5H9EB

Crystal structure of e. coli cascade bound to a pam-containing dsdna target (32-nt spacer) at 3.20 angstrom resolution.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
157
structure length
151
Chain Sequence
DEIDAMALYRAWQQLDNGSCAQIRRVSEPDELRDIPAFYRLVQPFGWENPRHQQALLRMVFCLSAGKNVIRHQDKGISLGRALANSGRINERRIFQLIRADRTADMVQLRRLLTHAEPVLDWPLMARMLTWWGKRERQQLLEDFVLTTNKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for promiscuous PAM recognition in type I-E Cascade from E. coli.
pubmed doi rcsb
molecule keywords CRISPR system Cascade subunit CasA
molecule tags Immune system/rna
source organism Escherichia coli (strain k12)
total genus 50
structure length 151
sequence length 157
chains with identical sequence C
ec nomenclature
pdb deposition date 2015-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09485 CRISPR_Cse2 CRISPR-associated protein Cse2 (CRISPR_cse2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.520.40 Mainly Alpha Orthogonal Bundle Peroxidase; domain 1 Peroxidase; domain 1 5h9eB00
2ZCAA 4H79A 4U7UB 4QYZB 5H9FB 4H7AA 3WA8A 5CD4J 5H9EB
chains in the Genus database with same CATH superfamily
2VCFX 3M2IA 4G05A 4NVFA 5KQKA 3M26A 4BM2A 1CCEA 2B12A 1QGJA 1AEUA 4XV4A 2ZOPA 1S73A 2CL4X 3M27A 5AOGA 1SBMA 1ARXA 2W23A 4JM6A 2RBTX 1U74A 5AMMA 5KQ2A 4XVAA 1W4YA 4NFGA 5JHXA 4A71A 1JDRA 3FM6A 5SYKA 1A2FA 2YLJA 1B85A 3WNUA 5L86A 2GHKX 1YYDA 2AS4A 3M8MA 2YCGA 4CZOA 1CMPA 6CCPA 1H5IA 1HSRA 4NVOB 4U7UB 4H79A 3M28A 4NVIB 4NVKB 5KSKA 1V0HX 1BESA 2EUNA 4NVDA 3HDLA 4BM0A 2EUOA 4CZNA 3M2DA 2EUTA 5FNEA 3M25A 3VLKA 2EURA 2GHDX 4JPLA 2IA8A 4XV8A 1AEQA 5SYJA 5KQ3A 4JMBA 4JM5A 3VLHA 1DSOA 1RYCA 2RC2X 1H5HA 1GWUA 2A7UB 1CCIA 1LYKA 1CPGA 2RC0X 2RBVX 3EXBA 3R98A 2N18A 5ABNA 1CCPA 2X07A 4FEFA 2XIFA 2GGNX 3CCXA 1EBEA 1BVAA 2PCCA 1Z53A 4JPUA 4C51A 4FDQA 2Y6AA 5CIDA 3X16A 4NVAA 7CCPA 5SX6A 5SW4A 1HCHA 5JPRA 5CIBA 2GHCX 5SXQA 