5GX3A

Luciferin-regenerating enzyme collected with serial synchrotron rotational crystallography with accumulated dose of 6.9 mgy (6th measurement)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
307
structure length
307
Chain Sequence
GPVVEKIAELGKYTVGEGPHWDHETQTLYFVDTVEKTFHKYVPSQKKYTFCKVDKLVSFIIPLAGSPGRFVVSLEREIAILTWDGVSAAPTSIEAIVNVEPHIKNNRLNDGKADPLGNLWTGTMAIDAGLPIGPVTGSLYHLGADKKVKMHESNIAIANGLAWSNDLKKMYYIDSGKRRVDEYDYDASTLSISNQRPLFTFEKHEVPGYPDGQTIDEEGNLWVAVFQGQRIIKISTQQPEVLLDTVKIPDPQVTSVAFGGPNLDELYVTSAGLQLDDSSFDKSLVNGHVYRVTGLGVKGFAGVKVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Development of a dose-limiting data collection strategy for serial synchrotron rotation crystallography
pubmed doi rcsb
molecule keywords Luciferin regenerating enzyme
molecule tags Hydrolase
source organism Photinus pyralis
total genus 76
structure length 307
sequence length 307
ec nomenclature
pdb deposition date 2016-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08450 SGL SMP-30/Gluconolactonase/LRE-like region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 5gx3A00
1QLGA 3KYAA 2GVVA 1CRUA 3AMSA 4DG6A 2IAXA 2QE8A 3DR2A 3O4PA 1CVMA 1RWIA 2GHSA 2FP8A 3SOBB 2IVZA 3AMRA 3S8VA 4JMLA 2V91A 3SOVA 5GX2A 2OJHA 4HHQA 3S8ZA 2IARA 3WWAA 4GNCA 3KGGA 2VAQA 4GNBA 5GTQA 4O5SA 4GN8A 1E1AA 5GX4A 3G4EA 2W8BA 2IASA 2G8SA 2IAQA 3V65B 3LI5A 2GVXA 3U0SA 1C9UA 3LI3A 3S94A 1V04A 2POOA 1N7DA 1NPEA 4IMBA 2IATA 1H6LA 5D9CA 2DG1A 3S2KA 3FW0A 5FWWA 4R40A 1QBIA 2GVUA 4HW6A 3WW9A 2IAWA 2IAUA 4ZLRA 2IAVA 1IJQA 4PWZA 2W8BB 2FPBA 2FP9A 3FVZA 3E5ZA 4GN9A 3A9GA 3SOQA 1RWLA 3V1SA 3IAXA 4GNAA 4HHOA 1CRZA 1C5KA 3Q6KA 2ISMA 2DG0A 3TC9A 3LI4A 5D9BA 5GX5A 3A9HA 1CQ1A 2GVWA 3HLHA 3G4HA 2P4OA 3SRGA 1Q7FA 3V64C 3BYCA 3Q6PA 5GX3A 4GN7A 4A0PA 2IAOA 2FPCA 4O5TA 3Q6TA 5D9DA 1POOA 4Q1UA 3DASA 5GX1A 3HRPA 5EX7A 3HLIA 4IYGA 2HQSA 3P5BL 2IAPA 1PJXA 3SREA 2DSOA 3I1CA
chains in the Genus database with same CATH superfamily
