5HD4A

Dissecting therapeutic resistance to erk inhibition rat wild type sch772984 in complex with (3r)-1-(2-oxo-2-{4-[4-(pyrimidin-2-yl)phenyl]piperazin-1-yl}ethyl)-n-[3-(pyridin-4-yl)-2h-indazol-5-yl]pyrrolidine-3-carboxamide
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
347
structure length
347
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissecting Therapeutic Resistance to ERK Inhibition.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 1
total genus 117
structure length 347
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2016-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5hd4A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5hd4A01
5KMIA 2YACA 3A7JA 1U5QA 1M7QA 2PVMA 5LMKC 4Q5HA 1GY3A 1T46A 2VTSA 1HCLA 3FV8A 2GFSA 3OT3A 3R7GA 2GHGA 2QG5A 5I3RA 3E3BX 3LLAA 3MVLA 1QPEA 3GC7A 4W9WA 4M12A 5CEOA 4DF3A 1UU7A 1U54B 3BIZA 4QTDA 4LUDA 4PL5A 5GHVA 1V1KA 4DT8A 5GIPE 4N70A 2V7OA 3A8XA 4BZDA 2C47A 4EUUA 3LKMA 2UV2A 2XMYA 4R5YA 1OIQA 3MH1A 2GNFA 4GKIA 3RK7A 4MBJA 3DB8A 3W32A 3DXQA 3MPMA 4F7LA 2W4KA 1UNGA 5AV1A 3T3VA 4DFLA 4BZOA 2WTCA 2XK4A 2OSCA 4BDCA 1A06A 1YDRE 3O50A 3OY1A 5AR4A 4AT4A 4AN2A 3PXYA 4M14A 3BRBA 5A4TA 4J96A 3KEXA 3RPYA 4HCUA 4HVIA 3I79A 4J1RA 3H0ZA 3VJNA 3W2QA 3KU2A 4FL2A 1OVEA 4ZMEA 5L4QA 2RL5A 3PG3A 4YJQA 3R04A 3HA8A 2FSTX 2O64A 4XYFA 2OF4A 5D11A 4FE2A 4FI1A 5M53A 3KA0A 5JFWA 3KB7A 2UW9A 5CEKA 4D4VA 4USEA 3Q3BA 3ZRMA 4M15A 3UE4A 4ASEA 5AR8A 4IC8A 3OWLA 1LP4A 3A61A 4MNEB 5HICA 1KE6A 2YZAA 3RTPA 1OZ1A 4QT1A 1H1QA 2PSQA 4QP3A 5C27A 2YM8A 4ZAUA 3BYUA 5LMBA 3GENA 3D5WA 4OTPA 1GOLA 5AEPA 3DCVA 3DBEA 3NW6A 4H1MA 3OUNB 3KY2A 2DWBA 3L8VA 3FLNC 3KMMA 4X21A 2GQGA 2OIBA 2PMOX 1Z57A 3QZFA 4MK0A 1FOTA 4K1BA 5TE0A 4MD9E 3HMNA 1B6CB 2BRHA 3SW7A 2Z8CA 2OJFE 5KUPA 3I4BA 2CGXA 3DNEA 3TV6A 4UN0C 3MIYA 4FSMA 1DS5A 2J0KA 4JRNA 2WMVA 5D7AA 3NYXA 5F95A 3VS4A 4YMJA 3UG1A 2R7IA 3HA6A 4XV1A 3C0IA 5TKDA 4FT0A 3FZSA 4BF2A 3Q9ZA 3RZFA 1ZZ2A 4BKJA 1YWNA 3PSBA 3GP0A 4D4SA 4RGJA 4BCPA 2Z7SA 3IW4A 4DFUA 2XRWA 4GUEA 2UUEA 3V51A 3R9NA 3DKCA 3MFSA 3QTSA 3I7BA 2QLQA 4L43A 4KAOA 3FXXA 4XG8A 3VVHA 4LGDA 2RF9A 3TJCA 4HVHA 3IW8A 4TYEA 1FMKA 5K5XA 2B7AA 2O65A 4E4MA 4BCFA 1O6LA 4FNZA 2R3GA 4JR7A 4J99A 3BGPA 2BDJA 3LFDA 3PLSA 2ZOQA 4FSYA 4G3FA 4TYJA 4BDIA 3R9RA 2J5EA 3W8LA 3QD0A 1JKLA 4LOQA 1H4LA 3QFVA 3GB2A 3T9IA 2ZV7A 1ZOGA 3D83A 3TWJA 3VBWA 4KSQA 3LFQA 5CWZA 3LFEA 3VUMA 4C36A 4I4EA 1Q24A 4D0WA 1IEPA 3R8UA 3SD0A 3IPHA 3E93A 2QO9A 4RC2A 2IW8A 3SRVB 3Q60A 5L2TA 4QYYA 1EH4A 3OT8A 4EOKA 4BCQA 4PNKA 5BUIA 4HVDA 2YDIA 2PMLX 4LGHA 1GIHA 2R3JA 4X6QC 2W05A 2FB8A 3AOXA 4QTCA 5FTOA 2RFNA 5EH0A 4XNEA 4F7SA 2HY81 3KRXA 4AOTA 1KWPA 4FNYA 3R1YA 4ANLA 1YOLA 4KBCA 4XHKB 3PIXA 5L2SA 4FODA 5CNNA 4QD6A 3QKMA 3PG1A 3QRJA 3NUXA 2C1AA 3CTJA 1PJKA 3ATSA 1FVVA 3WYXA 1XQZA 5BVOA 5EW3A 3U55A 2VNWA 3E3PA 5AUUA 3TTJA 3FMMA 1OECA 4C4JA 4RX5A 3AQVA 4E6AA 3QTQA 4JG7A 4YTIA 3TNWA 2OH0E 3HUCA 5HLPA 3ZH8A 4O2ZA 4MQ1A 4A06A 3OBGA 3CGFA 1TQMA 2FO0A 4F9CA 5ANJA 3RINA 4O6LA 1Q99A 2PZPA 4ZTRA 4K18A 4J97A 4FKGA 4O6EA 4FZDB 2ITWA 4JX7A 4G5PA 1OI9A 3PE2A 2QR8A 3F5PA 4BDKA 5A3XA 3NUSA 5J95A 1PMNA 1P4FA 4G3GA 1YXXA 3V04A 4QTBA 1B38A 5AP1A 2ZV9A 4QMYA 2RG5A 4C0TA 2R0UA 5J8IA 3UIBA 3GEQA 4G6OA 4QP4A 3KC3A 4L01A 2WTVA 3UQCA 2J9MA 3HV7A 4LL0A 3DB6A 3HMPA 4GV1A 4TKSA 4OBQA 4ZOGA 4EJNA 3VQHA 1BI8A 5H3QA 2YIXA 3OUKA 2CNUA 4BY9E 4GKHA 3K2LA 2A2AA 3Q9YA 3VW6A 1VYZA 4RG0A 5HIDA 2VTMA 2RFDA 4FIJA 2WO6A 5D41A 3V5WA 3KCKA 2F4JA 2UZVA 3O51A 3VUKA 3S00A 4YR8A 1UVRA 2BDWA 3QCSA 4F6UA 5FXQA 3KVWA 3TTIA 3A7HA 4DEHA 3RJCA 2PVYA 3LOKA 4OTHA 4FKSA 4DH8A 2NNWB 4EKLA 3TUBA 4I23A 5K4JA 4FV2A 1A9UA 2C0OA 4E5WA 3EYGA 1H0WA 3F3TA 3MWUA 5ICPA 4DH7A 5CALA 2UW8A 1CDKA 4FSNA 5CENA 3RZBA 1UU8A 3PVBA 2VN9A 4MF0A 5C01A 4FSZA 4EJ7A 2E9OA 4HPTE 2VWWA 4NTSA 1UWJA 1VJYA 4QYFA 4B0GA 4C02A 4QYHA 4QYGA 5ANGA 1SVEA 5HX8A 2FVDA 5EFQA 3ZUUA 5DNRA 5E7RA 1OGUA 5LVLA 4ZZOA 4RIWB 4TWPA 3MJ2A 3VBVA 1FGKA 3UODA 4ZSEA 4PPAA 3A4OX 4X2KA 5ETAA 4XEYA 4AXAA 3FC1X 4BR3A 2WU7A 4C62A 2HY0A 4BFMA 2XIYA 4OTQA 4JBVA 4IANA 4AT3A 1K2PA 1PYEA 3MPAA 4FKTA 5E1EA 3V6SA 3BV3A 3AD5A 3P9JA 1A48A 1QL6A 3ORXA 5BQ0A 1F5QA 2C3IB 1FQ1B 4EQUA 1YI4A 2PE2A 5E8YA 1UNHA 3R6XA 3VHKA 3WF9A 4D55A 4U81A 2YZLA 3CPCA 3FBVA 4I1ZA 4PMSA 3P7AA 3ORPA 1WAKA 5HOAA 2VWXA 3DBQA 3OG7A 4EOPA 3TCPA 2CN5A 4PDSA 4XH6A 3ORMA 4KB8A 1OUKA 5HCZA 4B6LA 3RAIA 3RMFA 2Y6MA 4C3FA 4O0VA 4EH8A 2H34A 3PP0A 5EW9A 3HV3A 4O7WA 3ULZA 4E3CA 3S95A 4U80A 2PL0A 3KMWA 3VO3A 3PVWA 5GJFA 4CGAA 5LOHA 2UVZA 4IVBA 3TIZA 4ONAA 4F1OA 4LM5A 2YHVA 3P08A 1PXNA 3R02A 4W8EA 4GH2A 5HX6A 4H05A 3ZUVA 3JPVA 1Y6AA 2PVHA 3OFMA 3V5JA 5DI1A 1OB3A 3NX8A 4HNFA 5AAFA 3MH0A 1H1RA 3BHVA 3P79A 3H10A 4LI5A 3F7ZA 4CFVA 3HDNA 3R8PA 3IQ7A 3DKOA 3VF9A 4YTFA 4DINA 3GGFA 3PE1A 5HNBA 3FMEA 3FMJA 4AQCA 1IA8A 1Q8UA 2NRUA 3OEZA 4YZMA 1JWHA 1YQJA 2CGUA 4DGOA 4F65A 4HYIA 4S33A 4CCUA 4JLCA 1V0OA 3NW7A 5CX9A 4I20A 5L2WA 4O0XA 3BI6A 3LJ1A 2OWBA 3CY2A 4ZSLA 4ZZMA 5IDNA 4UZDA 2UW7A 3QD3A 5G1XA 4DFYA 1M2RA 4PDOA 3AC3A 1IASA 4AF3A 4DHFA 3A8WA 2XCKA 