2E39A 2JTIA 2ICVA 5SX2A 4A6ZA 4BM3A 3CCPA 4JMVA 2VCNA 1CMQA 3FKGA 1H5DA 4GEDA 5ABOA 5JQRA 1CPEA 1AEVA 2WD4A 2WSSS 4JN0A 2AS3A 1AEMA 1ZBYA 3WA8A 2OEBA 3R99A 2VNXX 4NVEA 5SX7A 1ITKA 1BEQA 2ZCAA 1C8IA 3RIVA 6ATJA 5AL9A 4XV6A 1YYGA 1DJ5A 1H5CA 3FMUA 4JQJA 4CVIA 2RBXX 2ATJA 1AEOA 1W4WA 3M2FA 2EUSA 3Q3UA 1U2LA 1KOKA 1H57A 2VKAA 1AEJA 1AEBA 2CEPA 4BLYA 5SYHA 1U2KA 4NVNB 4USCA 4CVJA 1B82A 1CCJA 4C50A 4JMWA 5L05A 5SX0A 1UB2A 2B0ZA 2BOQA 2ANZA 5ALAA 1DSEA 4NVJB 1GWTA 2EUUA 3E2NA 1IYNA 2V23A 1QPAA 5SYIA 1CCBA 1DSPA 2AQDA 1DSGA 1DJ1A 3UT2A 1KXMA 3E2OA 5JHYA 1LYCA 2E3BA 1AEHA 4CZQA 5SYYA 4A7MA 3ZCHA 5JHZA 3X1LF 1ARYA 2RC1X 1H55A 4JMTA 1ML2A 3M29A 4CZRA 2V2EA 1YZPA 4XV5A 2XJ5A 3M23A 5KQIA 1AC8A 5KQ6A 4JM8A 1CMUA 5SX3A 4CUOA 5CICA 1GWOA 1PA2A 1AEDA 2RBYX 5CJHA 1CCLA 5SYWA 2PCBA 3RIWA 1H58A 1STQA 3ATJA 4BLZA 3M2BA 2VO2X 1CCCA 4FCSA 3FJWA 1AEGA 1BEKA 2JMXA 1SCHA 5SYXA 4BLKA 1ZBZA 1ARWA 4CZPA 3M2EA 5D6MA 4NVBA 1MN1A 1AC4A 2CYPA 1QO4A 1KXNA 2XJ6A 4P4QA 4OQ7A 1A2GA 3VLIA 1U2JA 5SX1A 5CIHA 1GX2A 1LY9A 4NVLA 4JMSA 1H5LA 3WXOA 4A78A 4JB4A 5SXTA 4CCXA 1BEJA 1H5JA 1GW2A 2RBUX 1FHFA 5SYUA 2RBZX 2XILA 1CCAA 3M2CA 3FM4A 5SX0B 4BLLA 1B80A 1AEFA 4ATJA 1BEMA 4NVHB 4BM1A 2GHHX 1SJ2A 2XJ8A 4NVMB 4BLNA 5SYVA 1MKQA 1CPDA 1H5KA 1MKRA 1GZBA 4JMZA 4QYZB 1AA4A 1S6VA 2B10A 4CCPA 5SXWA 2RBWX 1AESA 4A5GA 1LGAA 5SXXA 2X08A 3RRWA 1H5MA 5SW5A 1H5GA 2EUQA 4GKFA 4NVCA 5EJTA 1SOGA 2EUPA 1AEKA 5SXRA 3M2AA 4PAEA 3VLLA 5SYLA 5SXSA 1AETA 1ATJA 1CPFA 1ABVA 1OAGA 1ARPA 1ARUA 1CYFA 5CIFA 5CIEA 5ABQA 2BO5A 1GZAA 4H7AA 1H5EA 4BLXA 2GB8A 5SW6A 5CIGA 5KQ0A 1SDQA 1CCGA 2Y5AA 5KSFA 1H3JA 5H9EB 1CK6A 1LLPA 5CCPA 1MNPA 4NVGB 1OAFA 4JQMA 2AS2A 2GHEX 5H9FB 5KQHA 4BM4A 1U75A 1MN2A 2AS6A 4JM9A 5L02A 5CD4J 1KRJA 2XIHA 2AS1A 3M5QA 1AENA 1AEEA 7ATJA 2CCAA 1CCKA 1ARVA 1H5AA 4FCNA 3M2HA 1DCCA 1DS4A 3M2GA 4JMAA 5EJXA 2XI6A 4JQKA 1YZRA 2VCSA 2VNZX 1JCIA 2E3AA 1BEPA 4JQNA 3ZCGA 1H5FA 3VLJA 3FM1A 4XV7A 2BCNA 1CMTA 4JPTA 1MK8A 2CCDA 3UW8A 1LY8A 2B11A 1BJ9A 1KZMA 4JZAA 5FNBA 3VLMA 2CCPA 3ZCYA 2Y6BA 1APXA 1BGPA
