5GX4A

Luciferin-regenerating enzyme collected with serial synchrotron rotational crystallography with accumulated dose of 14 mgy (12th measurement)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
307
structure length
307
Chain Sequence
GPVVEKIAELGKYTVGEGPHWDHETQTLYFVDTVEKTFHKYVPSQKKYTFCKVDKLVSFIIPLAGSPGRFVVSLEREIAILTWDGVSAAPTSIEAIVNVEPHIKNNRLNDGKADPLGNLWTGTMAIDAGLPIGPVTGSLYHLGADKKVKMHESNIAIANGLAWSNDLKKMYYIDSGKRRVDEYDYDASTLSISNQRPLFTFEKHEVPGYPDGQTIDEEGNLWVAVFQGQRIIKISTQQPEVLLDTVKIPDPQVTSVAFGGPNLDELYVTSAGLQLDDSSFDKSLVNGHVYRVTGLGVKGFAGVKVKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Development of a dose-limiting data collection strategy for serial synchrotron rotation crystallography
pubmed doi rcsb
molecule keywords Luciferin regenerating enzyme
molecule tags Hydrolase
source organism Photinus pyralis
total genus 76
structure length 307
sequence length 307
ec nomenclature
pdb deposition date 2016-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08450 SGL SMP-30/Gluconolactonase/LRE-like region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.30 Mainly Beta 6 Propeller Neuraminidase TolB, C-terminal domain 5gx4A00
1QLGA 3SOVA 1RWLA 2HQSA 4GNBA 3SREA 1CRUA 5GX2A 1CRZA 3FVZA 4GN9A 4JMLA 3Q6PA 4GN8A 4HW6A 2GVXA 2FPCA 2IATA 3V64C 3KYAA 3S2KA 4GNAA 1V04A 3SRGA 3G4HA 5GX3A 3A9HA 3KGGA 2QE8A 5EX7A 1POOA 3E5ZA 2W8BA 2GVUA 4A0PA 2V91A 2IAVA 2IAXA 4DG6A 5D9DA 2GHSA 1C9UA 4IMBA 3TC9A 4ZLRA 3S8VA 4HHOA 3WWAA 4GN7A 3SOQA 4GNCA 5D9CA 2POOA 3LI3A 1CVMA 3HLIA 2FP8A 2G8SA 2IVZA 2VAQA 4IYGA 3AMRA 2IAOA 2GVWA 4PWZA 3A9GA 3LI4A 2FP9A 2IAPA 1CQ1A 1N7DA 1C5KA 3AMSA 5D9BA 5GX4A 2IAUA 5GX1A 3LI5A 3Q6KA 1RWIA 2W8BB 4O5TA 3DR2A 3FW0A 5GX5A 4R40A 2FPBA 2DG0A 2P4OA 5GTQA 2IAWA 3G4EA 2IAQA 3U0SA 1IJQA 2GVVA 2DG1A 3S94A 1QBIA 1NPEA 2DSOA 3HRPA 3IAXA 3HLHA 3O4PA 3BYCA 2ISMA 1H6LA 2OJHA 4O5SA 3V65B 3S8ZA 1E1AA 4HHQA 5FWWA 3SOBB 3P5BL 4Q1UA 1Q7FA 3I1CA 1PJXA 3WW9A 2IASA 3V1SA 3Q6TA 2IARA 3DASA
chains in the Genus database with same CATH superfamily
