5HUKA

The crystal structure of neuraminidase from a/northern pintail/washington/40964/2014 influenza virus
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
388
structure length
388
Chain Sequence
AEYRNWSKPQCQITGFAPFSKDNSIRLSAGGDIWVTREPYVSCSPGKCYQFALGQGTTLNNKHSNGTIHDRIPHRTLLMSELGVPFHLGTKQVCIAWSSSSCHDGKAWLHVCVTGDDRNATASFIYDGMLADSIGSWSQNILRTQESECVCINGTCTVVMTDGSASGRADTRILFIKEGKIVHISPLSGSAQHIEECSCYPRYPDVRCVCRDNWKGSNRPVIDINMADYSIDSSYVCSGLVGDTPRNDDSSSSSNCRDPNNERGNPGVKGWAFDNGNDVWMGRTISEDSRSGYETFRVTDGWTTANSKSQVNRQIIVDNNNWSGYSGIFSVEGKSCINRCFYVELIRGRPQETRVWWTSNSIVVFCGTSGTYGTGSWPDGANINFMPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Characterizations of Surface Proteins Hemagglutinin and Neuraminidase from Recent H5Nx Avian Influenza Viruses.
pubmed doi rcsb
molecule keywords Neuraminidase
molecule tags Viral protein
source organism Influenza a virus (a/northern pintail/washington/40964/2014(h5n2))
total genus 116
structure length 388
sequence length 388
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.18: Exo-alpha-sialidase.
pdb deposition date 2016-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00064 Neur Neuraminidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.10 Mainly Beta 6 Propeller Neuraminidase Neuraminidase 5hukA00
4K1KA 4YW5A 2HTWA 1N1TA 1INFA 4YW2A 4GZTA 1Z4XA 4DGRA 1DIMA 1W21A 1V0FA 4CPOA 2HT7A 2QWJA 4NCSA 2QWDA 2YDTA 2F27A 2C4LA 2YA7A 1MS4A 2F24A 1Z4VA 3SLIA 2YDPA 3K38A 5HUKA 1IVBA 4HIZA 3A71A 1INWA 4WA5A 3O9JA 1INVA 1IVCA 4MWXA 4CPNA 4XIOA 2AH2A 3INBA 1INYA 4FPEA 2HTVA 4K1JA 4YZ3A 1NCAN 4UF7A 3SANA 4FPFA 3GVJA 2F13A 1IVGA 4YZ1A 1MWEA 4MC7A 3SILA 2YA6A 3A72A 1USXA 3NN9A 1W1XA 1BJIA 4JF7A 4KS5A 4FPCA 3CL0A 1E8UA 4MWVA 4XE9A 1V2IA 4XIKA 3H71A 1MS0A 4KS1A 4XYXA 4M4VA 2QWFA 7NN9A 4X6KA 2QWKA 5HUGA 4X47A 1XOGA 3TI3A 3B69A 3BEQA 3CYEA 1E8VA 4Q6KA 3GVKA 3JU4A 4XILA 4NN9A 4XJQA 4WEGA 2SLIA 3CKZA 2AEPA 2VVZA 4M3MA 4MJUA 2BATA 2QWGA 4GZQA 4MWLA 3K3AA 2AEQA 1S0JA 2W20A 4XJ9A 4KS4A 4QN6A 3K36A 4MWYA 1IVEA 2F0ZA 4GZOA 4MWWA 3OPZA 