chains in the Genus database with same CATH topology
2VCFX 3M2IA 4G05A 4NVFA 5KQKA 3M26A 4BM2A 1CCEA 2B12A 1QGJA 1AEUA 4XV4A 1S73A 2CL4X 3M27A 5AOGA 1SBMA 1ARXA 2W23A 4JM6A 2RBTX 1U74A 5AMMA 5KQ2A 4XVAA 1W4YA 4NFGA 5JHXA 4A71A 1JDRA 3FM6A 5SYKA 1A2FA 2YLJA 1B85A 3WNUA 5L86A 2GHKX 1YYDA 2AS4A 3M8MA 2YCGA 4CZOA 1CMPA 6CCPA 1H5IA 1HSRA 4NVOB 4U7UB 4H79A 3M28A 4NVIB 4NVKB 5KSKA 1V0HX 1BESA 2EUNA 4NVDA 3HDLA 4BM0A 2EUOA 4CZNA 3M2DA 2EUTA 5FNEA 3M25A 3VLKA 2EURA 2GHDX 4JPLA 2IA8A 4XV8A 1AEQA 5SYJA 5KQ3A 4JMBA 4JM5A 3VLHA 1DSOA 1RYCA 2RC2X 1H5HA 1GWUA 1CCIA 1LYKA 1CPGA 2RC0X 2RBVX 3EXBA 3R98A 2N18A 5ABNA 1CCPA 2X07A 4FEFA 2XIFA 2GGNX 3CCXA 1EBEA 1BVAA 2PCCA 1Z53A 4JPUA 4C51A 4FDQA 2Y6AA 5CIDA 3X16A 4NVAA 7CCPA 5SX6A 5SW4A 1HCHA 5JPRA 5CIBA 2GHCX 5SXQA 2E39A 2JTIA 2ICVA 5SX2A 4A6ZA 4BM3A 3CCPA 4JMVA 2VCNA 1CMQA 3FKGA 1H5DA 4GEDA 5ABOA 5JQRA 1CPEA 1AEVA 2WD4A 4JN0A 2AS3A 1AEMA 1ZBYA 3WA8A 3R99A 2VNXX 4NVEA 5SX7A 1ITKA 1BEQA 2ZCAA 1C8IA 3RIVA 6ATJA 5AL9A 4XV6A 1YYGA 1DJ5A 1H5CA 3FMUA 4JQJA 4CVIA 2RBXX 2ATJA 1AEOA 1W4WA 3M2FA 2EUSA 3Q3UA 1U2LA 1KOKA 1H57A 2VKAA 1AEJA 1AEBA 2CEPA 4BLYA 5SYHA 1U2KA 4NVNB 4USCA 4CVJA 1B82A 1CCJA 4C50A 4JMWA 5L05A 5SX0A 1UB2A 2B0ZA 2BOQA 2ANZA 5ALAA 1DSEA 4NVJB 1GWTA 2EUUA 3E2NA 1IYNA 2V23A 1QPAA 5SYIA 1CCBA 1DSPA 2AQDA 1DSGA 1DJ1A 3UT2A 1KXMA 3E2OA 5JHYA 1LYCA 2E3BA 1AEHA 4CZQA 5SYYA 4A7MA 3ZCHA 5JHZA 1ARYA 2RC1X 1H55A 4JMTA 1ML2A 3M29A 4CZRA 2V2EA 1YZPA 4XV5A 2XJ5A 3M23A 5KQIA 1AC8A 5KQ6A 4JM8A 1CMUA 5SX3A 4CUOA 5CICA 1GWOA 1PA2A 1AEDA 2RBYX 5CJHA 1CCLA 5SYWA 2PCBA 3RIWA 1H58A 1STQA 3ATJA 4BLZA 3M2BA 2VO2X 1CCCA 4FCSA 3FJWA 1AEGA 1BEKA 1SCHA 5SYXA 4BLKA 1ZBZA 1ARWA 4CZPA 3M2EA 5D6MA 4NVBA 1MN1A 1AC4A 2CYPA 1QO4A 1KXNA 2XJ6A 4P4QA 4OQ7A 1A2GA 3VLIA 1U2JA 5SX1A 5CIHA 