4M4UA 3KYAA 2QWBA 3TI8A 1EUSA 1CRUA 4QN4A 2W38A 3BEQA 4G3NA 4XHXA 4FZHA 1IVFA 2RKCA 1ZGKA 4XOGA 3SOBB 4KS4A 1EURA 1Z4WA 1L7HA 1MZ5A 4D52C 4HHQA 4QNPA 1MS1A 3JU4A 2YA6A 2HTQA 3A71A 4FOQA 2VAQA 1Z4YA 4GZPA 4QN7A 4K1KA 4GN8A 4AGIA 2FLUX 4FPJA 4CPNA 5FZJA 2W8BA 4FP3A 4MWQA 3V65B 4YZ2A 2YA4A 1W1XA 2AH2A 4XILA 3U0SA 4AH4A 1C9UA 1EUTA 1V04A 5EO8A 4FVKA 3K3AA 1BJIA 1NMCA 1H6LA 1XOGA 1IVBA 1MS3A 5D9CA 2DG1A 3S2KA 3TIBA 2SLIA 4XHBA 4NN9A 3TI3A 1IVDA 4IFLX 1IVGA 4XJAA 4YZ1A 4IFJA 3WW9A 1E8TA 3CKZA 2F10A 2IAWA 2BERA 4MWLA 3VNHA 4N1BA 1NCBN 1NNAA 1N1TA 4YW1A 5HX0A 4FPCA 3OPZA 2W8BB 1W0PA 2QWCA 3NSSA 4MWXA 3FVZA 4MWWA 4KS1A 3A9GA 2F25A 2YDTA 5F9TA 3V1SA 2ZB5A 2ZW9A 2VPJA 2QWKA 4GZXA 2WOZA 1OFZA 1W8NA 4MX0A 1IUBA 2ISMA 4GEZA 3ALXA 3SALA 4XJ8A 2HU4A 3NO0A 4Q6KA 4WA4A 4UOUA 1V3EA 2GVWA 4B7JA 1INHA 1VCJA 1VCUA 2F29A 4XJ9A 3Q6PA 2QWGA 3NN9A 3GVKA 4A0PA 1V0EA 5EO7A 2YA8A 4NCSA 4SLIA 4WEGA 3DASA 5GX1A 1B9TA 4XMBA 4UF7A 5B2DA 1V0ZA 3P5BL 2IAPA 1DIMA 2F27A 2GVVA 1A4GA 3AMSA 4XJQA 4DG6A 1NNBA 2QE8A 2HTUA 4GZSA 2VSKA 3DR2A 1Z4XA 3TI6A 1W21A 1W0OA 3O4PA 4FPGA 5M1ZA 2HTRA 3II7A 1N6DA 4JMLA 3CL2A 3O9KA 1E8VA 5GX2A 1V2IA 4M4NA 2OJHA 2F24A 2B8HA 2QWJA 4FP2A 2VW1A 2IARA 3S8ZA 4GNCA 1IVEA 1DILA 4L7BA 4JF7A 1USXA 1MZ6A 4GNBA 2H2NA 3ZGCA 5GX4A 4XJWA 1Z4ZA 3VNGA 3G4EA 1IUCA 4AHAA 2G8SA 4GB1A 3LI5A 1MS8A 1V3DA 3INBA 4BBWA 1S18A 3S94A 2POOA 2YDPA 1NPEA 1F8CA 5F72C 3T1EA 4C1YA 1MS9A 1S0IA 4WA5A 1B9SA 3FW0A 4GZQA 4CSDA 2YA5A 4GDJA 3WDZA 4FPKA 4FQ4A 5HUNA 4WEFA 2XZJA 3D11A 1X2RA 2CMLA 4ZLRA 4XJZA 1IJQA 4IQKA 4CPZA 4B7QA 1INGA 4FOVA 4B7RA 4MWRA 4GN9A 1F8DA 2HT7A 3SOQA 4CPMA 2VWDA 4C1YB 1K32A 3IAXA 1C5KA 4D4UA 1SLIA 4QN3A 2VW2A 2X9MA 3LI4A 5D9BA 4YW3A 3TI5A 1NCCN 1WP5A 1WCSA 4X6KA 1SUUA 2QWAA 5NN9A 2IAOA 1L7GA 2FPCA 4B7NA 4FPYA 1Z4VA 4O5TA 1NCDN 2F26A 1SNTA 5FNSA 4Q1UA 1INVA 1S1DA 2A75A 5EX7A 1W8OA 4M4VA 4MWUA 2HQSA 4XMIA 1PJXA 1A14N 3I1CA 1QLGA 2DYHA 4CH9A 4ZY3A 2HTYA 4YW5A 5FNQA 3K36A 4CPOA 1SO7A 4YZ3A 2ZZKA 1N1YA 1RWIA 3B69A 2GHSA 2IVZA 3S8VA 2FHRA 2V91A 3CL0A 4FPHA 4MJVA 4XJUA 1ZI0A 2H2UA 4J9TA 2QWDA 1INYA 1NSDA 2QWIA 4AGTA 2QWEA 2JKBA 4MWJA 2XCYA 2F28A 1Z50A 4K1JA 4MWYA 2HU0A 4X49A 