2BF6A 1QLGA 1MR5A 2HQSA 1NSDA 4IFLX 4GNBA 3SILA 1IVGA 4I00A 4JF7A 5GX2A 4HIZA 1N6EA 1XOEA 4MZEA 2H2UA 4GZWA 1F8EA 4FOQA 1NNCA 4X6KA 4FPYA 2F12A 3Q6PA 4JMLA 4M3MA 3WDZA 2GVXA 3CYEA 4MWUA 1IVBA 3H73A 4GNAA 3SRGA 1MS1A 3A9HA 3ZGDA 2ZB5A 2A75A 1POOA 4KS3A 4FPCA 4K1KA 2W8BA 4SLIA 3INBA 4A0PA 1SLLA 3TI6A 1S18A 1V3BA 1IVDA 4AGIA 4MZAA 4GJTA 4FPOB 3UC1A 1N1SA 2HTRA 4HZXA 1L7GA 3VNGA 4CPMA 2IAXA 4KS5A 1VCJA 1DILA 2GHSA 2QWBA 1C9UA 1W0PA 1IUBA 5JYYA 4CPZA 5FNUA 4FPGA 4NN9A 4YZ4A 4FPEA 2ZW9A 3ALXA 4XJRA 3HLIA 4BBWA 3PJQA 4C1YA 2FLUX 5B2DA 4MWVA 2VAQA 2W38A 3AMRA 4FOVA 3K3AA 4FVKA 3A9GA 4QN4A 4D52A 4UOUA 1INGA 4GZPA 5GX1A 2XZIA 4X4AA 2HU0A 3B7EA 1MZ6A 3W09A 2QWEA 3H72A 2HTVA 1B9VA 1Z4VA 1W1XA 1MWEA 2QWIA 3S94A 1QBIA 3HLHA 2QWKA 2HU4A 3B69A 4D52C 3BYCA 2AEPA 1A4GA 1F8BA 1KITA 1Z4WA 4HHQA 1NMAN 3GVLA 5FZJA 4Q1UA 1PJXA 2IASA 4KS4A 3Q6TA 1SNTA 2XCYA 3SREA 2RKCA 4M4VA 2AH2A 2F26A 3D11A 1V3DA 3NSSA 4L7CA 3H6JA 4GN9A 4YZ2A 1NSBA 4ZGCA 2HTYA 4MWWA 4YZ3A 1OFZA 1EURA 3WN7A 4YW3A 1EUSA 4XJ9A 2F25A 4QN3A 2X9MA 4CHBA 3E5ZA 4MX0A 3TIBA 2GVUA 1X2JA 1EUUA 5EO7A 1V3EA 3SANA 2QWHA 4B7NA 2VW2A 1NCDN 4IFJA 3ALWA 4XIOA 3GVKA 1MS4A 4HZYA 4XJAA 1INWA 1SLIA 4YZ1A 2ZB6A 4HZZA 1W8OA 2WOZA 5D9DA 4D8SA 4QN5A 4IMBA 2VK5A 2W20A 4XE9A 5FZNA 3K36A 4FZHA 3TI5A 4ZLRA 4WA3A 1MZ5A 1INVA 3O9JA 5HUNA 3H71A 4QN6A 4AGTA 2G8SA 1K32A 4B7JA 4FP2A 1E8VA 2IAOA 1A14N 4HZVA 5FNRA 4D4UA 5D9BA 5GX4A 2CMLA 2QWCA 1N1YA 2IAUA 1L7HA 3A72A 4X47A 1RWIA 2W8BB 3FW0A 4K3YA 1ZGKA 2VW0A 2P4OA 3G4EA 1U6DX 1IJQA 4XJZA 2YA5A 4YZ5A 2GVVA 2DG1A 4GDJA 4MWYA 2DSOA 3IAXA 1E8UA 3O4PA 1V0EA 5FNTA 5EO8A 3ADEA 1N6FA 2F13A 2QWGA 2F27A 4MWQA 4GZTA 4CPLA 5HX0A 4MC7A 3SOBB 3P5BL 3I1CA 5F72C 3NN9A 4XYXA 4GZOA 3WW9A 3L6VA 1USXA 2QWDA 1NNAA 2W5OA 4C1YB 2ZZKA 2B8HA 4XJWA 1MS3A 4XJUA 4MJUA 2F28A 1CRUA 5NN9A 3TIAA 2HTUA 4D52B 1Z50A 2VPJA 1WP5A 4GN8A 1Z4ZA 4HW6A 4XMIA 1F8CA 4YW5A 3V64C 4FPLA 2HT5A 1XOGA 1V04A 3K38A 3O9KA 2YDPA 4L7DA 1V0FA 5EX7A 4MWXA 1IVEA 1W21A 5HUKA 4WEGA 2YA4A 2QWFA 4FP3A 1INHA 5FNQA 2V91A 4XMAA 2IAVA 4XJ8A 1INFA 1NMCA 4QNPA 5B2CA 1MS5A 1EUTA 3CKZA 2AGSA 2BATA 2F0ZA 2W5NA 