1GX2A 1LY9A 4NVLA 4JMSA 1H5LA 3WXOA 4A78A 4JB4A 5SXTA 4CCXA 1BEJA 1H5JA 1GW2A 2RBUX 1FHFA 5SYUA 2RBZX 2XILA 1CCAA 3M2CA 3FM4A 5SX0B 4BLLA 1B80A 1AEFA 4ATJA 1BEMA 4NVHB 4BM1A 2GHHX 1SJ2A 2XJ8A 4NVMB 4BLNA 5SYVA 1MKQA 1CPDA 1H5KA 1MKRA 1GZBA 4JMZA 4QYZB 1AA4A 1S6VA 2B10A 4CCPA 5SXWA 2RBWX 1AESA 4A5GA 1LGAA 5SXXA 2X08A 3RRWA 1H5MA 5SW5A 1H5GA 2EUQA 4NVCA 5EJTA 1SOGA 2EUPA 1AEKA 5SXRA 3M2AA 4PAEA 3VLLA 5SYLA 5SXSA 1AETA 1ATJA 1CPFA 1OAGA 1ARPA 1ARUA 1CYFA 5CIFA 5CIEA 5ABQA 1GZAA 4H7AA 1H5EA 4BLXA 2GB8A 5SW6A 5CIGA 5KQ0A 1SDQA 1CCGA 2Y5AA 5KSFA 1H3JA 5H9EB 1CK6A 1LLPA 5CCPA 1MNPA 4NVGB 1OAFA 4JQMA 2AS2A 2GHEX 5H9FB 5KQHA 4BM4A 1U75A 1MN2A 2AS6A 4JM9A 5L02A 5CD4J 1KRJA 2XIHA 2AS1A 3M5QA 1AENA 1AEEA 7ATJA 2CCAA 1CCKA 1ARVA 1H5AA 4FCNA 3M2HA 1DCCA 1DS4A 3M2GA 4JMAA 5EJXA 2XI6A 4JQKA 1YZRA 2VCSA 2VNZX 1JCIA 2E3AA 1BEPA 4JQNA 3ZCGA 1H5FA 3VLJA 3FM1A 4XV7A 2BCNA 1CMTA 4JPTA 1MK8A 2CCDA 3UW8A 1LY8A 2B11A 1BJ9A 1KZMA 4JZAA 5FNBA 3VLMA 2CCPA 3ZCYA 2Y6BA 1APXA 1BGPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZCA A;  4H79 A;  4U7U B;  4QYZ B;  5H9F B;  4H7A A;  3WA8 A;  5CD4 J;  5H9E B; 
#chains in the Genus database with same CATH topology
 2VCF X;  3M2I A;  4G05 A;  4NVF A;  5KQK A;  3M26 A;  4BM2 A;  1CCE A;  2B12 A;  1QGJ A;  1AEU A;  4XV4 A;  2ZOP A;  1S73 A;  2CL4 X;  3M27 A;  5AOG A;  1SBM A;  1ARX A;  2W23 A;  4JM6 A;  2RBT X;  1U74 A;  5AMM A;  5KQ2 A;  4XVA A;  1W4Y A;  4NFG A;  5JHX A;  4A71 A;  1JDR A;  3FM6 A;  5SYK A;  1A2F A;  2YLJ A;  1B85 A;  3WNU A;  5L86 A;  2GHK X;  1YYD A;  2AS4 A;  3M8M A;  2YCG A;  4CZO A;  1CMP A;  6CCP A;  1H5I A;  1HSR A;  4NVO B;  4U7U B;  4H79 A;  3M28 A;  4NVI B;  4NVK B;  5KSK A;  1V0H X;  1BES A;  2EUN A;  4NVD A;  3HDL A;  4BM0 A;  2EUO A;  4CZN A;  3M2D A;  2EUT A;  5FNE A;  3M25 A;  3VLK A;  2EUR A;  2GHD X;  4JPL A;  2IA8 A;  4XV8 A;  1AEQ A;  5SYJ A;  5KQ3 A;  4JMB A;  