1KITA 4YZ4A 2HTWA 3TICA 2QWHA 2IASA 4HIZA 2IAQA 4FPEA 2C4LA 2AEPA 3WN7A 1IVCA 3LI3A 4ZGCA 2VW0A 4HZZA 4K1IA 4IFNX 1N7DA 4CPLA 3PJQA 2F0ZA 4GZTA 2W20A 2SIMA 1N6EA 4M3MA 4R40A 4X47A 1MS4A 3SLIA 4MWVA 1V3CA 1NSBA 1QBIA 4YW2A 5HUGA 4H52A 4NC5A 3ZGDA 2IAVA 2YA7A 2HTVA 4I00A 1N1SA 2FP9A 2F11A 2XZIA 3E5ZA 2ZB6A 1INXA 6NN9A 1NSCA 4FOWA 1RWLA 4KS2A 1CRZA 4HZXA 3Q6KA 1E8UA 4KS3A 4YY8A 2F12A 2VK5A 4GDIA 5GX5A 1V3BA 2P4OA 2HT5A 3V64C 3BYCA 4K1HA 4MJUA 3GVJA 2HT8A 5FNUA 1MR5A 4QN6A 1L7FA 5JYYA 2VK6A 3H71A 3A72A 3HRPA 2BATA 3W09A 4FPFA 7NN9A 4DGRA 4KS5A 4IYGA 5CGJA 1N1VA 1NNCA 1NN2A 4FJ6A 1NCAN 2AGSA 1W20A 4HZVA 1XOEA 4D52A 1SLLA 2IAXA 4XIKA 4MZAA 4ASCA 3K38A 1CVMA 2AEQA 2FP8A 4GZWA 3AMRA 1INFA 1V0FA 3SOVA 3K39A 5FZNA 3WWAA 2QWFA 4MC7A 3KGGA 5GTQA 2SILA 3H6JA 4O5SA 4XE9A 4D52B 1E1AA 2C4AA 4IN4A 4FPOB 4XYXA 4L7CA 2VSMA 2GVXA 3O9JA 4MZEA 3SANA 2XZKA 1B9VA 4IMBA 3B7EA 2IATA 4XMAA 1F8BA 4XIOA 1U6DX 3TI4A 2F13A 5FNRA 5FNTA 5FWWA 1MWEA 3TIAA 4CHBA 4D8SA 4CPYA 2GVUA 4HW6A 1N6FA 4GZOA 3GVLA 2IAUA 2W5NA 4PWZA 2FPBA 2BF6A 5B2CA 2XN4A 1X2JA 2BZDA 3H72A 4H53A 3ALWA 1USRA 1MS0A 2ZWAA 3D12A 4YZ5A 5HUKA 4GNAA 4HHOA 5HUMA 2VK7A 2DG0A 1WCQA 2VVZA 4HZWA 4QN5A 4WA3A 3TC9A 4B7MA 3A9HA 1A4QA 1CQ1A 3L6VA 1NMAN 3K37A 3HLHA 3G4HA 5H47A 3SRGA 1Q7FA 4FPLA 4L7DA 1F8EA 3UC1A 5GX3A 4GN7A 4XJRA 4K3YA 3Q6TA 5D9DA 4YW4A 1POOA 4HZYA 4FOYA 1NMBN 1MS5A 3H73A 3CYEA 2Z32A 1EUUA 3HLIA 1INWA 1S0JA 3ADEA 4GJTA 3SILA 2W5OA 4X4AA 3SREA 2DSOA
chains in the Genus database with same CATH topology
1QLGA 3KYAA 2GVVA 1CRUA 3AMSA 4DG6A 2IAXA 2QE8A 3DR2A 3O4PA 1CVMA 1RWIA 2GHSA 2FP8A 3SOBB 2IVZA 3AMRA 3S8VA 4JMLA 2V91A 3SOVA 5GX2A 2OJHA 4HHQA 3S8ZA 2IARA 3WWAA 4GNCA 3KGGA 2VAQA 4GNBA 5GTQA 4O5SA 4GN8A 1E1AA 5GX4A 3G4EA 2W8BA 2IASA 2G8SA 2IAQA 3V65B 3LI5A 2GVXA 3U0SA 1C9UA 3LI3A 3S94A 1V04A 2POOA 1N7DA 1NPEA 4IMBA 2IATA 1H6LA 5D9CA 2DG1A 3S2KA 3FW0A 5FWWA 4R40A 1QBIA 2GVUA 4HW6A 3WW9A 2IAWA 2IAUA 4ZLRA 2IAVA 1IJQA 4PWZA 2W8BB 2FPBA 2FP9A 3FVZA 3E5ZA 4GN9A 3A9GA 3SOQA 1RWLA 3V1SA 3IAXA 4GNAA 4HHOA 1CRZA 1C5KA 3Q6KA 2ISMA 