3ENHA 5KZIA 3QZGA 4BDFA 3G15A 4XV9A 3RK9A 4XOYA 2PVJA 4O7ZA 1UNLA 4NW5A 4MF1A 2ZM1A 3Q4UA 4KS7A 3MGYA 4BCHA 3PXKA 1MQBA 2PUUA 1PMEA 4QMXA 1KE8A 4O7LA 5BYLA 3D9VA 4AN3A 2HENA 4NIFA 3HV5A 3HAVA 1ERKA 2CCIA 4NIFB 3U6HA 4FL1A 4CSVA 1IA9A 4IB0A 3QRKA 4GG5A 3SOAA 3AMYA 5FM3A 4FMQA 3WZDA 5KX8A 3HMMA 4OBPA 5L3AA 2R3HA 1JKKA 4CFFA 2VRXA 2A0CX 4G3DA 4PY1A 4EH7A 5CSWA 4RMZA 3GU4A 4LGGA 4D4RA 3UNJA 5J1WA 4DFBA 3DLSA 3BWJA 3D15A 3QQJA 3THBA 4ZTLA 1P14A 2E9VA 2WMSA 3LHJA 2UW6A 3FJQE 3ZC6A 3IK3A 3SG8A 4C4GA 4ZY4A 4N57A 2YDKA 4L52A 3UGCA 2R3KA 4LQMA 2VO7A 2XNOA 2YAKA 3L9LA 4Y5HA 2VAGA 1H08A 1H26A 4HGLA 4ITJA 3KXNA 1XBAA 4APCA 2WMUA 4C33A 4GK3A 1J1CA 2XK6A 3R01A 2DS1A 2QNJA 4OTGA 2YCSA 2FGIA 3ULIA 2QU5A 2XVDA 3ZM4A 3IECA 3OF0A 4X7QA 4BBFA 3VHEA 4UWYA 2X6DA 2GHMA 2XBJA 3ALOA 3QU0A 4EOSA 4FTRA 5HO7A 2GHLA 4G3CA 2HZIA 1JAMA 5EYKA 3TV7A 4S34A 5C4KA 4NTTA 4EWHA 2UVYA 2XKDA 3O8UA 4XOZA 5AWMA 3R8VA 2E9PA 4LOPA 2JFMA 3JY9A 3ITZA 3LZBA 4PTEA 3BYOA 5LVPA 4NL0A 4IW0A 1FPUA 4FZFB 4NUSA 4D1SA 4IWQA 2ZV8A 1VYWA 3OCTA 4CT1A 4FV1A 5EM8A 1STCE 4D28A 3ZYAA 2OLCA 3MI9A 3O17A 2GNLA 2XZSA 5LQFA 4PMPA 1R0EA 3MJ1A 3TXOA 5IMEA 4O21A 1U59A 2OJGA 3F2AA 4HZSA 5EK7A 3S3IA 4CRLA 2C5XA 3CJGA 2I0HA 1GIJA 4A4LA 2JD5A 2HW7A 3EFKA 3EQBA 4P2KA 1DM2A 3A7IA 4C59A 1PRYA 3NUAA 4B9DA 1KE5A 3G0FA 4HVSA 2OIDA 3ZTXA 4NT4A 3VRZA 2QOKA 5EQYA 4M13A 4JS8A 4L3PA 5JT2A 5M08A 5E90A 2X81A 4RRVA 3QA8A 2VWBA 2VWYA 4DFNA 3EN6A 1H07A 2QCSA 3VS1A 1CTPE 1IG1A 3ANRA 3NYNA 4IM3A 3ORIA 2OFVA 4L67A 5CXHA 5CU3A 5EM7A 3FY2A 4JL9A 4BYJA 1SMHA 4O91A 3ZBFA 2XNBA 2R3PA 3BE2A 4ZY6A 3F69A 3F7WA 4LMUA 2YIQA 3BV2A 3Q96A 4FT5A 4NM3A 5DIAA 2C6OA 2JKQA 3GCVA 3V8SA 5IQBA 5FQDC 2CSNA 3HP5A 3VBTA 3COIA 3ZBXA 4BDAA 4FK6A 3E7OA 2VTQA 5B0XA 2IN6A 2NRYA 4OLIA 3BYVA 4HYUA 5AMNA 1P4OA 1NY3A 3CD8A 3WIKA 4ZLZA 4XV3A 4F9YA 4BKYA 3EQDA 4QMUA 4AT5A 3PDTA 4I6QA 2OICA 2O63A 2JIIA 3GQLA 3GT8A 4V05A 3CCNA 3VN9A 3E7VA 5EI2A 3NWWA 4AZEA 5HBJA 4IACA 3A4PA 3GXLA 4QP8A 2YM7A 4ANNA 5CZHA 5IDPA 1O6YA 4FTAA 4I0RA 5AA8A 5CS6A 4ZLYA 3DJ5A 3C0HA 4CFNA 1FVRA 3II5A 1LEWA 4J95A 3M1SA 3R8ZA 3K5VA 2R0IA 4MBIA 3CXWA 5FRIA 4O0UA 3G6HA 5HTBA 3BGZA 5C4LA 2JITA 5BVWA 1YOMA 4BL1A 4E93A 5ETCA 3MY5A 3LW0A 3QD4A 5D12A 3V3VA 2QVSE 4KUJA 5FLFA 3DXPA 1I09A 3WZJA 2UZEA 1E1XA 3P5KA 4TZRA 4USDA 2QONA 3DKFA 1U54A 4R1YA 2OZAB 2XK7A 3GFEA 2JAMA 3GFWA 4NKSA 3UYTA 2VTIA 3I7CA 3OY3A 2W1GA 5DWRA 4NEUA 3RNYA 2R3MA 4ALWA 4RFZA 3R7IA 3R83A 3V5PA 2C5VA 3VNTA 2X8EA 3F3VA 2W17A 3HRFA 4FSQA 5D7VA 4DGNA 4EZ5A 2XM9A 1JSUA 5K5NA 4DN5A 3UOJA 1Q3WA 2EUFB 3MESA 4OTWA 4JJRA 5GNKA 4RQVA 1Q3DA 3HRBA 2IPXA 4HGEA 3QCYA 4G3EA 1BYGA 3NS9A 4AA0A 2Y4IB 4D1XA 4D2SA 2GPHA 2X9EA 4X6RA 3ZUTA 4QTEA 2JKOA 4ASDA 4TRLA 3OWKA 3PP1A 3PWYA 3Q6UA 2BRMA 4F64A 3VUHA 4A9YA 4FEUA 3ZSGA 3NAXA 1Q61A 2B4SB 5H8BA 2OJIA 4KIKB 4FV4A 2QOBA 4KRCA 5AV2A 4CZYB 3TNHA 4YU2A 2HWPA 4W4XA 1Y8YA 1OBGA 4X3FB 4ZSJA 3PJ3A 5CSPA 3DXNA 5HE2A 5JGBA 3DS6A 4BDBA 3POZA 4FKVA 5TF9A 4ASXA 3W1FA 4CKJA 3ALNA 2CKPA 2BR1A 3EN5A 3TIYA 3GU6A 2W4OA 2YIWA 4BGGA 5EW8A 3RALA 4UMTA 3T9TA 2H8HA 3CGOA 4WIHA 3DT1A 2BIKB 3W2SA 4ITIA 3QWJA 5AP7A 2CNQA 3MH3A 3NSZA 4B99A 4RFMA 1RW8A 1NVQA 5LCJA 2YM5A 4UZHA 3A62A 3L8SA 2XNNA 2OFUA 4YSJA 1OMWA 3N51A 3QLGA 2O3PA 2OU7A 5EI6A 3OP5A 3M42A 2UZUE 4LFIA 3WE4A 1WVYA 4I94A 4E5AX 3C7QA 2IVSA 4KIQA 3QQKA 1FGIA 4GS6A 4K33A 2WEVA 3OTUA 4U3ZA 1YDSE 3PPZA 3GU7A 2BZIB 4JAJA 3U4UA 3CPBA 3EYHA 3BLRA 4IM2A 4WNOA 4X3FC 4RQKA 3UJGA 3GCSA 4GRBA 3DBFA 3GNIB 2W7XA 4O7VA 2ONLA 4E4XA 2JGZA 4U7ZA 1WBTA 2RSVA 3QC9A 4C4HA 1HCKA 4FOCA 1Q4LA 3E5AA 3FL5A 4RWJA 5E8VA 4BI2A 4F0GA 4QQCA 4G2FA 4C7TA 3QAME 3OCGA 4DEEA 5BYZA 5AR2A 1KOBA 4GU9A 2HK5A 2O5KA 3C4CA 3FMNA 5TO8A 4QPSA 2PVRA 4PL4A 2OXYA 4UBAA 3UIXA 4CKIA 4LUEA 4L00A 2BAJA 4R7IA 4O81A 3TM0A 2BRGA 3EN4A 4J8MA 1URWA 3AGMA 1MQ4A 2FH9A 4KRDA 1FMOE 3R22A 3BBTB 5IUGA 2ETMA 3VUDA 5H2UA 2PU8A 4L7FA 4H3PA 3LM5A 4L45A 4AAAA 2OW3A 3PVUA 4FTKA 4NH1A 3AMAA 3KRRA 2JIUA 3NNUA 3OROA 5DGZA 3WILA 5E4HA 1B39A 4G9CA 2C3LA 4ZY5A 2BMCA 5KMMA 3PLAE 2CGVA 1GIIA 3QBNA 4CKRA 1XH8A 5HCXA 3RHXA 1YW2A 2X8IA 4A7CA 5LVMA 4YZNA 5HLWA 2Y7JA 4E73A 3LCTA 1LUFA 3KL8A 3HAMA 4QMSA 3H30A 1W7HA 4ENYA 3F3ZA 5AUXA 3BU5A 2OG8A 4JOAA 2VTJA 4OBOA 2I0YA 1ZMWA 4BC6A 4UXQA 2QQ7A 4GMYA 5KZ0A 3QXOA 1T45A 4LG4A 1YWRA 4U41A 5KMKA 5CVFA 2VTAA 2JKKA 4H39A 5CVHA 1BL7A 5B2KA 4DG0E 4F0FA 5HESA 3R9HA 3SC1A 3QZHA 4IFGA 1PW2A 4FV3A 5C03A 1XH5A 3UZTA 2GNJA 5IA4A 3NDMA 4QTAA 2H9VA 2H6DA 4TYGA 3UC4A 3QX4A 4CV8A 3W55A 4IWOA 4FSTA 4F7JA 2A4LA 2WFYA 5ACBC 3MYGA 4LMNA 4B7TA 5HZNA 4AZFA 2GQRA 2GQSA 1ZLTA 3WF8A 4BKZA 4WOVA 5IUHA 2VU3A 4QQTA 4RWKA 1ATPE 5E8ZA 4DLIA 2B52A 3VS5A 5JQ8A 2YM4A 5KO1A 2WPAA 1R1WA 3PXQA 4EH5A 4NM7A 3OTVA 5ITAA 2J4ZA 3S0OA 1Z9XA 4Y83A 2VV9A 4UEUA 4WD5A 4L53A 3PIYA 3L9NA 3LAUA 4G34A 4K9YA 2J2IB 2BCJA 3TKIA 5EM5A 1BLXA 4F63A 4IQ6A 3HL7A 3MS9A 4CG8A 4X3JA 2WHBA 3KFAA 4D5KA 1WCCA 4WBOA 5K0XA 1YXTA 1ZYJA 2BAKA 2F7EE 3LFSA 4O96A 4FC0A 2VWUA 4HZRA 2VWZA 4U42A 1GZNA 3C1XA 3UBDA 2ZDTA 4DYMA 3AT3A 5CAVA 3MY0A 3TKUA 4EH9A 3R1QA 2VTTA 3E64A 4IX6A 1KV1A 