2H2NA 2HTQA 4K1JA 4DG6A 4CSDA 2C4LA 4DGRA 2YDTA 7NN9A 2SIMA 2VW1A 2VSMA 2YA7A 4GNCA 4N1BA 1F8DA 4MWJA 2BERA 2FP8A 4GZSA 2F29A 4YW4A 2IVZA 2VSKA 3JU4A 4IYGA 1X2RA 4H52A 4QN7A 1V2IA 2IAPA 1E8TA 1V3CA 1NCBN 1SO7A 4AHAA 1C5KA 3D12A 2XN4A 1BJIA 3LI5A 4Q6KA 3CL2A 1MS9A 3NO0A 3DR2A 4O5TA 5GX5A 3SLIA 3TI4A 2FPBA 4XIKA 2DG0A 4FPFA 4M4UA 4X49A 1NMBN 4KS2A 4AH4A 2Z32A 4MWRA 4YY8A 4FPJA 2SLIA 1NPEA 1IVFA 1W8NA 2F24A 1H6LA 2OJHA 2XZJA 3S8ZA 3CL0A 1VCUA 1E1AA 1S0JA 5FWWA 4YW2A 4K1HA 4FOYA 4H53A 4MWLA 4FQ4A 4IQKA 3V1SA 4CPOA 6NN9A 1A4QA 5CGJA 3II7A 2IARA 1RWLA 4CPNA 4GZQA 3SOVA 1V0ZA 1WCSA 2HTWA 1NNBA 2JKBA 4KS1A 3T1EA 4CH9A 3SALA 5F9TA 1INYA 1CRZA 1N1TA 5HUMA 3FVZA 3ZGCA 1NCCN 2ZWAA 2VVZA 3K39A 1MS0A 4ZY3A 1DIMA 1WCQA 2FPCA 2IATA 4G3NA 4FOWA 5H47A 4L7BA 3KYAA 3S2KA 2VK6A 4IFNX 4NC5A 3GVJA 4YW1A 3G4HA 4XOGA 5GX3A 1MS8A 3KGGA 2QE8A 4WA5A 2VK7A 1Z4XA 1IUCA 4IN4A 1S0IA 1B9SA 3BEQA 2BZDA 1NCAN 2AEQA 5HUGA 4FJ6A 2HT8A 4XMBA 5M1ZA 2C4AA 2YA8A 2DYHA 4UF7A 1N1VA 4GB1A 4GDIA 1NSCA 4WEFA 3K37A 3TC9A 4FPHA 3TI3A 2FHRA 3OPZA 2XZKA 4WA4A 3S8VA 1B9TA 4HHOA 3WWAA 2YA6A 4GN7A 3SOQA 5D9CA 2POOA 3LI3A 1CVMA 1S1DA 2QWAA 4J9TA 4XHXA 4HZWA 5FNSA 1Z4YA 2GVWA 4PWZA 3LI4A 4K1IA 4GEZA 2FP9A 4CPYA 1L7FA 4XILA 1CQ1A 1N7DA 4NCSA 3AMSA 2F11A 1NN2A 1IVCA 3Q6KA 4M4NA 4B7MA 4R40A 5GTQA 2IAWA 1W0OA 1ZI0A 2IAQA 3U0SA 3A71A 4GZXA 1N6DA 4XJQA 3HRPA 2F10A 1INXA 2ISMA 3TI8A 2VWDA 4O5SA 1SUUA 3V65B 4B7QA 4FPKA 1W20A 4B7RA 2QWJA 1Q7FA 1USRA 4XHBA 2SILA 3VNHA 4ASCA 4MJVA 3DASA 3TICA 2HT7A
chains in the Genus database with same CATH topology
1QLGA 3SOVA 1RWLA 2HQSA 4GNBA 3SREA 1CRUA 5GX2A 1CRZA 3FVZA 4GN9A 4JMLA 3Q6PA 4GN8A 4HW6A 2GVXA 2FPCA 2IATA 3V64C 3KYAA 3S2KA 4GNAA 1V04A 3SRGA 3G4HA 5GX3A 3A9HA 3KGGA 2QE8A 5EX7A 1POOA 3E5ZA 2W8BA 2GVUA 4A0PA 2V91A 2IAVA 2IAXA 4DG6A 5D9DA 2GHSA 1C9UA 4IMBA 3TC9A 4ZLRA 3S8VA 4HHOA 3WWAA 4GN7A 3SOQA 4GNCA 5D9CA 2POOA 3LI3A 1CVMA 3HLIA 2FP8A 2G8SA 2IVZA 2VAQA 4IYGA 3AMRA 2IAOA 2GVWA 4PWZA 3A9GA 3LI4A 2FP9A 2IAPA 1CQ1A 1N7DA 1C5KA 3AMSA 5D9BA 5GX4A 2IAUA 5GX1A 3LI5A 3Q6KA 1RWIA 2W8BB 4O5TA 