2DG0A 3TC9A 3LI4A 5D9BA 5GX5A 3A9HA 1CQ1A 2GVWA 3HLHA 3G4HA 2P4OA 3SRGA 1Q7FA 3V64C 3BYCA 3Q6PA 5GX3A 4GN7A 4A0PA 2IAOA 2FPCA 4O5TA 3Q6TA 5D9DA 1POOA 4Q1UA 3DASA 5GX1A 3HRPA 5EX7A 3HLIA 4IYGA 2HQSA 3P5BL 2IAPA 1PJXA 3SREA 2DSOA 3I1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QLG A;  3KYA A;  2GVV A;  1CRU A;  3AMS A;  4DG6 A;  2IAX A;  2QE8 A;  3DR2 A;  3O4P A;  1CVM A;  1RWI A;  2GHS A;  2FP8 A;  3SOB B;  2IVZ A;  3AMR A;  3S8V A;  4JML A;  2V91 A;  3SOV A;  5GX2 A;  2OJH A;  4HHQ A;  3S8Z A;  2IAR A;  3WWA A;  4GNC A;  3KGG A;  2VAQ A;  4GNB A;  5GTQ A;  4O5S A;  4GN8 A;  1E1A A;  5GX4 A;  3G4E A;  2W8B A;  2IAS A;  2G8S A;  2IAQ A;  3V65 B;  3LI5 A;  2GVX A;  3U0S A;  1C9U A;  3LI3 A;  3S94 A;  1V04 A;  2POO A;  1N7D A;  1NPE A;  4IMB A;  2IAT A;  1H6L A;  5D9C A;  2DG1 A;  3S2K A;  3FW0 A;  5FWW A;  4R40 A;  1QBI A;  2GVU A;  4HW6 A;  3WW9 A;  2IAW A;  2IAU A;  4ZLR A;  2IAV A;  1IJQ A;  4PWZ A;  2W8B B;  2FPB A;  2FP9 A;  3FVZ A;  3E5Z A;  4GN9 A;  3A9G A;  3SOQ A;  1RWL A;  3V1S A;  3IAX A;  4GNA A;  4HHO A;  1CRZ A;  1C5K A;  3Q6K A;  2ISM A;  2DG0 A;  3TC9 A;  3LI4 A;  5D9B A;  5GX5 A;  3A9H A;  1CQ1 A;  2GVW A;  3HLH A;  3G4H A;  2P4O A;  3SRG A;  1Q7F A;  3V64 C;  3BYC A;  3Q6P A;  5GX3 A;  4GN7 A;  4A0P A;  2IAO A;  2FPC A;  4O5T A;  3Q6T A;  5D9D A;  1POO A;  4Q1U A;  3DAS A;  5GX1 A;  3HRP A;  5EX7 A;  3HLI A;  4IYG A;  2HQS A;  3P5B L;  2IAP A;  1PJX A;  3SRE A;  2DSO A;  3I1C A; 
#chains in the Genus database with same CATH topology
 4M4U A;  3KYA A;  2QWB A;  3TI8 A;  1EUS A;  1CRU A;  4QN4 A;  2W38 A;  3BEQ A;  4G3N A;  4XHX A;  4FZH A;  1IVF A;  2RKC A;  1ZGK A;  4XOG A;  3SOB B;  4KS4 A;  1EUR A;  1Z4W A;  1L7H A;  1MZ5 A;  4D52 C;  4HHQ A;  4QNP A;  1MS1 A;  3JU4 A;  2YA6 A;  2HTQ A;  3A71 A;  4FOQ A;  2VAQ A;  1Z4Y A;  4GZP A;  4QN7 A;  4K1K A;  4GN8 A;  4AGI A;  2FLU X;  4FPJ A;  4CPN A;  5FZJ A;  2W8B A;  4FP3 A;  4MWQ A;  3V65 B;  4YZ2 A;  2YA4 A;  1W1X A;  2AH2 A;  4XIL A;  3U0S A;  4AH4 A;  1C9U A;  1EUT A;  1V04 A;  5EO8 