4JM5 A;  3VLH A;  1DSO A;  1RYC A;  2RC2 X;  1H5H A;  1GWU A;  2A7U B;  1CCI A;  1LYK A;  1CPG A;  2RC0 X;  2RBV X;  3EXB A;  3R98 A;  2N18 A;  5ABN A;  1CCP A;  2X07 A;  4FEF A;  2XIF A;  2GGN X;  3CCX A;  1EBE A;  1BVA A;  2PCC A;  1Z53 A;  4JPU A;  4C51 A;  4FDQ A;  2Y6A A;  5CID A;  3X16 A;  4NVA A;  7CCP A;  5SX6 A;  5SW4 A;  1HCH A;  5JPR A;  5CIB A;  2GHC X;  5SXQ A;  2E39 A;  2JTI A;  2ICV A;  5SX2 A;  4A6Z A;  4BM3 A;  3CCP A;  4JMV A;  2VCN A;  1CMQ A;  3FKG A;  1H5D A;  4GED A;  5ABO A;  5JQR A;  1CPE A;  1AEV A;  2WD4 A;  2WSS S;  4JN0 A;  2AS3 A;  1AEM A;  1ZBY A;  3WA8 A;  2OEB A;  3R99 A;  2VNX X;  4NVE A;  5SX7 A;  1ITK A;  1BEQ A;  2ZCA A;  1C8I A;  3RIV A;  6ATJ A;  5AL9 A;  4XV6 A;  1YYG A;  1DJ5 A;  1H5C A;  3FMU A;  4JQJ A;  4CVI A;  2RBX X;  2ATJ A;  1AEO A;  1W4W A;  3M2F A;  2EUS A;  3Q3U A;  1U2L A;  1KOK A;  1H57 A;  2VKA A;  1AEJ A;  1AEB A;  2CEP A;  4BLY A;  5SYH A;  1U2K A;  4NVN B;  4USC A;  4CVJ A;  1B82 A;  1CCJ A;  4C50 A;  4JMW A;  5L05 A;  5SX0 A;  1UB2 A;  2B0Z A;  2BOQ A;  2ANZ A;  5ALA A;  1DSE A;  4NVJ B;  1GWT A;  2EUU A;  3E2N A;  1IYN A;  2V23 A;  1QPA A;  5SYI A;  1CCB A;  1DSP A;  2AQD A;  1DSG A;  1DJ1 A;  3UT2 A;  1KXM A;  3E2O A;  5JHY A;  1LYC A;  2E3B A;  1AEH A;  4CZQ A;  5SYY A;  4A7M A;  3ZCH A;  5JHZ A;  3X1L F;  1ARY A;  2RC1 X;  1H55 A;  4JMT A;  1ML2 A;  3M29 A;  4CZR A;  2V2E A;  1YZP A;  4XV5 A;  2XJ5 A;  3M23 A;  5KQI A;  1AC8 A;  5KQ6 A;  4JM8 A;  1CMU A;  5SX3 A;  4CUO A;  5CIC A;  1GWO A;  1PA2 A;  1AED A;  2RBY X;  5CJH A;  1CCL A;  5SYW A;  2PCB A;  3RIW A;  1H58 A;  1STQ A;  3ATJ A;  4BLZ A;  3M2B A;  2VO2 X;  1CCC A;  4FCS A;  3FJW A;  1AEG A;  1BEK A;  2JMX A;  1SCH A;  5SYX A;  4BLK A;  1ZBZ A;  1ARW A;  4CZP A;  3M2E A;  5D6M A;  4NVB A;  1MN1 A;  1AC4 A;  2CYP A;  1QO4 A;  1KXN A;  2XJ6 A;  4P4Q A;  4OQ7 A;  1A2G A;  3VLI A;  1U2J A;  5SX1 A;  