3DR2A 3FW0A 5GX5A 4R40A 2FPBA 2DG0A 2P4OA 5GTQA 2IAWA 3G4EA 2IAQA 3U0SA 1IJQA 2GVVA 2DG1A 3S94A 1QBIA 1NPEA 2DSOA 3HRPA 3IAXA 3HLHA 3O4PA 3BYCA 2ISMA 1H6LA 2OJHA 4O5SA 3V65B 3S8ZA 1E1AA 4HHQA 5FWWA 3SOBB 3P5BL 4Q1UA 1Q7FA 3I1CA 1PJXA 3WW9A 2IASA 3V1SA 3Q6TA 2IARA 3DASA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QLG A;  3SOV A;  1RWL A;  2HQS A;  4GNB A;  3SRE A;  1CRU A;  5GX2 A;  1CRZ A;  3FVZ A;  4GN9 A;  4JML A;  3Q6P A;  4GN8 A;  4HW6 A;  2GVX A;  2FPC A;  2IAT A;  3V64 C;  3KYA A;  3S2K A;  4GNA A;  1V04 A;  3SRG A;  3G4H A;  5GX3 A;  3A9H A;  3KGG A;  2QE8 A;  5EX7 A;  1POO A;  3E5Z A;  2W8B A;  2GVU A;  4A0P A;  2V91 A;  2IAV A;  2IAX A;  4DG6 A;  5D9D A;  2GHS A;  1C9U A;  4IMB A;  3TC9 A;  4ZLR A;  3S8V A;  4HHO A;  3WWA A;  4GN7 A;  3SOQ A;  4GNC A;  5D9C A;  2POO A;  3LI3 A;  1CVM A;  3HLI A;  2FP8 A;  2G8S A;  2IVZ A;  2VAQ A;  4IYG A;  3AMR A;  2IAO A;  2GVW A;  4PWZ A;  3A9G A;  3LI4 A;  2FP9 A;  2IAP A;  1CQ1 A;  1N7D A;  1C5K A;  3AMS A;  5D9B A;  5GX4 A;  2IAU A;  5GX1 A;  3LI5 A;  3Q6K A;  1RWI A;  2W8B B;  4O5T A;  3DR2 A;  3FW0 A;  5GX5 A;  4R40 A;  2FPB A;  2DG0 A;  2P4O A;  5GTQ A;  2IAW A;  3G4E A;  2IAQ A;  3U0S A;  1IJQ A;  2GVV A;  2DG1 A;  3S94 A;  1QBI A;  1NPE A;  2DSO A;  3HRP A;  3IAX A;  3HLH A;  3O4P A;  3BYC A;  2ISM A;  1H6L A;  2OJH A;  4O5S A;  3V65 B;  3S8Z A;  1E1A A;  4HHQ A;  5FWW A;  3SOB B;  3P5B L;  4Q1U A;  1Q7F A;  3I1C A;  1PJX A;  3WW9 A;  2IAS A;  3V1S A;  3Q6T A;  2IAR A;  3DAS A; 
#chains in the Genus database with same CATH topology
 2BF6 A;  1QLG A;  1MR5 A;  2HQS A;  1NSD A;  4IFL X;  4GNB A;  3SIL A;  1IVG A;  4I00 A;  4JF7 A;  5GX2 A;  4HIZ A;  1N6E A;  1XOE A;  4MZE A;  2H2U A;  4GZW A;  1F8E A;  4FOQ A;  1NNC A;  4X6K A;  4FPY A;  2F12 A;  3Q6P A;  4JML A;  4M3M A;  3WDZ A;  2GVX A;  3CYE A;  4MWU A;  1IVB A;  3H73 A;  4GNA A;  3SRG A;  1MS1 A;  3A9H A;  3ZGD A;  2ZB5 A;  2A75 A;  1POO A;  4KS3 A;  4FPC A;  4K1K A;  2W8B A;  4SLI A;  3INB A;  4A0P A;  1SLL A;  3TI6 A;  1S18 A;  1V3B A;  1IVD A;  4AGI