4EUTA 2HXLA 4J52A 2IVTA 4KWPA 4MXZA 4RWIA 3QRTA 3QQGA 1JLUE 2XJ0A 3D4QA 5CI6A 4JDKA 5EYCA 5HE0A 5IMXA 2XNPA 3FSFA 2PUIA 3QX2A 1FVTA 1BKXA 3FMKA 2H96A 2PVFA 3CJFA 3CTQA 4FKUA 4QMNA 4C4FA 2R9SA 4DTBA 3F5XA 2W1FA 4UWCA 4YBJA 5HBHA 3IGOA 5CEQA 1JKTA 3RPVA 4J53A 4CLIA 4JR3A 5IH5A 2ESMA 2R3QA 4C61A 2C69A 4IBMA 4DGMA 3F5UA 4U44A 3FYJX 3UVPA 3RWPA 4MH7A 4IZ5A 1H28A 3HRCA 3T8OA 1H0VA 3ODYX 4D2PA 3EFJA 3MIAA 4G9RA 3FZOA 5M44A 3E62A 2WMXA 3OMVA 4RVMA 2ZYBA 4FV9A 4NFMA 4CZUA 4BWKA 4M0ZA 5KHWA 4KNBA 5K9IA 3OWPA 3C5IA 4KD1A 4R3PA 4O7YA 3FPMA 4TL0A 1YKRA 5JN2A 3BBWA 3BU3A 5FDPA 3W2PA 2WOTA 4FV0A 5LARA 4EC9A 2C30A 2C0TA 4UX9A 3QTXA 5HKMA 3UNKA 4JXFA 3COKA 2PY3A 4FL3A 4MXYA 4OUCA 2W1IA 4M69B 4JG8A 3W16A 4AGDA 4AOIA 5F9EA 4GYGA 4O7SA 3R7UA 1W98A 1BMKA 3U54A 4UMQA 4I41A 2F9GA 2HZ0A 2QURA 3DFCB 2EXMA 3OW4A 1DI9A 2CLQA 3HP2A 1GZ8A 4R3RA 1BI7A 4RX8A 5I3OA 3ZFYA 2DYLA 5J9LA 5AFVA 2WGJA 2BRBA 2EWAA 2GSFA 3CQUA 5CSHA 3AT2A 4UXLA 5DVRA 5CLPA 4RC4A 2R3RA 3W33A 3ZMMA 4MEDA 1REKA 3FXZA 4BRXA 2X4ZA 1OITA 2XNGA 4XUFA 3TNIA 4ZSGA 4DH3A 3FLQA 2B0QA 1NW1A 4ASZA 3A99A 2W5BA 3UMWA 1PMUA 2OI4X 2ITXA 4X2FA 4YZDA 2C6LA 1XWSA 4I22A 4ZJJA 3WBLA 3HECA 1PXKA 2QO2A 1GAGA 2YCFA 4U0IA 4XG7A 4QYEA 4I4FA 4DT9A 2HOGA 3IG7A 4FNWA 4YJTA 3SDJA 4FV5A 2IO6A 5EHYA 4NM5A 3QALE 4XMOA 1CKPA 4YC3A 4D2TA 4DBNA 5FUTA 5DHJA 5FM2A 4FEWA 2ZDUA 5AP6A 3MW1A 2HZ4A 3DLZA 4M67A 3LCOA 2I0VA 5B7VA 5I5ZA 4FSWA 5E8UA 3H9FA 4YTHA 3NVMB 5FXRA 1KUTA 4L6QA 1PXJA 2XIKA 3B2WA 4O0RA 3MB7A 4NFNA 4I24A 1RDQE 4LRMA 5F20A 5JRSA 4EQMA 3LPBA 2OXXA 4GL9A 4IZYA 1OBDA 4TN6A 4S32A 3HLLA 3P23A 3DK6A 3FI4A 4RJ3A 1TVOA 2C6KA 3OC1A 4UB7A 3QUDA 4YJUA 1WBNA 4FV8A 1OM1A 5LXMA 3FC2A 4UYAA 1AD5A 4EI4A 5DR2A 2J5FA 5EKNA 3KK8A 2I0EA 1YWVA 3AC1A 3TDVA 2QLUA 2BTRA 4FTTA 2VTPA 5BUEA 1ZYSA 3DU8A 4U5JA 4X3FA 3PJ8A 4PMMA 3K5UA 3E8DA 4KIKA 4Y85A 4O84A 5B2LA 2WTJA 3FKLA 3WF7A 2C6DA 1JQHA 3ZONA 2B9JA 2PZ5A 3BQCA 2OH4A 3ROYA 4HVGA 1WVWA 4I92A 2R4BA 4PP9A 4EK5A 1IRKA 4UYNA 5IEYA 4DH5A 4NJ3A 4IB5A 1XHAA 5HCYA 3GC8A 2JFLA 1DI8A 3JXWA 3Q53A 4IH8A 5DN3A 1OIUA 3TZ9A 2OK1A 2UW0A 5HO8A 4E6CA 4AN9A 5IA1A 5K0KA 1KE7A 1YHVA 4HGTA 3KQ7A 3LCSA 4IEBA 5TR6A 4V0GA 5HE3A 2CJMA 3D7ZA 5C8NA 1SNUA 5LCKA 4DG2E 3PZHA 3C4ZA 3MDYA 1J7UA 4QPMA 2SRCA 4ZMFA 1XH6A 2P33A 5EI8A 4ACCA 1U5RA 2C6TA 3ZRKA 4U8ZA 2X1NA 3AG9A 5DR6A 3Q6WA 4PRJA 3LFCA 2QOFA 3I60A 4BCNA 4MBLA 5AJQA 5KE0A 2Y0AA 5IQDA 5BYYA 3ATTA 4WG5A 4CQGA 2VD5A 4RIXB 5EDRA 3SGCA 1G5SA 2C4GA 1OIYA 3Q4CA 5KHXA 3QKKA 3QRIA 3C9WA 2IZRA 2IVVA 1H01A 4OT6A 2CHLA 3FSKA 4MXOA 4V01A 4CXAA 3O2MA 4C58A 4DBXA 4I5CA 4FT3A 4XV2A 3RI1A 4IX4A 2VTNA 2YA9A 3D5UA 3GI3A 4TXCA 3IONA 4WHZA 5AP0A 4PX6A 5BVKA 3RPSA 3W2RA 3W8QA 3IO7A 4JT3A 4AX8A 3U8WA 3QXPA 2I40A 4WG3A 4H58A 2GTNA 2PWLA 5C1QB 2OXDA 4EOLA 4AS0A 4C37A 4F9AA 2UZBA 2W9ZB 2WTKB 2QG7A 5DRDA 2WMTA 2YJRA 3HMIA 3OD6X 5AAEA 3KK9A 3HV4A 3MFTA 4PL3A 3NNWA 4FZ6A 4M97A 3NGAA 3CC6A 4W8DA 2EXCX 2C5NA 3AXWA 4FR4A 4RX9A 4OAUC 3ZEPA 3BHYA 5HVYA 4AUAA 5HD4A 3SXSA 4YHTA 5EHOA 2R3OA 1H1SA 4FG8A 4FUXA 3S1HA 5ANEA 3VUIA 5A6NA 2E9NA 3JY0A 4PTCA 1REJA 5C8MA 1UKHA 2HAKA 3UQFA 5GJGA 3MN3A 3AC2A 3NPCA 4HCTA 4R5SA 4BTFA 4D9UA 2WTWA 3ETAA 1QMZA 5L8KA 2DUVA 4U40A 3F88A 3Q5IA 3ZLSA 1KE9A 3Q9WA 4BTMA 4P7EA 2Z7QA 2P4IA 2WMRA 4RA5A 4DGGA 3UDBA 4JX3A 2ITZA 4R7HA 5CVGA 5HHWA 3ZO3A 4BGHA 3NIZA 4E8AA 2ITPA 2PZRA 2GTMA 4IAIA 4FKQA 3TZ8A 4D2RA 2QI8A 2OGVA 1XBBA 4M7IA 3LJ2A 4R3CA 1WVXA 4I5MA 4LV5A 5CAUA 4IAYA 5TT7A 4BBEA 3PPJA 4M68A 4EOJA 4C3PA 4Q9ZA 5HORA 2UW4A 2CN8A 2PE0A 2QOHA 2XIRA 2QKWB 2BFYA 3QGWA 4O1OA 2WU6A 5HLNA 3GUBA 1K9AA 1CKJA 4N4SA 3HV6A 3P78A 4L9IA 3ZDIA 2IG7A 5FWKK 3O96A 1ND4A 3KREA 4AWIA 2CDZA 4OW8A 4W4WA 3FHIA 5I0BA 2YJSA 3ELJA 2BRNA 3D0EA 3R28A 4FIHA 4DEDA 3AC4A 3RGFA 1ZWSA 4YC6A 1H8FA 4GT3A 2BFXA 4D9TA 1WZYA 4EWQA 3K54A 4QPAA 3PXFA 4A07A 5J7BA 4BI1A 1RJBA 2BAQA 2GCDA 4IX5A 3V5LA 4UMUA 3JYAA 4TT7A 2PZYA 3UO4A 4QP9A 1Q5KA 3UOHA 4AZSA 5CU0A 4XP2A 4X0MA 5CAOA 2FUMA 4GFOA 3HDMA 4WO5A 4ZZNA 2R3IA 1R78A 3DQWA 3FI8A 3EOCA 5DG5A 4AGCA 3DNDA 3LCDA 5H8GA 3D5XA 2ZVAA 3EWHA 4FICA 4D2VA 3QKLA 5IQGA 1AQ1A 4EZ7A 3MA3A 4QQJA 2PTKA 4CEGA 3F82A 1ZYDA 2G15A 3PXRA 4AW5A 4JDIA 4EBWA 4FNXA 5ANOA 3EJ1A 1WMKA 3LIJA 3UPZA 3QTRA 2WQBA 2Z7LA 4RIYB 4EBVA 5AV0A 5HG7A 2V55A 2ZB0A 3L8XA 3IOPA 2YM6A 2WOUA 2ITTA 3NIEA 3VS6A 4OTRA 4WSQA 1PY5A 5L2QA 3PUPA 3QTIA 2PE1A 5JKGA 5C9CA 4XLIA 3W18A 3POOA 3ROCA 3VBQA 2BTSA 4F08A 1XO2B 3UOKA 3PRIA 3AT4A 1J1BA 4YJSA 5FP5A 3SQQA 3UOLA 3MPTA 3HKOA 3EQGA 4U3YA 4EOMA 4IE9A 4PMTA 2C6IA 4WRGA 3G6GA 3Q9XA 3SXRA 4U79A 4FOBA 3SHEA 1H1PA 4CLJA 4MD8E 4D1ZA 4JBOA 2NPQA 4JIAA 3NMUF 3P0MA 5GINE 2XYNA 4TNDA 2WZJA 4RVTA 3G33A 4MKCA 4B8LA 3MBLA 3G0EA 4F6SA 4H36A 4O22A 3NCGA 3LFFA 4EONA 3C13A 5EDPA 3LFAA 4CD0A 2XS0A 4EOIA 3RM7A 1G3NA 1P5EA 1U46A 3FPQA 1ZAOA 2XKCA 3O0GA 3VUTA 2BHHA 3RCJA 3R9DA 3V6RA 3ZFMA 4UMPA 3RCDA 5JZNA 3IW7A 4IAAA 4BN1A 5JGDA 4D58A 5D1JA 2I1MA 3QQUA 2YLFA 2ZMCA 4ZK5A 2W1EA 4IHPA 4AP7A 4CYIA 4GT5A 4RBLA 3TI1A 2YFXA 3R7VA 3MV5A 4GK4A 1DAYA 3TNQB 3ZFXA 1J91A 2J0LA 4GW8A 4GU6A 4IWPA 3DJ7A 2JLDA 3LXNA 