5CIH A;  1GX2 A;  1LY9 A;  4NVL A;  4JMS A;  1H5L A;  3WXO A;  4A78 A;  4JB4 A;  5SXT A;  4CCX A;  1BEJ A;  1H5J A;  1GW2 A;  2RBU X;  1FHF A;  5SYU A;  2RBZ X;  2XIL A;  1CCA A;  3M2C A;  3FM4 A;  5SX0 B;  4BLL A;  1B80 A;  1AEF A;  4ATJ A;  1BEM A;  4NVH B;  4BM1 A;  2GHH X;  1SJ2 A;  2XJ8 A;  4NVM B;  4BLN A;  5SYV A;  1MKQ A;  1CPD A;  1H5K A;  1MKR A;  1GZB A;  4JMZ A;  4QYZ B;  1AA4 A;  1S6V A;  2B10 A;  4CCP A;  5SXW A;  2RBW X;  1AES A;  4A5G A;  1LGA A;  5SXX A;  2X08 A;  3RRW A;  1H5M A;  5SW5 A;  1H5G A;  2EUQ A;  4GKF A;  4NVC A;  5EJT A;  1SOG A;  2EUP A;  1AEK A;  5SXR A;  3M2A A;  4PAE A;  3VLL A;  5SYL A;  5SXS A;  1AET A;  1ATJ A;  1CPF A;  1ABV A;  1OAG A;  1ARP A;  1ARU A;  1CYF A;  5CIF A;  5CIE A;  5ABQ A;  2BO5 A;  1GZA A;  4H7A A;  1H5E A;  4BLX A;  2GB8 A;  5SW6 A;  5CIG A;  5KQ0 A;  1SDQ A;  1CCG A;  2Y5A A;  5KSF A;  1H3J A;  5H9E B;  1CK6 A;  1LLP A;  5CCP A;  1MNP A;  4NVG B;  1OAF A;  4JQM A;  2AS2 A;  2GHE X;  5H9F B;  5KQH A;  4BM4 A;  1U75 A;  1MN2 A;  2AS6 A;  4JM9 A;  5L02 A;  5CD4 J;  1KRJ A;  2XIH A;  2AS1 A;  3M5Q A;  1AEN A;  1AEE A;  7ATJ A;  2CCA A;  1CCK A;  1ARV A;  1H5A A;  4FCN A;  3M2H A;  1DCC A;  1DS4 A;  3M2G A;  4JMA A;  5EJX A;  2XI6 A;  4JQK A;  1YZR A;  2VCS A;  2VNZ X;  1JCI A;  2E3A A;  1BEP A;  4JQN A;  3ZCG A;  1H5F A;  3VLJ A;  3FM1 A;  4XV7 A;  2BCN A;  1CMT A;  4JPT A;  1MK8 A;  2CCD A;  3UW8 A;  1LY8 A;  2B11 A;  1BJ9 A;  1KZM A;  4JZA A;  5FNB A;  3VLM A;  2CCP A;  3ZCY A;  2Y6B A;  1APX A;  1BGP A; 
#chains in the Genus database with same CATH homology
 2VCF X;  3M2I A;  4G05 A;  4NVF A;  5KQK A;  3M26 A;  4BM2 A;  1CCE A;  2B12 A;  1QGJ A;  1AEU A;  4XV4 A;  1S73 A;  2CL4 X;  3M27 A;  5AOG A;  1SBM A;  1ARX A;  2W23 A;  4JM6 A;  2RBT X;  1U74 A;  5AMM A;  5KQ2 A;  4XVA A;  1W4Y A;  4NFG A;  5JHX A;  4A71 A;  1JDR A;  3FM6 A;  5SYK A;  1A2F A;  2YLJ A;  