A;  4MZA A;  4GJT A;  4FPO B;  3UC1 A;  1N1S A;  2HTR A;  4HZX A;  1L7G A;  3VNG A;  4CPM A;  2IAX A;  4KS5 A;  1VCJ A;  1DIL A;  2GHS A;  2QWB A;  1C9U A;  1W0P A;  1IUB A;  5JYY A;  4CPZ A;  5FNU A;  4FPG A;  4NN9 A;  4YZ4 A;  4FPE A;  2ZW9 A;  3ALX A;  4XJR A;  3HLI A;  4BBW A;  3PJQ A;  4C1Y A;  2FLU X;  5B2D A;  4MWV A;  2VAQ A;  2W38 A;  3AMR A;  4FOV A;  3K3A A;  4FVK A;  3A9G A;  4QN4 A;  4D52 A;  4UOU A;  1ING A;  4GZP A;  5GX1 A;  2XZI A;  4X4A A;  2HU0 A;  3B7E A;  1MZ6 A;  3W09 A;  2QWE A;  3H72 A;  2HTV A;  1B9V A;  1Z4V A;  1W1X A;  1MWE A;  2QWI A;  3S94 A;  1QBI A;  3HLH A;  2QWK A;  2HU4 A;  3B69 A;  4D52 C;  3BYC A;  2AEP A;  1A4G A;  1F8B A;  1KIT A;  1Z4W A;  4HHQ A;  1NMA N;  3GVL A;  5FZJ A;  4Q1U A;  1PJX A;  2IAS A;  4KS4 A;  3Q6T A;  1SNT A;  2XCY A;  3SRE A;  2RKC A;  4M4V A;  2AH2 A;  2F26 A;  3D11 A;  1V3D A;  3NSS A;  4L7C A;  3H6J A;  4GN9 A;  4YZ2 A;  1NSB A;  4ZGC A;  2HTY A;  4MWW A;  4YZ3 A;  1OFZ A;  1EUR A;  3WN7 A;  4YW3 A;  1EUS A;  4XJ9 A;  2F25 A;  4QN3 A;  2X9M A;  4CHB A;  3E5Z A;  4MX0 A;  3TIB A;  2GVU A;  1X2J A;  1EUU A;  5EO7 A;  1V3E A;  3SAN A;  2QWH A;  4B7N A;  2VW2 A;  1NCD N;  4IFJ A;  3ALW A;  4XIO A;  3GVK A;  1MS4 A;  4HZY A;  4XJA A;  1INW A;  1SLI A;  4YZ1 A;  2ZB6 A;  4HZZ A;  1W8O A;  2WOZ A;  5D9D A;  4D8S A;  4QN5 A;  4IMB A;  2VK5 A;  2W20 A;  4XE9 A;  5FZN A;  3K36 A;  4FZH A;  3TI5 A;  4ZLR A;  4WA3 A;  1MZ5 A;  1INV A;  3O9J A;  5HUN A;  3H71 A;  4QN6 A;  4AGT A;  2G8S A;  1K32 A;  4B7J A;  4FP2 A;  1E8V A;  2IAO A;  1A14 N;  4HZV A;  5FNR A;  4D4U A;  5D9B A;  5GX4 A;  2CML A;  2QWC A;  1N1Y A;  2IAU A;  1L7H A;  3A72 A;  4X47 A;  1RWI A;  2W8B B;  3FW0 A;  4K3Y A;  1ZGK A;  2VW0 A;  2P4O A;  3G4E A;  1U6D X;  1IJQ A;  4XJZ A;  2YA5 A;  4YZ5 A;  2GVV A;  2DG1 A;  4GDJ A;  4MWY A;  2DSO A;  3IAX A;  1E8U A;  3O4P A;  1V0E A;  5FNT A;  5EO8 A;  3ADE A;  1N6F A;  2F13 A;  2QWG A;  2F27 A;  4MWQ A;  4GZT A;  4CPL A;  5HX0 A;  4MC7 A;  3SOB B;  3P5B L;  3I1C A;  5F72 C;  3NN9 A;  4XYX A;  4GZO A;  3WW9 A;  