2HTYA 2YA5A 1INXA 2AGSA 4SLIA 2HT5A 3H6JA 4HZYA 2BF6A 1V3CA 1NSCA 1A14N 4WEFA 3ALWA 2F11A 5NN9A 1N1VA 4K1HA 4NC5A 1MS9A 2XZJA 1NMAN 1Z4ZA 4FJ6A 2QWCA 2XZKA 2SILA 5HUMA 5HUNA 1NCCN 1V3DA 2F25A 2VK6A 4HZXA 2QWEA 4GEZA 2VW2A 4QNPA 4BBWA 4XOGA 2JKBA 4XMAA 2HU0A 1EUTA 1MZ6A 1NNAA 2F29A 1N1SA 4YZ2A 4D8SA 4MWJA 4MWUA 1VCUA 1V3BA 4K1IA 1SO7A 2VWDA 4GZPA 2RKCA 1KITA 1N1YA 4YW1A 1USRA 4M4UA 4WA3A 4GB1A 4FOYA 1WCQA 3TI5A 2VW1A 4FP2A 1F8CA 2QWIA 4XJWA 4H53A 2ZB5A 4GZSA 2BERA 2YA4A 3CL2A 3W09A 4B7MA 3K39A 5HX0A 1IVFA 1W8OA 4KS2A 4GDIA 5F9TA 2HU4A 2X9MA 1MS1A 1W8NA 4FPGA 4GDJA 4YZ5A 3GVLA 4QN7A 4MJVA 2VK5A 3H73A 4J9TA 2F26A 4B7RA 4CPMA 1V0EA 1NN2A 2CMLA 2QWHA 4MWQA 1A4GA 1SNTA 4X49A 4XJZA 1MS8A 1B9SA 1B9TA 4MX0A 4XHXA 4FOQA 2QWBA 1INGA 1V3EA 4GZXA 1Z50A 3ALXA 4FPJA 3B7EA 1WCSA 1EURA 1MZ5A 4KS3A 4FPKA 4FP3A 4HZZA 4XJUA 4FOWA 1MR5A 4HZVA 3TICA 4K3YA 2W5OA 2VW0A 2HT8A 1EUUA 3O9KA 1W20A 4YZ4A 4CPZA 1B9VA 2VSMA 4FPOB 2XZIA 2VK7A 1Z4YA 1XOEA 1NNBA 4H52A 2HTQA 1IVDA 2F28A 4FPHA 4HZWA 2F10A 1E8TA 2HTRA 2BZDA 2YA8A 1NMBN 5M1ZA 4FOVA 2W38A 4XJAA 5B2CA 1F8BA 3NSSA 3T1EA 4X4AA 4FZHA 3SALA 4MZEA 2FHRA 1DILA 1F8EA 1W0OA 4YW3A 4FQ4A 3D11A 2C4AA 4CPYA 2HTUA 4B7QA 3TIBA 1L7FA 1NSBA 2XCYA 4GJTA 4WA4A 1MS3A 1NNCA 5B2DA 1A4QA 1Z4WA 3TI6A 1NMCA 3H72A 2SIMA 3PJQA 4B7NA 1SLLA 4XJRA 4CPLA 4FPLA 3K37A 4XHBA 1EUSA 3TIAA 2W5NA 2F12A 4MZAA 5JYYA 1L7GA 1SLIA 1VCJA 4M4NA 1W0PA 1S0IA 4GZWA 1NCBN 1NSDA 1MS5A 4XMIA 3TI8A 4QN3A 4QN4A 1V0ZA 2A75A 4FPYA 3TI4A 1F8DA 4FVKA 4QN5A 4I00A 3D12A 4MWRA 2ZB6A 4XJ8A 1NCDN 4YW4A 2QWAA 2VSKA 1L7HA 1INHA 6NN9A 4B7JA 2B8HA
chains in the Genus database with same CATH superfamily
4K1KA 4DG6A 4YW5A 2HTWA 1N1TA 4GNAA 1INFA 4YW2A 4GZTA 1Z4XA 4DGRA 3SRGA 3DR2A 1DIMA 1W21A 5FWWA 1V0FA 5FZJA 4CPOA 1K32A 2HT7A 2QWJA 4NCSA 2QWDA 2YDTA 2F27A 2C4LA 4Q1UA 3O4PA 2YA7A 5D9CA 1MS4A 2F24A 3FW0A 1Z4VA 2IARA 3SLIA 2YDPA 3K38A 3SOBB 5HUKA 1IVBA 4HIZA 3A71A 1INWA 4WA5A 3O9JA 1INVA 4IN4A 1IVCA 4ZY3A 4MWXA 4CPNA 4XIOA 5FNUA 2AH2A 3INBA 2HQSA 1INYA 4FPEA 2HTVA 4K1JA 4YZ3A 1NCAN 2W8BB 4GNCA 