1B85 A;  3WNU A;  5L86 A;  2GHK X;  1YYD A;  2AS4 A;  3M8M A;  2YCG A;  4CZO A;  1CMP A;  6CCP A;  1H5I A;  1HSR A;  4NVO B;  4U7U B;  4H79 A;  3M28 A;  4NVI B;  4NVK B;  5KSK A;  1V0H X;  1BES A;  2EUN A;  4NVD A;  3HDL A;  4BM0 A;  2EUO A;  4CZN A;  3M2D A;  2EUT A;  5FNE A;  3M25 A;  3VLK A;  2EUR A;  2GHD X;  4JPL A;  2IA8 A;  4XV8 A;  1AEQ A;  5SYJ A;  5KQ3 A;  4JMB A;  4JM5 A;  3VLH A;  1DSO A;  1RYC A;  2RC2 X;  1H5H A;  1GWU A;  1CCI A;  1LYK A;  1CPG A;  2RC0 X;  2RBV X;  3EXB A;  3R98 A;  2N18 A;  5ABN A;  1CCP A;  2X07 A;  4FEF A;  2XIF A;  2GGN X;  3CCX A;  1EBE A;  1BVA A;  2PCC A;  1Z53 A;  4JPU A;  4C51 A;  4FDQ A;  2Y6A A;  5CID A;  3X16 A;  4NVA A;  7CCP A;  5SX6 A;  5SW4 A;  1HCH A;  5JPR A;  5CIB A;  2GHC X;  5SXQ A;  2E39 A;  2JTI A;  2ICV A;  5SX2 A;  4A6Z A;  4BM3 A;  3CCP A;  4JMV A;  2VCN A;  1CMQ A;  3FKG A;  1H5D A;  4GED A;  5ABO A;  5JQR A;  1CPE A;  1AEV A;  2WD4 A;  4JN0 A;  2AS3 A;  1AEM A;  1ZBY A;  3WA8 A;  3R99 A;  2VNX X;  4NVE A;  5SX7 A;  1ITK A;  1BEQ A;  2ZCA A;  1C8I A;  3RIV A;  6ATJ A;  5AL9 A;  4XV6 A;  1YYG A;  1DJ5 A;  1H5C A;  3FMU A;  4JQJ A;  4CVI A;  2RBX X;  2ATJ A;  1AEO A;  1W4W A;  3M2F A;  2EUS A;  3Q3U A;  1U2L A;  1KOK A;  1H57 A;  2VKA A;  1AEJ A;  1AEB A;  2CEP A;  4BLY A;  5SYH A;  1U2K A;  4NVN B;  4USC A;  4CVJ A;  1B82 A;  1CCJ A;  4C50 A;  4JMW A;  5L05 A;  5SX0 A;  1UB2 A;  2B0Z A;  2BOQ A;  2ANZ A;  5ALA A;  1DSE A;  4NVJ B;  1GWT A;  2EUU A;  3E2N A;  1IYN A;  2V23 A;  1QPA A;  5SYI A;  1CCB A;  1DSP A;  2AQD A;  1DSG A;  1DJ1 A;  3UT2 A;  1KXM A;  3E2O A;  5JHY A;  1LYC A;  2E3B A;  1AEH A;  4CZQ A;  5SYY A;  4A7M A;  3ZCH A;  5JHZ A;  1ARY A;  2RC1 X;  1H55 A;  4JMT A;  1ML2 A;  3M29 A;  4CZR A;  2V2E A;  1YZP A;  4XV5 A;  2XJ5 A;  3M23 A;  5KQI A;  1AC8 A;  5KQ6 A;  4JM8 A;  1CMU A;  5SX3 A;  4CUO A;  5CIC A;  1GWO A;  1PA2 A;  1AED A;  2RBY