1OL1A 2Y9QA 3K3IA 4TY1A 3U87A 5CEIA 2XEYA 3R73A 3Q2JA 1J3HA 4YLLA 1SVGA 1RQQA 5IEXA 4YLKA 2RIOA 3T3UA 3SKCA 3RAKA 4ANQA 3LXKA 5BVEA 1YDTE 3QD2B 2Y6OA 3UC3A 3BE9A 2VNYA 3L8PA 2QKRA 2YN8A 3COHA 1F3MC 2WQMA 2JIVA 4BZNA 2W5AA 4HPUE 3ZZWA 3TDWA 3R1SA 2AC5A 3C4EA 4QNAA 4U6RA 1GNGA 1YI6A 3LMHA 3KULB 3VQUA 1K3AA 4Z16A 4R8QA 4YJRA 5A4LA 4O7TA 4DTAA 4K6ZA 1NA7A 2Z02A 4XG3A 2V62A 5DE2A 2J0IA 2R3NA 3FKNA 2WQNA 4I0TA 5E8WA 3Q5ZA 5LVOA 5J5TA 3KULA 5ANKA 3C4XA 4WG4A 4FTMA 3TT0A 2JBPA 4PDYA 1SM2A 3LE6A 1W8CA 4AZTA 2XA4A 2B55A 2YM3A 3FLZA 5ETFA 3EZRA 3DAEA 3MVJA 5GZAA 3ZU7A 2C1BA 2EVAA 4R1VA 2XNMA 3E8EA 2FYSA 3NNVA 3BHHA 3PXZA 2J0JA 1CSNA 4JRVA 2R5TA 2XCHA 4B4LA 1H00A 2RG6A 2YISA 3N4UA 4AACA 4F7NA 1OKVA 1YVJA 2KTYA 4FVQA 1Q8TA 4YGAA 1Y57A 2VWIA 3OCSA 3VS3A 5IU2A 5HE1A 4IXPA 2FSOX 4E5BA 1MRYA 4Y8DA 1ZARA 5I9VA 3Q4ZA 3MY1A 4O0SA 4BHZA 1JVPP 5BPYA 3NZ0A 1Y8GA 4TPTA 4RZWA 5ANDA 3TKHA 5GZ8A 2B9HA 2X7FA 4M66A 3P7BA 4ALUA 2YIRA 4E6DA 2WMWA 4NWMA 1WFCA 4EK3A 4QP2A 3FZPA 3SVVA 2XBAA 4I21A 4PTGA 3QQLA 4GIIA 4FIFA 2BKKA 4TWNA 5J87A 3R7OA 3NLBA 3EQPA 4UY9A 3TUDA 1PXOA 3GC0A 2R7BA 3FHRA 1Q8WA 4IJPA 1IR3A 2XF0A 3UZPA 3CY3A 3MA6A 2GMXA 5IH6A 3PJ2A 3GVUA 2Z2WA 4FZAB 3KXMA 2BVAA 2WMAA 3FWQA 2CCHA 4FYNA 4GIHA 4O27B 3IW5A 5IPJA 5HNIX 4EHVA 4IAFA 4RLKA 4GG7A 3FLYA 3DPKA 4IFCA 4WNKA 3MVHA 5JQ5A 2XK9A 4MCVA 3ZLXA 3OWJA 3VS2A 4Y46A 5AUVA 3KN5A 4E7WA 4BBMA 4WSYA 3E92A 4YNOA 5DMZA 3NW5A 4BCIA 5JSMA 5HD7A 1TKIA 3UO5A 4UALA 3LXPA 1H1WA 4LOOA 3H9RA 3FE3A 5E8TA 4WUNA 3N4TA 5J7HA 3ZXZA 3PZEA 2CLXA 4L46A 3UO6A 4DFZE 2B53A 3RVGA 3TN8A 3PY3A 5CT0A 4ERKA 4IWDA 3QQFA 5HEZA 4ZJVA 3FQSA 2ERKA 4XLVA 2PHKA 2VTHA 3MTFA 2R2PA 3ANQA 4P90A 2ZV2A 1Y6BA 2JKMA 1JOWB 4NZWB 2Y4PA 3ZXTA 1OL7A 3RPOA 4DE4A 1ZRZA 2QC6A 4HYHA 4XX9A 1YXUA 2BHEA 4BWXA 2QR7A 2VGPA 4QMZA 4NCTA 5BX0A 2G9XA 3EMGA 2QOQA 4QNYA 5AX3A 4K11A 4DCEA 5I4NA 2UZDA 5JFXA 2X6EA 4F1TA 5FD2A 4EQCA 2G1TA 4ZTHA 3QGYA 5M51A 4I6FA 3EL7A 1R3CA 5HI2A 2JDTA 3KXGA 3QRUA 4LYNA 2PYWA 2IZUA 3DQXA 3L9MA 4MNFA 4Y73A 4Z9LA 5LMKA 2J51A 4IIRA 3OXZA 4RJ8A 4AFEA 3NCZA 2XK3A 3HNGA 4GUBA 5AM7A 4N0SA 2PMNX 4RJ6A 4ZIMA 4F09A 2YAAA 3DDQA 3FLWA 4YHFA 2EB3A 4RVLA 3IS5A 5FP6A 3V8TA 5AUTA 3FMLA 1PXIA 1PHKA 3QTUA 5HQ0A 4G5JA 3TNPC 3UG2A 3OZ6A 3KCFA 3BWFA 3O23A 4ANSA 1PXPA 3GCPA 4FTNA 1Q41A 3GQIA 3F66A 1ZMUA 2PVNA 3DZOA 3DY7A 5AA9A 5DOSA 4AGUA 3ORLA 4HCVA 1M2QA 5DLSA 3RAWA 5AX9A 3CTHA 2GS2A 3LMGA 3O7LD 1QPDA 3R30A 4HOKA 4ID7A 4XP3A 1GZKA 3O71A 4FVPA 3VC4A 4AW1A 3D7TB 4FX3A 3I5ZA 4JNWA 5D9HA 3W2OA 5IKWA 3RNIA 3PVGA 1CMKE 4CVAA 5HIEA 4YJPA 4O86A 2BZKB 2GNGA 2XKFA 1V0BA 3QUPA 2GFCA 5M07A 4NCTC 3OHTA 3TV4A 5H9BA 2GS7A 3VIDA 4CG9A 4YTCA 2JEDA 2QO7A 3BYMA 5I9UA 4F4PA 3H4JA 3VWAA 2HCKA 1IAHA 5F94A 5C8KA 2CKOA 3F5GA 3MB6A 5FGKA 3R00A 2PUPA 3H9OA 1OPJA 2XJ1A 2YERA 1CKIA 2Z60A 2UZTA 4YHJA 2WQOA 4ENXA 3E87A 4BI0A 4O82A 3LLTA 3PPKA 4XG6A 3R8MA 4KIPA 5KCVA 2OKRA 2ZJWA 4IVDA 4FKIA 4FA2A 3B8QA 4DH1A 3QTWA 1ZZLA 5B2MA 5L6PA 2W1ZA 3Q52A 4O83A 2WNTA 3QF9A 5ETIA 3UQGA 1M17A 2XKEA 3KXHA 3OOMA 4KBAA 5M57A 4AE9A 4II5A 1FBNA 5IEVA 4YJOA 3DBCA 1YXVA 5J9YA 3ET7A 4U97A 5IZFA 3A2CA 4FKLA 3FXWA 4YLJA 5KBRA 4RIWA 2ZM4A 3PSCA 2XB7A 3EB0A 2JDVA 4ZTQA 5HG9A 2W1DA 5CU2A 3HVCA 3AC8A 4TW9A 4ARKA 1RE8A 3R21A 4EC8A 4PPCA 4CFUA 3SA0A 4FK3A 4FV7A 5A4QA 3RHKA 5CQUA 4RX7A 5A54A 4OR5A 5IF1A 1JPAA 4O1PA 4D0XA 3P7CA 3WARA 4MHAA 2PPQA 5J1VA 4MXAA 1OPLA 4EEVA 1OL6A 2EXEA 3IDBA 3C5UA 3Q4TA 4RIXA 3AD6A 2QOCA 4D5HA 4M84A 3AGLA 4O0WA 4S2ZA 4M3QA 1DAWA 4FEXA 3KF4A 2YCQA 2OO8X 2IZSA 4G31A 2YWVA 3PIZA 2HELA 3VUGA 3F2RA 4XBRA 3BELA 3CQEA 2ITOA 4ZTSA 4QOXA 4J71A 4EK6A 3C50A 4QMVA 4CMUA 3DAKA 1OUYA 4XG2A 3KRJA 3EQFA 2HXQA 3QYZA 5AIRA 4BCMA 5D10A 2J50A 2EU9A 5HGIA 4F6WA 3DOGA 5CF8A 5J79A 3G51A 5IG1A 4G1WA 4E20A 3E8NA 3BGQA 4PDPA 4GVAA 5JFSA 2X0GA 1PKGA 3CIKA 5M56A 3KMUA 4CCBA 3WE8A 3A7GA 3PA3A 4FT9A 4XS2A 3ZM9A 5F1ZA 5GJDA 2Q0BA 2ITYA 4WKQA 4CT2A 5CEPA 3QYWA 3VF8A 3ZSIA 1ZY5A 3PYYA 4IVCA 3R2BA 3JS2A 2QHMA 2W0JA 4J7BA 4CTCA 2JAVA 3H0YA 3MSSA 4I0SA 2W99B 3AMBA 3ODZX 1L3RE 2ETRA 2ITVA 3V01A 3EKNA 3V5QA 3BU6A 4CYJA 2ZMDA 3KN6A 3HMOA 4IJ9A 4LV8A 4ACGA 3HUBA 3E8CA 3G9NA 2P2HA 4FKPA 4WT6A 3E63A 3KRWA 2VTRA 3OXTA 5EKOA 2UZOA 2J6MA 2PK9A 1UKIA 3FDNA 5EM6A 1JKSA 3QLFA 3H3CA 3FQEA 3PFQA 4FZ7A 2VX0A 3RPRA 3ZS5A 2Y8OA 4JI9A 2WMQA 1XH4A 4M0YA 4MXXA 5AUZA 4BB4A 2JBOA 3I6WA 4QO9A 2CPKE 4FTOA 3HX4A 4A9RA 3BHUA 1XJDA 3QA0A 2O0UA 3FL4A 3BZ3A 3GC9A 1S9IA 3P4KA 3UPXA 3WIGA 3I6UA 1MUOA 4RJ7A 4FG9A 3PJ1A 4EH6A 4YP8A 3KXXA 3PY1A 3FLSA 4RIYA 3NUUA 4N6YA 4APPA 3MTLA 4OAVB 4G6NA 3SX9A 4C2VA 4L3LA 2B54A 4NU1A 4O7NA 4O2PA 2R3FA 4RFYA 4TNBA 5DFPA 4C57A 4ZP5A 2O8YA 2V22A 4CMTA 3EQIA 1ZYLA 3I5NA 5CXZA 3NYVA 4EL9A 5JH6A 4ITHA 4JQ7A 4WA9A 3S2PA 5DH3A 4L7SA 4HJOA 3CE3A 5DEYA 4QMWA 4DTKA 5IQCA 3OEFX 4EHZA 4O38A 2CMWA 1XR1A 4C4IA 4AW0A 4IX3A 4F1MA 4ZJIA 4ANBA 3QTZA 1XH7A 2P55A 4JIKA 4CV9A 1O9UA 5HTCA 2OBJA 4FTIA 4ZS4A 4I5HA 3EFWA 2PULA 3CEKA 5M09A 1E1VA 2WB8A 5G6VA 5FEEA 3TACA 4F9BA 5IA0A 4WRSA 1YOJA 1W82A 2RKUA 4L42A 5M55A 3UNZA 3DAJA 2G2IA 2GU8A 3RK5A 5M4CA 3LQ5A 3VAPA 