A;  4FVK A;  3K3A A;  1BJI A;  1NMC A;  1H6L A;  1XOG A;  1IVB A;  1MS3 A;  5D9C A;  2DG1 A;  3S2K A;  3TIB A;  2SLI A;  4XHB A;  4NN9 A;  3TI3 A;  1IVD A;  4IFL X;  1IVG A;  4XJA A;  4YZ1 A;  4IFJ A;  3WW9 A;  1E8T A;  3CKZ A;  2F10 A;  2IAW A;  2BER A;  4MWL A;  3VNH A;  4N1B A;  1NCB N;  1NNA A;  1N1T A;  4YW1 A;  5HX0 A;  4FPC A;  3OPZ A;  2W8B B;  1W0P A;  2QWC A;  3NSS A;  4MWX A;  3FVZ A;  4MWW A;  4KS1 A;  3A9G A;  2F25 A;  2YDT A;  5F9T A;  3V1S A;  2ZB5 A;  2ZW9 A;  2VPJ A;  2QWK A;  4GZX A;  2WOZ A;  1OFZ A;  1W8N A;  4MX0 A;  1IUB A;  2ISM A;  4GEZ A;  3ALX A;  3SAL A;  4XJ8 A;  2HU4 A;  3NO0 A;  4Q6K A;  4WA4 A;  4UOU A;  1V3E A;  2GVW A;  4B7J A;  1INH A;  1VCJ A;  1VCU A;  2F29 A;  4XJ9 A;  3Q6P A;  2QWG A;  3NN9 A;  3GVK A;  4A0P A;  1V0E A;  5EO7 A;  2YA8 A;  4NCS A;  4SLI A;  4WEG A;  3DAS A;  5GX1 A;  1B9T A;  4XMB A;  4UF7 A;  5B2D A;  1V0Z A;  3P5B L;  2IAP A;  1DIM A;  2F27 A;  2GVV A;  1A4G A;  3AMS A;  4XJQ A;  4DG6 A;  1NNB A;  2QE8 A;  2HTU A;  4GZS A;  2VSK A;  3DR2 A;  1Z4X A;  3TI6 A;  1W21 A;  1W0O A;  3O4P A;  4FPG A;  5M1Z A;  2HTR A;  3II7 A;  1N6D A;  4JML A;  3CL2 A;  3O9K A;  1E8V A;  5GX2 A;  1V2I A;  4M4N A;  2OJH A;  2F24 A;  2B8H A;  2QWJ A;  4FP2 A;  2VW1 A;  2IAR A;  3S8Z A;  4GNC A;  1IVE A;  1DIL A;  4L7B A;  4JF7 A;  1USX A;  1MZ6 A;  4GNB A;  2H2N A;  3ZGC A;  5GX4 A;  4XJW A;  1Z4Z A;  3VNG A;  3G4E A;  1IUC A;  4AHA A;  2G8S A;  4GB1 A;  3LI5 A;  1MS8 A;  1V3D A;  3INB A;  4BBW A;  1S18 A;  3S94 A;  2POO A;  2YDP A;  1NPE A;  1F8C A;  5F72 C;  3T1E A;  4C1Y A;  1MS9 A;  1S0I A;  4WA5 A;  1B9S A;  3FW0 A;  4GZQ A;  4CSD A;  2YA5 A;  4GDJ A;  3WDZ A;  4FPK A;  4FQ4 A;  5HUN A;  4WEF A;  2XZJ A;  3D11 A;  1X2R A;  2CML A;  4ZLR A;  4XJZ A;  1IJQ A;  4IQK A;  4CPZ A;  4B7Q A;  1ING A;  4FOV A;  4B7R A;  4MWR A;  4GN9 A;  1F8D A;  2HT7 A;  3SOQ A;  4CPM A;  2VWD A;  4C1Y B;  1K32 A;  3IAX A;  1C5K A;  4D4U A;  1SLI A;  4QN3 A;  2VW2 A;  2X9M A;  3LI4 A;  5D9B A;  4YW3 A;  3TI5 A;  1NCC N;  1WP5 A;  1WCS A;  4X6K A;  