X;  5CJH A;  1CCL A;  5SYW A;  2PCB A;  3RIW A;  1H58 A;  1STQ A;  3ATJ A;  4BLZ A;  3M2B A;  2VO2 X;  1CCC A;  4FCS A;  3FJW A;  1AEG A;  1BEK A;  1SCH A;  5SYX A;  4BLK A;  1ZBZ A;  1ARW A;  4CZP A;  3M2E A;  5D6M A;  4NVB A;  1MN1 A;  1AC4 A;  2CYP A;  1QO4 A;  1KXN A;  2XJ6 A;  4P4Q A;  4OQ7 A;  1A2G A;  3VLI A;  1U2J A;  5SX1 A;  5CIH A;  1GX2 A;  1LY9 A;  4NVL A;  4JMS A;  1H5L A;  3WXO A;  4A78 A;  4JB4 A;  5SXT A;  4CCX A;  1BEJ A;  1H5J A;  1GW2 A;  2RBU X;  1FHF A;  5SYU A;  2RBZ X;  2XIL A;  1CCA A;  3M2C A;  3FM4 A;  5SX0 B;  4BLL A;  1B80 A;  1AEF A;  4ATJ A;  1BEM A;  4NVH B;  4BM1 A;  2GHH X;  1SJ2 A;  2XJ8 A;  4NVM B;  4BLN A;  5SYV A;  1MKQ A;  1CPD A;  1H5K A;  1MKR A;  1GZB A;  4JMZ A;  4QYZ B;  1AA4 A;  1S6V A;  2B10 A;  4CCP A;  5SXW A;  2RBW X;  1AES A;  4A5G A;  1LGA A;  5SXX A;  2X08 A;  3RRW A;  1H5M A;  5SW5 A;  1H5G A;  2EUQ A;  4NVC A;  5EJT A;  1SOG A;  2EUP A;  1AEK A;  5SXR A;  3M2A A;  4PAE A;  3VLL A;  5SYL A;  5SXS A;  1AET A;  1ATJ A;  1CPF A;  1OAG A;  1ARP A;  1ARU A;  1CYF A;  5CIF A;  5CIE A;  5ABQ A;  1GZA A;  4H7A A;  1H5E A;  4BLX A;  2GB8 A;  5SW6 A;  5CIG A;  5KQ0 A;  1SDQ A;  1CCG A;  2Y5A A;  5KSF A;  1H3J A;  5H9E B;  1CK6 A;  1LLP A;  5CCP A;  1MNP A;  4NVG B;  1OAF A;  4JQM A;  2AS2 A;  2GHE X;  5H9F B;  5KQH A;  4BM4 A;  1U75 A;  1MN2 A;  2AS6 A;  4JM9 A;  5L02 A;  5CD4 J;  1KRJ A;  2XIH A;  2AS1 A;  3M5Q A;  1AEN A;  1AEE A;  7ATJ A;  2CCA A;  1CCK A;  1ARV A;  1H5A A;  4FCN A;  3M2H A;  1DCC A;  1DS4 A;  3M2G A;  4JMA A;  5EJX A;  2XI6 A;  4JQK A;  1YZR A;  2VCS A;  2VNZ X;  1JCI A;  2E3A A;  1BEP A;  4JQN A;  3ZCG A;  1H5F A;  3VLJ A;  3FM1 A;  4XV7 A;  2BCN A;  1CMT A;  4JPT A;  1MK8 A;  2CCD A;  3UW8 A;  1LY8 A;  2B11 A;  1BJ9 A;  1KZM A;  4JZA A;  5FNB A;  3VLM A;  2CCP A;  3ZCY A;  2Y6B A;  1APX A;  1BGP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...