5ACKA 3MFRA 4WUAA 3KKVA 5JK3A 4TYHB 5AADA 2ETKA 2R64A 4OTFA 5CU4A 1XKKA 3ZC5A 2ONLC 4YPDA 2O2UA 3UTOA 2WIHA 3D7TA 4JG6A 4BCKA 1G8AA 4F9WA 2X2LA 1WBPA 4A4XA 2YABA 3TJDA 4R6VA 5AUWA 4K77A 4ZXTA 5A9UA 4RT7A 5E91A 3CSVA 4H1JA 4UWBA 3O8TA 1SYKA 2C5YA 5EQEA 2AYPA 2PVLA 4JDHA 5AV3A 2BUJA 5CY3A 4BWPA 4RSSA 4XP0A 4IB1A 3ZCLA 4PV0A 4MTAA 3FI3A 4YSMA 4RA4A 4EH4A 2W5HA 4H3QA 5IQIA 3PJCA 2QODA 2CKEA 2OF2A 5DYJA 4QMLA 4EK4A 3Q04A 3CP9A 4RIOA 4IC7A 2VGOA 4TTHB 4RPVA 4TWOA 4MX9A 5DPVA 1ZOHA 5BVDA 5IQFA 1JSTA 4AG8A 2XM8A 3WZEA 2X39A 3VW8A 3L9PA 1M2PA 2XH5A 2BZJA 3QHRA 2ZB1A 4C35A 4EOQA 2VTLA 4AE6A 3DZQA 4C4EA 2CKQA 1JBPE 3NUNA 1UV5A 3EQHA 3ZZEA 3EKKA 5KMOA 4OTIA 3B2TA 2HZNA 5FEQA 3ZHPC 4BIBA 1NVSA 2PVKA 3I0QA 4NK9A 3UMXA 2I7QA 2AC3A 3NEWA 3QHWA 3FYKX 4C8BA 1XBCA 3PA5A 5LJJA 4QMTA 1X8BA 3NUPA 4IAKA 5E1SA 4BYIA 2W9FB 4R77A 3LM0A 3EHAA 4RZVA 3UVRA 5EOLA 3BYSA 3GCUA 4O7RA 3JUHA 4JDJA 4S31A 4O0TA 4BDDA 4YO4A 4FIGA 4AZWA 4GYIA 1PMVA 3R0TA 4FIIA 4FTUA 3UVQA 2WEIA 3SG9A 1YHWA 3BEAA 4DEAA 3B8RA 1URCA 4WNPA 3R71A 3NRMA 4BVUA 3TEIA 4YZBA 1S9JA 1NT2A 3OOGA 2WKMA 2ZM3A 3U4WA 4QMPA 1Z5MA 1MP8A 2F7XE 3SRVA 4K8AA 3D94A 4AW2A 2ITNA 3GBZA 2W06A 4FTLA 3LJ0A 3ZO1A 4BTJA 3HEGA 4Y5QA 2F49A 1E9HA 4FV6A 3FUPA 4I3ZA 5EG3A 5H8EA 4QP6A 4ORKA 4Z55A 3U6IA 3W2CA 2PUNA 3LFBA 3FZRA 5T68A 3NNXA 1BL6A 3DK7A 2X7OA 4PP7A 3GOKA 5E8SA 5FTGA 1OL5A 4FGRA 3QZIA 4MVFA 5JRQA 5IA5A 3FMDA 5IISA 5AR5A 1MRUA 4UV0A 5KNJA 5ANIA 5AR7A 2J0MB 2Z7RA 3DK3A 4KBKA 4A9SA 2JDOA 3LCKA 3Q2MA 5DT3A 5BMMA 5I9WA 3I0OA 4R78A 3TZ7A 4O0YA 2X7GA 3UYSA 4EYJA 2Q83A 3ZO4A 4L44A 3ZRLA 4X2NA 3SW4A 2QD9A 2W96B 3TL8A 4G17A 4ANMA 3R1NA 4DCAA 2XRUA 4NYEA 2ERZE 4FGBA 5I9XA 2GNHA 3CR0A 3ENMA 4ACHA 1LEZA 3MH2A 3CLYA 5AIKA 1GJOA 1VR2A 2BROA 4XG9A 3MFUA 4ZTNA 5FG8A 2C0IA 3FI2A 2G2FA 4P5ZA 5E92A 5L2IA 2G2HA 4USFA 3IDPA 1J7IA 4R7BA 4PF4A 3OCBA 4D2WA 3DDPA 4Y95A 1Q8ZA 1YHSA 3NVKI 2XYUA 3R8LA 3CBLA 3R9OA 5AP5A 3FY0A 3OVVA 5JMSA 2VZ6A 2V0DA 3L1SA 5IUIA 2RFEA 4EOOA 3UZRA 5IH4A 2ITQA 2JC6A 4K0YA 5E8XA 4A4OA 5L6OA 3PY0A 4QQ5A 4YBKA 5L8LA 1QPJA 4J8NA 1V0PA 4YJNA 1NVRA 1WBSA 5CYIA 5EHLA 4Z7HA 3U51A 4IDTA 3AC5A 2BIYA 3TZMA 4Q9SA 3C4WA 2XP2A 4UMRA 2BPMA 2V5QA 4ACDA 3M2WA 3ORZA 4C34A 1MRVA 2E9UA 3D14A 3G2FA 4I6BA 3EIDA 3MVMA 3OS3A 2BALA 4MNEA 1PXLA 4OTDA 3WZUA 1PYXA 5CQWA 1UU3A 4DLJA 5EQPA 2ACXA 4IVAA 2VO3A 4FKWA 4RC3A 2YEXA 3VULA 2BZHB 5KKRC 2RFSA 3BPRA 3CKXA 4ZLOA 3BKBA 2VO6A 3ORKA 4V04A 3QC4A 3DTCA 1UWHA 1ZY4A 4GFMA 5DRBA 3I81A 4OT5A 5AM6A 4C2WA 2P2IA 5C26A 5LWMA 3TUCA 2QHNA 4IDVA 4ZTMA 5JFVA 4LL5A 1G8SA 5EOBA 3P1AA 3PTGA 3BEGA 1JNKA 4GEOA 3BLQA 3G9LX 3FAAA 4XJ0A 1U4DA 2J7TA 3KF7A 1OKZA 5AP4A 4QMQA 3DV3A 1P2AA 5IQHA 2HWOA 4N6ZA 4DA5A 1OIRA 2VTOA 2OIQA 2VX1A 3OW3A 2IW6A 3OXIA 1H27A 1AGWA 3NAYA 5AP3A 4DEGA 4BCGA 4YURA 5E9EA 3DA6A 4NSTA 5AUYA 2IWIA 4RVKA 4B8MA 2YLEA 1XH9A 3C51A 4CRSA 4JAIA 3IOKA 4C38A 4QMOA 4A9TA 5HTIA 3SAYA 5EDQA 5IA3A 4GJ3A 5EYMA 4Y72A 4J98A 5LWNA 5KBQA 4BCJA 2PMIA 3KRLA 4TWCA 4P4CA 1J7LA 4GVJA 5HO6A 3GU8A 3QCQA 2C3KA 3QCXA 4PPBA 4HYSA 4BHNA 4X2JA 3K3JA 5HG5A 2WAJA 3CQWA 4M69A 3HZTA 4H3BA 3RP9A 3GU5A 1VEBA 2JDSA 5A14A 5AAGA 1WBOA 2Y4IC 1OL2A 2B1PA 5I9ZA 3JVRA 4ZS0A 3O8PA 3R2YA 3NUYA 1H24A 2J90A 3DGKA 2IW9A 2QOLA 4U43A 4BIEA 4XBUA 4A9UA 3ACKA 3D5VA 4L8MA 3RKBA 2XJ2A 1OKWA 5CZIA 4FVRA 5HVJA 4YUQA 2W4JA 3EN7A 4BIDA 4EHEA 4AZVA 4YPSA 4LRKA 3R7EA 1W84A 3EQRA 4FEQA 3REPA 1PKDA 2XIXA 4E4NA 4RLLA 4L68A 2F2UA 1LPUA 3PWDA 4ACMA 4F0IA 4U9AA 4EKKA 5FBOA 3DJ6A 5F4NA 5LVNA 4WBBB 1F0QA 4FUYA 4JBPA 4EH3A 4W4YA 3HGKA 5BUJA 3KGAA 2XUUA 1BUHA 2Q0NA 3A60A 3ZOSA 4F70A 2F7ZE 4KSPA 5L6WL 2B9FA 4DC2A 4GSBA 3BQRA 4MD7E 2W1HA 4P5QA 4CFMA 2I6LA 4MQ2A 4QP7A 4XRLA 3WYYA 3ZO2A 4ALVA 3ORTA 5DT0A 4BDEA 1H25A 4Z3VA 2BKZA 3FKOA 3IW6A 3JVSA 5M4FA 4FEVA 3F2NA 1YI3A 4L3JA 4MWIA 3RAHA 4I5PA 1APME 2OZAA 3WI6A 3F9NA 3QQHA 3F6XA 2KULA 4YZ9A 5GIOE 4F99A 5KKRB 2JDRA 5FEDA 5T3QA 3QWKA 3AD4A 1PXMA 2NP8A 3DFAA 5FTQA 3CKWA 4KIOA 2A27A 2GS6A 4FKRA 5CF4A 3JR1A 1KSWA 4EHGA 4E4LA 3VJOA 5HU9A 3COMA 5BNJA 4BICA 4AFJA 5HVKA 2B9IA 4CQEA 4KINA 3EH9A 4QP1A 4XCUA 3BHTA 4IB3A 5AP2A 5K4IA 4XG4A 4BDHA 5BMSA 3WZKA 4EYMA 3OBJA 2YIYA 2WXVA 4GT4A 4EZ3A 1PF8A 2IVUA 2X2KA 3DBDA 4IZ7A 2QOOA 4MAOA 2V7AA 5IQAA 2A19B 5AR3A 4CTBA 2C6MA 3GOPA 5BVFA 4PWNA 2X8DA 5FXSA 4KABA 4FT7A 2YWPA 3BCEA 2HW6A 3C4FA 5LMAA 4M8TA 2XK8A 3PA4A 2WIPA 2AUHA 3G90X 4GK2A 4C3RA 3HYHA 4I6HA 2FSMX 3EN9A 4PUZA 2UZWE 3WOWA 3ZDUA 4FF8A 2QU6A 3U6JA 3LFNA 1FINA 4E6QA 4FTQA 2VO0A 4X2GA 1SVHA 5A4EA 1WBWA 3FZ1A 2UW3A 5CAPA 5HU3A 5J9ZA 2WELA 2UZNA 5M06A 2GNIA 1W83A 2XNEA 1KOAA 3BX5A 2R3LA 5T6KA 1GZOA 3RM6A 2GDOA 5KMNA 4YC8A 4YO6A 2HIWA 5CEMA 2OJJA 1QCFA 5CTPA 2WTDA 3ORNA 4E26A 4ZSAA 3S4QA 5BVNA 3PSDA 2XEZA 4Q5EA 3F3UA 4PQNA 4LRJA 3DKGA 5CANA 3M11A 4BGQA 1UA2A 4D4YA 2C6EA 2LGCA 5EYDA 4AGWA 3KXZA 5CT7A 4IAZA 4AU8A 1L8TA 5A46A 1M14A 5HIBA 3RWQA 4TYIA 2HYYA 4YNEA 1Y91A 1BX6A 1TQPA 4JVGA 3P86A 4U45A 2OJ9A 5DT4A 3R7YA 3SXFA 3GCQA 3FMHA 1O6KA 3ZLYA 5CU6A 2VX3A 3LXLA 4BTKA 5CSVA 2QOIA 4OGRA 1OPKA 2ITUA 3UP2A 5KMLA 3VS0A 1HOWA 3WF5A 3VBYA 3UIUA 