4UF7A 3SANA 4FPFA 3GVJA 3KGGA 2F13A 3AMRA 1IVGA 3IAXA 3SREA 4YZ1A 1MWEA 4MC7A 3SILA 3V65B 2YA6A 3A72A 1USXA 3NN9A 1RWLA 4A0PA 1W1XA 1BJIA 4JF7A 5H47A 4KS5A 1C5KA 4C1YA 4D52A 4FPCA 4L7CA 3CL0A 1E8UA 4MWVA 3DASA 4XE9A 4AGTA 3II7A 1V2IA 4XIKA 3H71A 1MS0A 4KS1A 4XYXA 3WWAA 3VNGA 3G4EA 4M4VA 2QWFA 7NN9A 4X6KA 2QWKA 5CGJA 5HUGA 4X47A 1XOGA 3TI3A 3B69A 3BEQA 3CYEA 5FNQA 1E8VA 4Q6KA 3GVKA 1E1AA 3JU4A 3Q6TA 4XILA 4NN9A 4XJQA 4IMBA 4WEGA 2SLIA 4GN8A 3LI3A 3CKZA 2AEPA 2DSOA 4D52C 2VAQA 2VVZA 2V91A 4G3NA 4M3MA 1WP5A 4MJUA 3FVZA 2IAVA 2BATA 4ZLRA 2QWGA 4GZQA 4MWLA 2POOA 3K3AA 3S8ZA 2AEQA 1S0JA 2ZZKA 2W20A 4XJ9A 4KS4A 4QN6A 3S8VA 3K36A 4MWYA 1IVEA 2F0ZA 5EO7A 3AMSA 3NO0A 3OPZA 4GZOA 2HTYA 4MWWA 2YA5A 2IAWA 1X2RA 5D9DA 1INXA 2AGSA 3Q6KA 4SLIA 2HT5A 4IYGA 3H6JA 3L6VA 2IAQA 4HZYA 2BF6A 2WOZA 1V3CA 1NSCA 1A14N 4WEFA 3ALWA 2F11A 5NN9A 1N1VA 4AHAA 4D4UA 4K1HA 4NC5A 1MS9A 1OFZA 3WN7A 2XZJA 5GX4A 1NMAN 1Z4ZA 4FJ6A 2QWCA 1ZGKA 2XZKA 2SILA 4ASCA 5HUMA 5HUNA 1NCCN 1V3DA 2F25A 2VK6A 4O5TA 4HZXA 2QWEA 4GEZA 2VW2A 4QNPA 1QBIA 4BBWA 2GVVA 4XOGA 2JKBA 4XMAA 2HU0A 5GTQA 1EUTA 4IFLX 1MZ6A 1NNAA 4CH9A 2F29A 2IAXA 4R40A 1N1SA 2GHSA 3S94A 4YZ2A 5FNRA 4D8SA 4MWJA 4MWUA 1VCUA 1V3BA 4K1IA 1SO7A 4ZGCA 3V1SA 1ZI0A 2VWDA 4GZPA 2RKCA 4HHQA 1KITA 1N1YA 4CHBA 4YW1A 1USRA 4M4UA 4WA3A 1CQ1A 4FOYA 4GB1A 2DG0A 3I1CA 1WCQA 3TI5A 2VW1A 4FP2A 1F8CA 2QWIA 4XJWA 4H53A 2W8BA 2ZB5A 3SOVA 1IUBA 5EO8A 2IVZA 5GX2A 4GZSA 2GVUA 2BERA 1C9UA 2YA4A 3CL2A 4IFNX 3W09A 4HHOA 3UC1A 4B7MA 2P4OA 3K39A 2G8SA 2GVXA 1U6DX 5HX0A 2FP9A 1IVFA 1W8OA 2IASA 4JMLA 4KS2A 4GDIA 2H2NA 5F9TA 2HU4A 1CRZA 3Q6PA 2X9MA 1MS1A 1W8NA 4FPGA 2IATA 4GDJA 2DG1A 4YZ5A 3GVLA 2VPJA 1N6EA 2FPBA 2ZW9A 4QN7A 4MJVA 2VK5A 3H73A 4J9TA 2F26A 4B7RA 4CPMA 1V0EA 3E5ZA 1NN2A 2CMLA 2QWHA 4O5SA 4MWQA 1A4GA 1SNTA 4X49A 4XJZA 3ADEA 1MS8A 1B9SA 1B9TA 1H6LA 4MX0A 4XHXA 4FOQA 2QWBA 1INGA 1V3EA 2ZWAA 4GZXA 1Z50A 3ALXA 4FPJA 3U0SA 3B7EA 3WDZA 1WCSA 3KYAA 1EURA 4L7BA 1MZ5A 4KS3A 3HLIA 4FPKA 4FP3A 4HZZA 4XJUA 4FOWA 1MR5A 4HZVA 3TICA 3ZGDA 1QLGA 4K3YA 2W5OA 2VW0A 2HT8A 1EUUA 