3L6V A;  1USX A;  2QWD A;  1NNA A;  2W5O A;  4C1Y B;  2ZZK A;  2B8H A;  4XJW A;  1MS3 A;  4XJU A;  4MJU A;  2F28 A;  1CRU A;  5NN9 A;  3TIA A;  2HTU A;  4D52 B;  1Z50 A;  2VPJ A;  1WP5 A;  4GN8 A;  1Z4Z A;  4HW6 A;  4XMI A;  1F8C A;  4YW5 A;  3V64 C;  4FPL A;  2HT5 A;  1XOG A;  1V04 A;  3K38 A;  3O9K A;  2YDP A;  4L7D A;  1V0F A;  5EX7 A;  4MWX A;  1IVE A;  1W21 A;  5HUK A;  4WEG A;  2YA4 A;  2QWF A;  4FP3 A;  1INH A;  5FNQ A;  2V91 A;  4XMA A;  2IAV A;  4XJ8 A;  1INF A;  1NMC A;  4QNP A;  5B2C A;  1MS5 A;  1EUT A;  3CKZ A;  2AGS A;  2BAT A;  2F0Z A;  2W5N A;  2H2N A;  2HTQ A;  4K1J A;  4DG6 A;  4CSD A;  2C4L A;  4DGR A;  2YDT A;  7NN9 A;  2SIM A;  2VW1 A;  2VSM A;  2YA7 A;  4GNC A;  4N1B A;  1F8D A;  4MWJ A;  2BER A;  2FP8 A;  4GZS A;  2F29 A;  4YW4 A;  2IVZ A;  2VSK A;  3JU4 A;  4IYG A;  1X2R A;  4H52 A;  4QN7 A;  1V2I A;  2IAP A;  1E8T A;  1V3C A;  1NCB N;  1SO7 A;  4AHA A;  1C5K A;  3D12 A;  2XN4 A;  1BJI A;  3LI5 A;  4Q6K A;  3CL2 A;  1MS9 A;  3NO0 A;  3DR2 A;  4O5T A;  5GX5 A;  3SLI A;  3TI4 A;  2FPB A;  4XIK A;  2DG0 A;  4FPF A;  4M4U A;  4X49 A;  1NMB N;  4KS2 A;  4AH4 A;  2Z32 A;  4MWR A;  4YY8 A;  4FPJ A;  2SLI A;  1NPE A;  1IVF A;  1W8N A;  2F24 A;  1H6L A;  2OJH A;  2XZJ A;  3S8Z A;  3CL0 A;  1VCU A;  1E1A A;  1S0J A;  5FWW A;  4YW2 A;  4K1H A;  4FOY A;  4H53 A;  4MWL A;  4FQ4 A;  4IQK A;  3V1S A;  4CPO A;  6NN9 A;  1A4Q A;  5CGJ A;  3II7 A;  2IAR A;  1RWL A;  4CPN A;  4GZQ A;  3SOV A;  1V0Z A;  1WCS A;  2HTW A;  1NNB A;  2JKB A;  4KS1 A;  3T1E A;  4CH9 A;  3SAL A;  5F9T A;  1INY A;  1CRZ A;  1N1T A;  5HUM A;  3FVZ A;  3ZGC A;  1NCC N;  2ZWA A;  2VVZ A;  3K39 A;  1MS0 A;  4ZY3 A;  1DIM A;  1WCQ A;  2FPC A;  2IAT A;  4G3N A;  4FOW A;  5H47 A;  4L7B A;  3KYA A;  3S2K A;  2VK6 A;  4IFN X;  4NC5 A;  3GVJ A;  4YW1 A;  3G4H A;  4XOG A;  5GX3 A;  1MS8 A;  3KGG A;  2QE8 A;  4WA5 A;  2VK7 A;  1Z4X A;  1IUC A;  4IN4 A;  1S0I A;  1B9S A;  3BEQ A;  2BZD A;  1NCA N;  2AEQ A;  5HUG A;  4FJ6 A;  2HT8 A;  4XMB A;  5M1Z A;  2C4A A;  2YA8 A;  2DYH A;  4UF7 A;  1N1V A;  4GB1 