1SUU A;  2QWA A;  5NN9 A;  2IAO A;  1L7G A;  2FPC A;  4B7N A;  4FPY A;  1Z4V A;  4O5T A;  1NCD N;  2F26 A;  1SNT A;  5FNS A;  4Q1U A;  1INV A;  1S1D A;  2A75 A;  5EX7 A;  1W8O A;  4M4V A;  4MWU A;  2HQS A;  4XMI A;  1PJX A;  1A14 N;  3I1C A;  1QLG A;  2DYH A;  4CH9 A;  4ZY3 A;  2HTY A;  4YW5 A;  5FNQ A;  3K36 A;  4CPO A;  1SO7 A;  4YZ3 A;  2ZZK A;  1N1Y A;  1RWI A;  3B69 A;  2GHS A;  2IVZ A;  3S8V A;  2FHR A;  2V91 A;  3CL0 A;  4FPH A;  4MJV A;  4XJU A;  1ZI0 A;  2H2U A;  4J9T A;  2QWD A;  1INY A;  1NSD A;  2QWI A;  4AGT A;  2QWE A;  2JKB A;  4MWJ A;  2XCY A;  2F28 A;  1Z50 A;  4K1J A;  4MWY A;  2HU0 A;  4X49 A;  1KIT A;  4YZ4 A;  2HTW A;  3TIC A;  2QWH A;  2IAS A;  4HIZ A;  2IAQ A;  4FPE A;  2C4L A;  2AEP A;  3WN7 A;  1IVC A;  3LI3 A;  4ZGC A;  2VW0 A;  4HZZ A;  4K1I A;  4IFN X;  1N7D A;  4CPL A;  3PJQ A;  2F0Z A;  4GZT A;  2W20 A;  2SIM A;  1N6E A;  4M3M A;  4R40 A;  4X47 A;  1MS4 A;  3SLI A;  4MWV A;  1V3C A;  1NSB A;  1QBI A;  4YW2 A;  5HUG A;  4H52 A;  4NC5 A;  3ZGD A;  2IAV A;  2YA7 A;  2HTV A;  4I00 A;  1N1S A;  2FP9 A;  2F11 A;  2XZI A;  3E5Z A;  2ZB6 A;  1INX A;  6NN9 A;  1NSC A;  4FOW A;  1RWL A;  4KS2 A;  1CRZ A;  4HZX A;  3Q6K A;  1E8U A;  4KS3 A;  4YY8 A;  2F12 A;  2VK5 A;  4GDI A;  5GX5 A;  1V3B A;  2P4O A;  2HT5 A;  3V64 C;  3BYC A;  4K1H A;  4MJU A;  3GVJ A;  2HT8 A;  5FNU A;  1MR5 A;  4QN6 A;  1L7F A;  5JYY A;  2VK6 A;  3H71 A;  3A72 A;  3HRP A;  2BAT A;  3W09 A;  4FPF A;  7NN9 A;  4DGR A;  4KS5 A;  4IYG A;  5CGJ A;  1N1V A;  1NNC A;  1NN2 A;  4FJ6 A;  1NCA N;  2AGS A;  1W20 A;  4HZV A;  1XOE A;  4D52 A;  1SLL A;  2IAX A;  4XIK A;  4MZA A;  4ASC A;  3K38 A;  1CVM A;  2AEQ A;  2FP8 A;  4GZW A;  3AMR A;  1INF A;  1V0F A;  3SOV A;  3K39 A;  5FZN A;  3WWA A;  2QWF A;  4MC7 A;  3KGG A;  5GTQ A;  2SIL A;  3H6J A;  4O5S A;  4XE9 A;  4D52 B;  1E1A A;  2C4A A;  4IN4 A;  4FPO B;  4XYX A;  4L7C A;  2VSM A;  2GVX A;  3O9J A;  4MZE A;  3SAN A;  2XZK A;  1B9V A;  4IMB A;  3B7E A;  2IAT A;  4XMA A;  1F8B A;  4XIO A;  1U6D X;  3TI4 A;  2F13 A;  5FNR A;  5FNT