3UP7A 2A1AB 2G01A 3ERKA 4FKOA 4BDGA 4PNIA 4Q2AA 3ZEWA 3Q32A 5TOZA 3EFLA 1NXKA 2P0CA 3FZTA 4QMMA 1OKYA 4FIEA 4HW7A 1ZOEA 2W1CA 4I93A 4DITA 4Z7GA 4NW6A 2UVXA 3SLSA 5M4IA 4DG3E 2IZTA 4FBXA 4GCJA 4EK8A 3E88A 1M7NA 3VBXA 4BCOA 4WNMA 5CASA 4EH2A 4IZAA 2X2MA 3IGGA 3KVXA 2C3JA 2WTKC 3G5DA 4HGSA 4JQ8A 5CNOA 3SV0A 3U9NA 3SOCA 3N4VA 1SZMA 5L8JA 3ZSHA 2DQ7X 3IKAA 3D2KA 2CGWA 2REIA 1IAJA 4TYHA 1QPCA 4FKJA 4MYGA 2YITA 4ERWA 2XIZA 4HNIA 3LVPA 5CSXA 3D2IA 4FTJA 4RWLA 2F57A 1VZOA 5IQEA 2NO3A 3VRYA 3CS9A 4KKEA 4NKAA 1KV2A 4DEIA 5JEBA 3EL8A 4DEBA 2FSLX 2X9FA 1Q97A 5KMJA 1Q8YA 2C5OA 1I44A 3QL8A 4K2RA 4JQEA 4EORA 4CZTA 5HG8A 2ZAZA 4CMOA 4XRJA 3NR9A 4FSRA 3VS7A 2YCRA 5FBNC 3PRFA 3LMIA 5IA2A 4S30A 1ZYCA 4BDJA 2WD1A 2WTIA 1JSVA 4FYOA 4KKHA 5DA3A 3F3WA 3LQ8A 4YJVA 1CM8A 2FA2A 2OZOA 4V0GB 3W10A 4DAWA 5A4CA 1R39A 3FEGA 1Q62A 2UZLA 4RJ4A 3A7FA 3EQCA 3LQ3A 4FG7A 5CI7A 2BILB 4NJDA 4YZCA 5HNGA 1UU9A 3RBWA 3ID6C 3ACJA 2BDFA 3F61A 3ZLWA 5DEWA 2EB2A 2P3GX 3QUEA 4W9XA 2RGPA 5CF6A 4AA4A 2UW5A 4MXCA 5DR9A 5FDXA 5AV4A 5HBEA 2PZIA 5K3YA 4AOJA 2CNVA 1SNXA 3N9XA 3FQHA 4IM0A 4G6LA 2C68A 4IADA 5A6OA 4RJ5A 3EZVA 2YDJA 3IDCA 4KKGA 1WBVA 5M4UA 1YXSA 4IMYA 2LAVA 2X4FA 4AA5A 4W4VA 4ZEGA 1LR4A 4ANOA 4G16A 1YRPA 3UIMA 5I9YA 1R0PA 2IJMA 5JZJA 4DGLC 4FSUA 3C0GA 4QRCA 3TG1A 4NM0A 2F2CB 4KA3A 1ZMVA 2VUWA 4DFXE 1M52A 3DTWA 3WF6A 5JGAA 5CAQA 3O7LB 3V5TA 4CNHA 5CF5A 2WQEA 2VWVA 1ZXEA 2E2BA 1W0XC 3BLHA 4CFWA 1TQIA 5GZ9A 4GJ2A 3CD3A 3I1AA 5DBXA 4MWHA 4E1ZA 3NYOA 2WMBA 4KS8A 3V8WA 3R63A 4CFXA 4FTCA 4GFGA 3U9CA 4JBQA 5J5SA
chains in the Genus database with same CATH superfamily
5KMIA 2YACA 3A7JA 1U5QA 1M7QA 2PVMA 5LMKC 4Q5HA 1GY3A 1T46A 2VTSA 1HCLA 3FV8A 2GFSA 3OT3A 3R7GA 2GHGA 2QG5A 5I3RA 3E3BX 3LLAA 3MVLA 1QPEA 3GC7A 4FJVA 4W9WA 4M12A 5CEOA 4DF3A 1UU7A 1U54B 3BIZA 4QTDA 4LUDA 4PL5A 5GHVA 1V1KA 4DT8A 5GIPE 4N70A 2V7OA 3A8XA 4BZDA 2C47A 4EUUA 3LKMA 2UV2A 2XMYA 4R5YA 1OIQA 3MH1A 2GNFA 4GKIA 3RK7A 4MBJA 3DB8A 3W32A 3DXQA 3MPMA 4F7LA 2W4KA 1UNGA 5AV1A 3T3VA 4DFLA 4BZOA 2WTCA 2XK4A 2OSCA 4BDCA 1A06A 1YDRE 3O50A 3OY1A 5AR4A 4AT4A 4AN2A 3PXYA 4M14A 3BRBA 5A4TA 4J96A 3KEXA 3RPYA 4HCUA 4HVIA 3I79A 4J1RA 3H0ZA 3VJNA 3W2QA 3KU2A 4FL2A 1OVEA 4ZMEA 5L4QA 2RL5A 3PG3A 4YJQA 3R04A 3HA8A 2FSTX 2O64A 4XYFA 2OF4A 5D11A 4FE2A 4FI1A 5M53A 3KA0A 5JFWA 3KB7A 2UW9A 5CEKA 4D4VA 4USEA 3Q3BA 3ZRMA 4M15A 3UE4A 4ASEA 5AR8A 4IC8A 3OWLA 1LP4A 3A61A 4MNEB 5HICA 1KE6A 2YZAA 3RTPA 1OZ1A 4QT1A 1H1QA 2PSQA 4QP3A 5C27A 2YM8A 4AAYA 4ZAUA 3BYUA 5LMBA 3GENA 3D5WA 4OTPA 1GOLA 5AEPA 3DCVA 3DBEA 3NW6A 4H1MA 3OUNB 3KY2A 2DWBA 3L8VA 2AQXA 3FLNC 3KMMA 4X21A 2GQGA 2OIBA 2PMOX 1Z57A 3QZFA 4MK0A 1FOTA 4K1BA 5TE0A 4MD9E 3HMNA 1B6CB 2BRHA 3SW7A 2Z8CA 2OJFE 5KUPA 3I4BA 2CGXA 3DNEA 3TV6A 4UN0C 3MIYA 4FSMA 1DS5A 2J0KA 4JRNA 2WMVA 5D7AA 3NYXA 5F95A 3VS4A 4YMJA 3UG1A 2R7IA 3HA6A 4XV1A 3C0IA 5TKDA 4FT0A 3FZSA 4BF2A 3Q9ZA 3RZFA 1ZZ2A 4BKJA 1YWNA 3PSBA 3GP0A 4D4SA 4RGJA 4BCPA 2Z7SA 3IW4A 4DFUA 2XRWA 4GUEA 2UUEA 3V51A 3R9NA 3DKCA 3MFSA 3QTSA 3I7BA 2QLQA 4L43A 4KAOA 3FXXA 4XG8A 3VVHA 4LGDA 2RF9A 3TJCA 4HVHA 3IW8A 4TYEA 1FMKA 5K5XA 4DDIA 2B7AA 2O65A 4E4MA 4BCFA 1O6LA 4FNZA 2R3GA 4JR7A 4J99A 3BGPA 2BDJA 3LFDA 3PLSA 2ZOQA 4FSYA 4G3FA 4TYJA 4BDIA 3R9RA 2J5EA 3W8LA 3QD0A 1JKLA 4LOQA 1H4LA 3QFVA 3GB2A 3T9IA 2ZV7A 1ZOGA 3D83A 3TWJA 3VBWA 4KSQA 3LFQA 5CWZA 3LFEA 3VUMA 4C36A 4I4EA 1Q24A 4D0WA 1IEPA 3R8UA 3SD0A 3IPHA 3E93A 2QO9A 4RC2A 2IW8A 3SRVB 3Q60A 5L2TA 4QYYA 1EH4A 3OT8A 4EOKA 4BCQA 4PNKA 5BUIA 4HVDA 2YDIA 2PMLX 4LGHA 1GIHA 2R3JA 4X6QC 2W05A 2FB8A 3AOXA 4QTCA 5FTOA 2RFNA 5EH0A 4XNEA 4F7SA 2HY81 3KRXA 4AOTA 1KWPA 4FNYA 3R1YA 4ANLA 1YOLA 4KBCA 4XHKB 3PIXA 5L2SA 4FODA 5CNNA 4QD6A 3QKMA 3PG1A 3QRJA 3NUXA 2C1AA 3CTJA 1PJKA 3ATSA 1FVVA 3WYXA 1XQZA 5BVOA 5EW3A 3U55A 2VNWA 3E3PA 5AUUA 3TTJA 3FMMA 1OECA 4C4JA 4RX5A 3AQVA 4E6AA 3QTQA 4JG7A 4YTIA 3TNWA 2OH0E 3HUCA 5HLPA 3ZH8A 4O2ZA 4MQ1A 4A06A 3OBGA 3CGFA 1TQMA 2FO0A 4F9CA 5ANJA 3RINA 4O6LA 1Q99A 2PZPA 4ZTRA 4K18A 4J97A 4FKGA 4O6EA 4FZDB 2ITWA 4JX7A 4G5PA 1OI9A 3PE2A 2QR8A 3F5PA 4BDKA 5A3XA 3NUSA 5J95A 1PMNA 1P4FA 4G3GA 1YXXA 3V04A 4QTBA 1B38A 5AP1A 2ZV9A 4QMYA 2RG5A 4C0TA 2A98A 2R0UA 5J8IA 3UIBA 3GEQA 4G6OA 4QP4A 3KC3A 4L01A 2WTVA 3UQCA 2J9MA 3HV7A 4LL0A 3DB6A 3HMPA 4GV1A 4TKSA 4OBQA 4ZOGA 4EJNA 3VQHA 1BI8A 5H3QA 2YIXA 3OUKA 2CNUA 4BY9E 4GKHA 3K2LA 2A2AA 3Q9YA 3VW6A 1VYZA 4RG0A 5HIDA 2VTMA 2RFDA 4FIJA 2WO6A 5D41A 4LDTA 3V5WA 3KCKA 2F4JA 2UZVA 3O51A 3VUKA 3S00A 4YR8A 1UVRA 2BDWA 3QCSA 4F6UA 5FXQA 3KVWA 3TTIA 3A7HA 4DEHA 3RJCA 2PVYA 3LOKA 4OTHA 4FKSA 4DH8A 2NNWB 4EKLA 3TUBA 4I23A 5K4JA 4FV2A 1A9UA 2C0OA 4E5WA 3EYGA 1H0WA 3F3TA 3MWUA 5ICPA 4DH7A 5CALA 2UW8A 1CDKA 4FSNA 5CENA 3RZBA 1UU8A 3PVBA 2VN9A 4MF0A 5C01A 4FSZA 4EJ7A 2E9OA 4HPTE 2VWWA 4NTSA 2XAOA 1UWJA 1VJYA 4QYFA 4B0GA 4C02A 4QYHA 4QYGA 5ANGA 1SVEA 5HX8A 2FVDA 5EFQA 3ZUUA 5DNRA 5E7RA 1OGUA 5LVLA 4ZZOA 4RIWB 4TWPA 3MJ2A 3VBVA 1FGKA 3UODA 4ZSEA 4PPAA 3A4OX 4X2KA 5ETAA 4XEYA 4AXAA 3FC1X 4BR3A 2WU7A 4C62A 2HY0A 4BFMA 2XIYA 4OTQA 4JBVA 4IANA 4AT3A 1K2PA 1PYEA 3MPAA 4FKTA 5E1EA 