A;  4GDI A;  1NSC A;  4WEF A;  3K37 A;  3TC9 A;  4FPH A;  3TI3 A;  2FHR A;  3OPZ A;  2XZK A;  4WA4 A;  3S8V A;  1B9T A;  4HHO A;  3WWA A;  2YA6 A;  4GN7 A;  3SOQ A;  5D9C A;  2POO A;  3LI3 A;  1CVM A;  1S1D A;  2QWA A;  4J9T A;  4XHX A;  4HZW A;  5FNS A;  1Z4Y A;  2GVW A;  4PWZ A;  3LI4 A;  4K1I A;  4GEZ A;  2FP9 A;  4CPY A;  1L7F A;  4XIL A;  1CQ1 A;  1N7D A;  4NCS A;  3AMS A;  2F11 A;  1NN2 A;  1IVC A;  3Q6K A;  4M4N A;  4B7M A;  4R40 A;  5GTQ A;  2IAW A;  1W0O A;  1ZI0 A;  2IAQ A;  3U0S A;  3A71 A;  4GZX A;  1N6D A;  4XJQ A;  3HRP A;  2F10 A;  1INX A;  2ISM A;  3TI8 A;  2VWD A;  4O5S A;  1SUU A;  3V65 B;  4B7Q A;  4FPK A;  1W20 A;  4B7R A;  2QWJ A;  1Q7F A;  1USR A;  4XHB A;  2SIL A;  3VNH A;  4ASC A;  4MJV A;  3DAS A;  3TIC A;  2HT7 A; 
#chains in the Genus database with same CATH homology
 1QLG A;  3SOV A;  1RWL A;  2HQS A;  4GNB A;  3SRE A;  1CRU A;  5GX2 A;  1CRZ A;  3FVZ A;  4GN9 A;  4JML A;  3Q6P A;  4GN8 A;  4HW6 A;  2GVX A;  2FPC A;  2IAT A;  3V64 C;  3KYA A;  3S2K A;  4GNA A;  1V04 A;  3SRG A;  3G4H A;  5GX3 A;  3A9H A;  3KGG A;  2QE8 A;  5EX7 A;  1POO A;  3E5Z A;  2W8B A;  2GVU A;  4A0P A;  2V91 A;  2IAV A;  2IAX A;  4DG6 A;  5D9D A;  2GHS A;  1C9U A;  4IMB A;  3TC9 A;  4ZLR A;  3S8V A;  4HHO A;  3WWA A;  4GN7 A;  3SOQ A;  4GNC A;  5D9C A;  2POO A;  3LI3 A;  1CVM A;  3HLI A;  2FP8 A;  2G8S A;  2IVZ A;  2VAQ A;  4IYG A;  3AMR A;  2IAO A;  2GVW A;  4PWZ A;  3A9G A;  3LI4 A;  2FP9 A;  2IAP A;  1CQ1 A;  1N7D A;  1C5K A;  3AMS A;  5D9B A;  5GX4 A;  2IAU A;  5GX1 A;  3LI5 A;  3Q6K A;  1RWI A;  2W8B B;  4O5T A;  3DR2 A;  3FW0 A;  5GX5 A;  4R40 A;  2FPB A;  2DG0 A;  2P4O A;  5GTQ A;  2IAW A;  3G4E A;  2IAQ A;  3U0S A;  1IJQ A;  2GVV A;  2DG1 A;  3S94 A;  1QBI A;  1NPE A;  2DSO A;  3HRP A;  3IAX A;  3HLH A;  3O4P A;  3BYC A;  2ISM A;  1H6L A;  2OJH A;  4O5S A;  3V65 B;  3S8Z A;  1E1A A;  4HHQ A;  5FWW A;  3SOB B;  3P5B L;  4Q1U A;  1Q7F A;  3I1C A;  1PJX A;  3WW9 A;  2IAS A;  3V1S A;  3Q6T A;  2IAR A;  3DAS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...