A;  5FWW A;  1MWE A;  3TIA A;  4CHB A;  4D8S A;  4CPY A;  2GVU A;  4HW6 A;  1N6F A;  4GZO A;  3GVL A;  2IAU A;  2W5N A;  4PWZ A;  2FPB A;  2BF6 A;  5B2C A;  2XN4 A;  1X2J A;  2BZD A;  3H72 A;  4H53 A;  3ALW A;  1USR A;  1MS0 A;  2ZWA A;  3D12 A;  4YZ5 A;  5HUK A;  4GNA A;  4HHO A;  5HUM A;  2VK7 A;  2DG0 A;  1WCQ A;  2VVZ A;  4HZW A;  4QN5 A;  4WA3 A;  3TC9 A;  4B7M A;  3A9H A;  1A4Q A;  1CQ1 A;  3L6V A;  1NMA N;  3K37 A;  3HLH A;  3G4H A;  5H47 A;  3SRG A;  1Q7F A;  4FPL A;  4L7D A;  1F8E A;  3UC1 A;  5GX3 A;  4GN7 A;  4XJR A;  4K3Y A;  3Q6T A;  5D9D A;  4YW4 A;  1POO A;  4HZY A;  4FOY A;  1NMB N;  1MS5 A;  3H73 A;  3CYE A;  2Z32 A;  1EUU A;  3HLI A;  1INW A;  1S0J A;  3ADE A;  4GJT A;  3SIL A;  2W5O A;  4X4A A;  3SRE A;  2DSO A; 
#chains in the Genus database with same CATH homology
 1QLG A;  3KYA A;  2GVV A;  1CRU A;  3AMS A;  4DG6 A;  2IAX A;  2QE8 A;  3DR2 A;  3O4P A;  1CVM A;  1RWI A;  2GHS A;  2FP8 A;  3SOB B;  2IVZ A;  3AMR A;  3S8V A;  4JML A;  2V91 A;  3SOV A;  5GX2 A;  2OJH A;  4HHQ A;  3S8Z A;  2IAR A;  3WWA A;  4GNC A;  3KGG A;  2VAQ A;  4GNB A;  5GTQ A;  4O5S A;  4GN8 A;  1E1A A;  5GX4 A;  3G4E A;  2W8B A;  2IAS A;  2G8S A;  2IAQ A;  3V65 B;  3LI5 A;  2GVX A;  3U0S A;  1C9U A;  3LI3 A;  3S94 A;  1V04 A;  2POO A;  1N7D A;  1NPE A;  4IMB A;  2IAT A;  1H6L A;  5D9C A;  2DG1 A;  3S2K A;  3FW0 A;  5FWW A;  4R40 A;  1QBI A;  2GVU A;  4HW6 A;  3WW9 A;  2IAW A;  2IAU A;  4ZLR A;  2IAV A;  1IJQ A;  4PWZ A;  2W8B B;  2FPB A;  2FP9 A;  3FVZ A;  3E5Z A;  4GN9 A;  3A9G A;  3SOQ A;  1RWL A;  3V1S A;  3IAX A;  4GNA A;  4HHO A;  1CRZ A;  1C5K A;  3Q6K A;  2ISM A;  2DG0 A;  3TC9 A;  3LI4 A;  5D9B A;  5GX5 A;  3A9H A;  1CQ1 A;  2GVW A;  3HLH A;  3G4H A;  2P4O A;  3SRG A;  1Q7F A;  3V64 C;  3BYC A;  3Q6P A;  5GX3 A;  4GN7 A;  4A0P A;  2IAO A;  2FPC A;  4O5T A;  3Q6T A;  5D9D A;  1POO A;  4Q1U A;  3DAS A;  5GX1 A;  3HRP A;  5EX7 A;  3HLI A;  4IYG A;  2HQS A;  3P5B L;  2IAP A;  1PJX A;  3SRE A;  2DSO A;  3I1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...