3V6SA 3BV3A 3AD5A 3P9JA 1A48A 1QL6A 3ORXA 5BQ0A 1F5QA 2C3IB 1FQ1B 4EQUA 1YI4A 2PE2A 5E8YA 1UNHA 3R6XA 3VHKA 3WF9A 4D55A 4U81A 2YZLA 3CPCA 3FBVA 4I1ZA 4PMSA 3P7AA 3ORPA 1WAKA 5HOAA 2VWXA 3DBQA 3OG7A 4EOPA 3TCPA 2CN5A 4PDSA 4XH6A 3ORMA 4KB8A 1OUKA 5HCZA 4B6LA 2CKPA 4DHIB 3RAIA 3RMFA 2Y6MA 4C3FA 4O0VA 4EH8A 2H34A 3PP0A 5EW9A 3HV3A 4O7WA 3ULZA 4E3CA 3S95A 4U80A 2PL0A 3KMWA 3VO3A 3PVWA 5GJFA 4CGAA 5LOHA 2UVZA 4IVBA 3TIZA 4ONAA 4F1OA 4LM5A 2YHVA 3P08A 1PXNA 3R02A 4W8EA 4GH2A 1W2FA 5HX6A 4H05A 3ZUVA 3JPVA 1Y6AA 2PVHA 3OFMA 3V5JA 5DI1A 1OB3A 3NX8A 4HNFA 5AAFA 3MH0A 1H1RA 3BHVA 3P79A 3H10A 4LI5A 3ML1A 3F7ZA 4CFVA 3HDNA 3R8PA 3IQ7A 3DKOA 3VF9A 4YTFA 4DINA 3GGFA 3PE1A 5HNBA 3FMEA 3FMJA 4AQCA 1IA8A 1Q8UA 2NRUA 3OEZA 4YZMA 1JWHA 1YQJA 2CGUA 4DGOA 4F65A 4HYIA 4S33A 4CCUA 4JLCA 1V0OA 3NW7A 5CX9A 4I20A 5L2WA 4O0XA 3BI6A 3LJ1A 2OWBA 3CY2A 4ZSLA 4ZZMA 5IDNA 4UZDA 2UW7A 3QD3A 5G1XA 4DFYA 1M2RA 4PDOA 3AC3A 1IASA 4AF3A 4DHFA 3A8WA 2XCKA 3ENHA 5KZIA 3QZGA 4BDFA 3G15A 4XV9A 3RK9A 4XOYA 2PVJA 4O7ZA 1UNLA 4NW5A 4MF1A 2ZM1A 3Q4UA 4KS7A 3MGYA 4BCHA 3PXKA 1MQBA 2PUUA 1PMEA 4QMXA 1KE8A 4O7LA 5BYLA 3D9VA 4AN3A 2HENA 4NIFA 3HV5A 3HAVA 1ERKA 2CCIA 4NIFB 3U6HA 4FL1A 4CSVA 1IA9A 4IB0A 3QRKA 4GG5A 3SOAA 3AMYA 5FM3A 4FMQA 3WZDA 5KX8A 3HMMA 4OBPA 5L3AA 2R3HA 1JKKA 4CFFA 2VRXA 2A0CX 4G3DA 4PY1A 4EH7A 5CSWA 4RMZA 3GU4A 4LGGA 4D4RA 3UNJA 5J1WA 4DFBA 3DLSA 3BWJA 3D15A 3QQJA 3THBA 4ZTLA 1P14A 2E9VA 2WMSA 3LHJA 2UW6A 3FJQE 3ZC6A 3IK3A 3SG8A 4C4GA 4ZY4A 4N57A 2YDKA 4L52A 3UGCA 2R3KA 4LQMA 2VO7A 2XNOA 2YAKA 3L9LA 4Y5HA 2VAGA 1H08A 1H26A 4HGLA 4ITJA 3KXNA 1XBAA 4APCA 2WMUA 4C33A 4GK3A 1J1CA 2XK6A 3R01A 2DS1A 2QNJA 4OTGA 2YCSA 2FGIA 3ULIA 2QU5A 2XVDA 3ZM4A 3IECA 3OF0A 4X7QA 4BBFA 3VHEA 4UWYA 2X6DA 2GHMA 2XBJA 3ALOA 3QU0A 4EOSA 4FTRA 5HO7A 2GHLA 4G3CA 2HZIA 1JAMA 5EYKA 3TV7A 4S34A 5C4KA 4NTTA 4EWHA 2UVYA 2XKDA 3O8UA 4XOZA 5AWMA 3R8VA 2E9PA 4LOPA 2JFMA 3JY9A 3ITZA 3LZBA 4PTEA 3BYOA 5LVPA 3W0MA 4NL0A 4IW0A 1FPUA 4FZFB 4NUSA 4D1SA 4IWQA 2ZV8A 1VYWA 3OCTA 4CT1A 4FV1A 5EM8A 1STCE 4D28A 3ZYAA 2OLCA 3MI9A 3O17A 2GNLA 2XZSA 5LQFA 4PMPA 1R0EA 3MJ1A 3TXOA 5IMEA 4O21A 1U59A 2OJGA 3F2AA 4HZSA 5EK7A 3S3IA 4CRLA 2C5XA 3CJGA 2I0HA 1GIJA 4A4LA 2JD5A 2HW7A 3EFKA 3EQBA 4P2KA 1DM2A 3A7IA 4C59A 1PRYA 3NUAA 4B9DA 1KE5A 3G0FA 4HVSA 2OIDA 3ZTXA 4NT4A 3VRZA 2QOKA 5EQYA 4M13A 4JS8A 4L3PA 5JT2A 5M08A 5E90A 2X81A 4RRVA 3QA8A 2VWBA 2VWYA 4DFNA 3EN6A 4DHZA 1H07A 2QCSA 3VS1A 1CTPE 1IG1A 3ANRA 3NYNA 4IM3A 3ORIA 2OFVA 4L67A 5CXHA 5CU3A 5EM7A 3FY2A 4JL9A 4BYJA 1SMHA 4O91A 3ZBFA 2XNBA 2R3PA 3BE2A 4ZY6A 3F69A 3F7WA 4LMUA 2YIQA 3BV2A 3Q96A 4FT5A 4NM3A 5DIAA 2XANA 2C6OA 2JKQA 3GCVA 3V8SA 5IQBA 5FQDC 2CSNA 3HP5A 3VBTA 3COIA 3ZBXA 4BDAA 2XARA 4FK6A 3E7OA 2VTQA 5B0XA 2IN6A 2NRYA 4OLIA 3BYVA 4HYUA 5AMNA 1P4OA 1NY3A 3CD8A 4O4DA 3WIKA 4XV3A 4ZLZA 4F9YA 4BKYA 3EQDA 4QMUA 4AT5A 3PDTA 4I6QA 2OICA 2O63A 2JIIA 3GQLA 3GT8A 4V05A 3CCNA 3VN9A 3E7VA 5EI2A 3NWWA 4AZEA 5HBJA 4IACA 3A4PA 3GXLA 4QP8A 2YM7A 4ANNA 5CZHA 5IDPA 1O6YA 4FTAA 4I0RA 5AA8A 5CS6A 4ZLYA 3DJ5A 3C0HA 4CFNA 1FVRA 3II5A 1LEWA 4J95A 3M1SA 3R8ZA 3K5VA 2R0IA 4MBIA 3CXWA 5FRIA 4O0UA 3G6HA 5HTBA 3BGZA 5C4LA 2JITA 5BVWA 1YOMA 4BL1A 4E93A 5ETCA 3MY5A 3LW0A 3QD4A 5D12A 3V3VA 2QVSE 4KUJA 5FLFA 3DXPA 1I09A 3WZJA 3W0NA 2UZEA 1E1XA 3P5KA 4TZRA 4USDA 2QONA 3DKFA 1U54A 4R1YA 2OZAB 2XK7A 3GFEA 4BJJA 2JAMA 3GFWA 4NKSA 3UYTA 2VTIA 3I7CA 3OY3A 2W1GA 5DWRA 4NEUA 3RNYA 2R3MA 4ALWA 4RFZA 3R7IA 3R83A 3V5PA 2C5VA 3VNTA 2X8EA 3F3VA 2W17A 3HRFA 4FSQA 5D7VA 4DGNA 4EZ5A 2XM9A 1JSUA 5K5NA 4DN5A 3UOJA 1Q3WA 2EUFB 3MESA 4OTWA 4JJRA 5GNKA 4RQVA 1Q3DA 3HRBA 2IPXA 4HGEA 3QCYA 4G3EA 1BYGA 3NS9A 4O4CA 2Y4IB 4AA0A 4D1XA 4D2SA 2GPHA 2X9EA 4X6RA 3ZUTA 4QTEA 2JKOA 4ASDA 4TRLA 3OWKA 3PP1A 3PWYA 3Q6UA 2BRMA 4F64A 3VUHA 4A9YA 4FEUA 3ZSGA 3NAXA 1Q61A 2B4SB 5H8BA 2OJIA 4KIKB 4FV4A 2QOBA 4KRCA 5AV2A 4CZYB 3TNHA 4YU2A 2HWPA 4W4XA 1Y8YA 1OBGA 4X3FB 4ZSJA 3PJ3A 5CSPA 3DXNA 5HE2A 5JGBA 3DS6A 4BDBA 3POZA 4FKVA 5TF9A 1TZDA 3W1FA 4ASXA 3ALNA 4CKJA 2BR1A 3EN5A 3TIYA 3GU6A 2W4OA 2YIWA 4BGGA 5EW8A 3RALA 4UMTA 3T9TA 2H8HA 3CGOA 4WIHA 3DT1A 2BIKB 3W2SA 4ITIA 3QWJA 5AP7A 2CNQA 3MH3A 3NSZA 4B99A 4RFMA 1RW8A 1NVQA 5LCJA 2YM5A 4UZHA 3A62A 3L8SA 2XNNA 2OFUA 4YSJA 1OMWA 3N51A 3QLGA 2O3PA 2OU7A 5EI6A 3OP5A 3M42A 2UZUE 4LFIA 3BLAA 3WE4A 1WVYA 4I94A 4E5AX 3C7QA 2IVSA 4KIQA 3QQKA 1FGIA 4GS6A 4K33A 3W0OA 2WEVA 3OTUA 4U3ZA 1YDSE 3PPZA 3GU7A 2BZIB 4JAJA 3U4UA 3CPBA 3EYHA 3BLRA 4IM2A 4WNOA 4X3FC 4RQKA 3UJGA 3GCSA 4GRBA 3DBFA 3GNIB 2W7XA 4O7VA 2ONLA 4E4XA 2JGZA 4U7ZA 1WBTA 2RSVA 3QC9A 3NFFB 4C4HA 1HCKA 4FOCA 1Q4LA 3E5AA 3FL5A 4RWJA 5E8VA 4BI2A 4F0GA 4QQCA 4G2FA 4C7TA 3QAME 3OCGA 4DEEA 5BYZA 5AR2A 1KOBA 4GU9A 2HK5A 2O5KA 3C4CA 3FMNA 5TO8A 4QPSA 2PVRA 4PL4A 2OXYA 4UBAA 3UDZA 3UIXA 4CKIA 4LUEA 4L00A 2BAJA 4R7IA 1ST0A 4O81A 3TM0A 2BRGA 3EN4A 4J8MA 1URWA 3AGMA 1MQ4A 2FH9A 4KRDA 1FMOE 3R22A 3BBTB 5IUGA 2ETMA 4FRFA 3VUDA 5H2UA 2PU8A 4L7FA 4H3PA 3LM5A 4L45A 4AAAA 2OW3A 3PVUA 4FTKA 4NH1A 3AMAA 3KRRA 2JIUA 3NNUA 3OROA 5DGZA 3WILA 5E4HA 1B39A 4G9CA 2C3LA 4ZY5A 2BMCA 5KMMA 3PLAE 2CGVA 1GIIA 3QBNA 4CKRA 1XH8A 5HCXA 3RHXA 1YW2A 2X8IA 4A7CA 5LVMA 4YZNA 5HLWA 2Y7JA 4E73A 3LCTA 1LUFA 3KL8A 3HAMA 4QMSA 3H30A 1W7HA 4ENYA 3F3ZA 5AUXA 3BU5A 2OG8A 4JOAA 2VTJA 4OBOA 1XMMA 2I0YA 1ZMWA 4BC6A 4UXQA 2QQ7A 4GMYA 5KZ0A 3QXOA 1T45A 4LG4A 1YWRA 4U41A 5KMKA 5CVFA 2VTAA 2JKKA 4H39A 5CVHA 1BL7A 5B2KA 4DG0E 4F0FA 5HESA 4AXCA 3R9HA 3SC1A 3QZHA 4IFGA 1PW2A 4FV3A 5C03A 1XH5A 3UZTA 2GNJA 5IA4A 3NDMA 4QTAA 2H9VA 2H6DA 4TYGA 3UC4A 3QX4A 4CV8A 3W55A 4IWOA 4FSTA 4F7JA 2A4LA 2WFYA 5ACBC 3MYGA 4LMNA 4B7TA 5HZNA 4AZFA 2GQRA 2GQSA 1ZLTA 3WF8A 4BKZA 3BL7A 4MUQA 4WOVA 5IUHA 2VU3A 4QQTA 4RWKA 1ATPE 5E8ZA 4DLIA 2B52A 3VS5A 5JQ8A 2YM4A 5KO1A 2WPAA 1R1WA 3PXQA 4EH5A 4NM7A 3OTVA 5ITAA 2J4ZA 3S0OA 3KIOC 1Z9XA 4Y83A 2VV9A 4UEUA 4WD5A 4L53A 3PIYA 3L9NA 3LAUA 4G34A 4K9YA 2J2IB 2BCJA 3TKIA 5EM5A 1BLXA 4F63A 4IQ6A 3HL7A 3MS9A 4CG8A 4X3JA 2WHBA 3KFAA 4D5KA 1WCCA 4WBOA 5K0XA 1YXTA 1ZYJA 2BAKA 2F7EE 3LFSA 4O96A 4FC0A 2VWUA 4HZRA 2VWZA 4U42A 1GZNA 3C1XA 3UBDA 2ZDTA 4DYMA 3AT3A 5CAVA 3MY0A 3TKUA 4EH9A 3R1QA 2VTTA 3E64A 4IX6A 1KV1A 3P5JC 4EUTA 2HXLA 4J52A 2IVTA 4KWPA 4MXZA 4RWIA 3QRTA 3QQGA 1JLUE 2XJ0A 3D4QA 5CI6A 4JDKA 5EYCA 5HE0A 5IMXA 2XNPA 3FSFA 2PUIA 3QX2A 1FVTA 1BKXA 3FMKA 2H96A 2PVFA 3CJFA 3CTQA 4FKUA 4QMNA 4C4FA 2R9SA 4DTBA 3F5XA 2W1FA 4UWCA 4YBJA 5HBHA 3IGOA 5CEQA 1JKTA 3RPVA 4J53A 4CLIA 4JR3A 5IH5A 2ESMA 2R3QA 4C61A 2C69A 4IBMA 4DGMA 3F5UA 4U44A 3FYJX 3UVPA 3RWPA 4MH7A 4IZ5A 1H28A 3HRCA 3T8OA 1H0VA 3ODYX 4D2PA 3EFJA 3MIAA 4G9RA 3FZOA 5M44A 3E62A 2WMXA 3OMVA 4RVMA 2ZYBA 4FV9A 4NFMA 4CZUA 4BWKA 4M0ZA 5KHWA 4KNBA 5K9IA 3OWPA 3C5IA 4KD1A 4R3PA 4O7YA 3FPMA 4TL0A 1YKRA 5JN2A 3BBWA 3BU3A 5FDPA 3W2PA 2WOTA 4FV0A 3VONA 5LARA 4EC9A 2C30A 2C0TA 4UX9A 3QTXA 5HKMA 3UNKA 4JXFA 3COKA 2PY3A 4FL3A 4MXYA 4OUCA 2W1IA 4M69B 4JG8A 3W16A 4AGDA 4AOIA 5F9EA 4GYGA 4O7SA 3R7UA 1W98A 1BMKA 3U54A 4UMQA 4I41A 2F9GA 2HZ0A 2QURA 3DFCB 2EXMA 3OW4A 1DI9A 3UDSA 2CLQA 3HP2A 1GZ8A 4R3RA 1BI7A 4RX8A 5I3OA 3ZFYA 2DYLA 5J9LA 5AFVA 2WGJA 2BRBA 2EWAA 2GSFA 1ST4A 3CQUA 5CSHA 3AT2A 4UXLA 5DVRA 5CLPA 4RC4A 2R3RA 3W33A 3ZMMA 4MEDA 1REKA 3FXZA 4BRXA 2X4ZA 1OITA 2XNGA 4XUFA 1W2DA 4ZSGA 3TNIA 3FLQA 4DH3A 2B0QA 1NW1A 4ASZA 3A99A 2W5BA 3UMWA 1PMUA 2OI4X 2ITXA 4X2FA 4YZDA 2C6LA 1XWSA 4I22A 4ZJJA 3WBLA 3HECA 1PXKA 2QO2A 1GAGA 2YCFA 4U0IA 4XG7A 4QYEA 4I4FA 4DT9A 2HOGA 3IG7A 4FNWA 4YJTA 3SDJA 4FV5A 2IO6A 5EHYA 4NM5A 3QALE 3TMOA 4XMOA 1CKPA 4YC3A 4D2TA 4DBNA 5FUTA 5DHJA 5FM2A 4FEWA 2ZDUA 5AP6A 3MW1A 2HZ4A 3DLZA 4M67A 3LCOA 2I0VA 5B7VA 5I5ZA 4FSWA 5E8UA 3H9FA 4YTHA 3NVMB 5FXRA 1KUTA 4L6QA 1PXJA 2XIKA 3B2WA 4O0RA 3MB7A 4NFNA 4I24A 1RDQE 4LRMA 4O4EA 5F20A 5JRSA 4EQMA 3LPBA 2OXXA 4GL9A 4IZYA 1OBDA 4TN6A 4S32A 3HLLA 3P23A 3DK6A 3FI4A 4RJ3A 1TVOA 2C6KA 3OC1A 4UB7A 3QUDA 4YJUA 1WBNA 4FV8A 1OM1A 2X0OA 5LXMA 3FC2A 4UYAA 1AD5A 4EI4A 5DR2A 2J5FA 5EKNA 3KK8A 2I0EA 1YWVA 3AC1A 3TDVA 2QLUA 2BTRA 4FTTA 2VTPA 5BUEA 1ZYSA 3DU8A 4U5JA 4X3FA 3PJ8A 4PMMA 3K5UA 3E8DA 4KIKA 4Y85A 4O84A 5B2LA 2WTJA 3FKLA 3WF7A 2C6DA 1JQHA 3ZONA 2B9JA 2PZ5A 3BQCA 2OH4A 3ROYA 4HVGA 1WVWA 4I92A 2R4BA 4PP9A 4EK5A 1IRKA 4UYNA 5IEYA 4DH5A 4NJ3A 4IB5A 1XHAA 5HCYA 3GC8A 2JFLA 1DI8A 3JXWA 3Q53A 4IH8A 5DN3A 1OIUA 3TZ9A 2OK1A 2UW0A 5HO8A 4E6CA 4AN9A 5IA1A 5K0KA 1KE7A 1YHVA 4HGTA 3KQ7A 3LCSA 3AKJA 4IEBA 5TR6A 4V0GA 5HE3A 2CJMA 3D7ZA 5C8NA 1SNUA 5LCKA 4DG2E 3PZHA 3C4ZA 3MDYA 1J7UA 4QPMA 2SRCA 4ZMFA 1XH6A 2P33A 5EI8A 4ACCA 1U5RA 2C6TA 3ZRKA 4U8ZA 2X1NA 3AG9A 5DR6A 3Q6WA 4PRJA 3LFCA 2QOFA 3I60A 4BCNA 4MBLA 5AJQA 5KE0A 2Y0AA 5IQDA 5BYYA 3ATTA 4WG5A 4CQGA 4BJJB 2VD5A 4RIXB 5EDRA 3SGCA 1G5SA 2C4GA 1OIYA 3Q4CA 5KHXA 3QKKA 3QRIA 3C9WA 2IZRA 2IVVA 1H01A 4OT6A 2CHLA 3FSKA 4MXOA 4V01A 4CXAA 3O2MA 4C58A 4DBXA 4I5CA 4FT3A 4XV2A 3RI1A 4IX4A 2VTNA 2YA9A 3D5UA 3GI3A 4TXCA 3IONA 4WHZA 5AP0A 4PX6A 5BVKA 3RPSA 3W2RA 3W8QA 3IO7A 4JT3A 4AX8A 3U8WA 3QXPA 2I40A 4WG3A 4H58A 2GTNA 2PWLA 5C1QB 2OXDA 4EOLA 4AS0A 4C37A 4F9AA 2UZBA 2W9ZB 2WTKB 2QG7A 5DRDA 2WMTA 2YJRA 3HMIA 3OD6X 5AAEA 3KK9A 3HV4A 3MFTA 4PL3A 3NNWA 4FZ6A 4M97A 3NGAA 3CC6A 4W8DA 2EXCX 2C5NA 3AXWA 4FR4A 4RX9A 4OAUC 3ZEPA 3BHYA 5HVYA 4AUAA 5HD4A 3SXSA 4YHTA 5EHOA 2R3OA 1H1SA 4FG8A 4FUXA 3S1HA 5ANEA 3VUIA 5A6NA 2E9NA 3JY0A 4PTCA 1REJA 5C8MA 1UKHA 2HAKA 3UQFA 5GJGA 3MN3A 3AC2A 3NPCA 4HCTA 4R5SA 4BTFA 4D9UA 2WTWA 3ETAA 1QMZA 5L8KA 2DUVA 4U40A 3F88A 3Q5IA 3ZLSA 1KE9A 3Q9WA 4BTMA 4P7EA 2Z7QA 2P4IA 2WMRA 4RA5A 4DGGA 4I6LA 3UDBA 4JX3A 2ITZA 4R7HA 5CVGA 5HHWA 3ZO3A 4BGHA 3NIZA 4E8AA 2ITPA 2PZRA 2GTMA 4IAIA 4FKQA 3TZ8A 4D2RA 2QI8A 2OGVA 1XBBA 4M7IA 3LJ2A 4R3CA 1WVXA 4I5MA 4LV5A 5CAUA 4IAYA 5TT7A 4BBEA 3PPJA 4M68A 4EOJA 4C3PA 4Q9ZA 5HORA 2UW4A 2CN8A 2PE0A 2QOHA 2XIRA 2QKWB 2BFYA 3QGWA 4O1OA 2WU6A 5HLNA 3GUBA 1K9AA 1CKJA 4N4SA 3HV6A 3P78A 4L9IA 3ZDIA 2IG7A 5FWKK 3O96A 1ND4A 3KREA 2IEWA 4AWIA 4LV7A 2CDZA 4OW8A 4W4WA 3FHIA 5I0BA 2YJSA 3ELJA 2BRNA 3D0EA 3R28A 4FIHA 4DEDA 3AC4A 3RGFA 1ZWSA 4YC6A 1H8FA 4GT3A 2BFXA 4D9TA 1WZYA 4EWQA 3K54A 4QPAA 3PXFA 4A07A 5J7BA 4BI1A 1RJBA 2BAQA 2GCDA 4IX5A 3V5LA 4UMUA 3JYAA 4TT7A 2PZYA 3UO4A