3O9KA 1W20A 4UOUA 4YZ4A 5FNSA 2FP8A 4CPZA 3P5BL 5FNTA 1B9VA 3TC9A 2VSMA 4GN7A 5D9BA 4FPOB 2XZIA 2VK7A 2XN4A 1Z4YA 1CRUA 1NNBA 1XOEA 4H52A 1PJXA 3HRPA 2HTQA 1IVDA 2F28A 4FPHA 5FZNA 1V04A 4HZWA 2F10A 1N6DA 1E8TA 2Z32A 4AGIA 2HTRA 2IAUA 2BZDA 2YA8A 1NMBN 5M1ZA 4FOVA 2W38A 4XJAA 5B2CA 1F8BA 3NSSA 3T1EA 3V64C 4X4AA 4FZHA 5GX1A 4C1YB 3SALA 4D52B 4IQKA 4MZEA 2OJHA 2FHRA 3LI4A 1DILA 3A9HA 1F8EA 1W0OA 3S2KA 4YW3A 4FQ4A 3D11A 2C4AA 1RWIA 4CPYA 3BYCA 2HTUA 3SOQA 4B7QA 3TIBA 1L7FA 1NSBA 2XCYA 3VNHA 4GJTA 4WA4A 1S1DA 2H2UA 1MS3A 1NNCA 5B2DA 1A4QA 1IUCA 2FPCA 1Z4WA 4AH4A 5EX7A 4PWZA 1IJQA 3A9GA 3TI6A 1NMCA 3H72A 2SIMA 3PJQA 4XMBA 4IFJA 4B7NA 1SLLA 4XJRA 4CPLA 4FPLA 3K37A 2GVWA 4XHBA 4GN9A 4L7DA 1EUSA 3HLHA 1NPEA 3TIAA 2W5NA 2F12A 4MZAA 5JYYA 1L7GA 1SLIA 3WW9A 1VCJA 1N7DA 4M4NA 5GX5A 3ZGCA 1N6FA 1W0PA 1S0IA 4YY8A 4GZWA 1NCBN 1NSDA 1MS5A 4XMIA 1SUUA 4HW6A 3TI8A 4CSDA 1CVMA 2FLUX 4QN3A 1POOA 4QN4A 1V0ZA 5F72C 2A75A 4FPYA 4N1BA 1Q7FA 3TI4A 3G4HA 1F8DA 4FVKA 2ISMA 1S18A 4QN5A 4I00A 3D12A 1X2JA 4MWRA 2ZB6A 4XJ8A 1NCDN 2IAPA 2QE8A 2IAOA 5GX3A 4YW4A 2QWAA 2VSKA 1L7HA 1INHA 2DYHA 6NN9A 3LI5A 4GNBA 4B7JA 2B8HA
chains in the Genus database with same CATH topology
4K1KA 4YW5A 2HTWA 1N1TA 1INFA 4YW2A 4GZTA 1Z4XA 4DGRA 1DIMA 1W21A 1V0FA 4CPOA 2HT7A 2QWJA 4NCSA 2QWDA 2YDTA 2F27A 2C4LA 2YA7A 1MS4A 2F24A 1Z4VA 3SLIA 2YDPA 3K38A 5HUKA 1IVBA 4HIZA 3A71A 1INWA 4WA5A 3O9JA 1INVA 1IVCA 4MWXA 4CPNA 4XIOA 2AH2A 3INBA 1INYA 4FPEA 2HTVA 4K1JA 4YZ3A 1NCAN 4UF7A 3SANA 4FPFA 3GVJA 2F13A 1IVGA 4YZ1A 1MWEA 4MC7A 3SILA 2YA6A 3A72A 1USXA 3NN9A 1W1XA 1BJIA 4JF7A 4KS5A 4FPCA 3CL0A 1E8UA 4MWVA 4XE9A 1V2IA 4XIKA 3H71A 1MS0A 4KS1A 4XYXA 4M4VA 2QWFA 7NN9A 4X6KA 2QWKA 5HUGA 4X47A 1XOGA 3TI3A 3B69A 3BEQA 3CYEA 1E8VA 4Q6KA 3GVKA 3JU4A 4XILA 4NN9A 4XJQA 4WEGA 2SLIA 3CKZA 2AEPA 2VVZA 4M3MA 4MJUA 2BATA 2QWGA 4GZQA 4MWLA 3K3AA 2AEQA 1S0JA 2W20A 4XJ9A 4KS4A 4QN6A 3K36A 4MWYA 1IVEA 2F0ZA 4GZOA 4MWWA 3OPZA 2HTYA 2YA5A 1INXA 2AGSA 4SLIA 2HT5A 3H6JA 4HZYA 2BF6A 1V3CA 1NSCA 1A14N 4WEFA 3ALWA 2F11A 5NN9A 1N1VA 4K1HA 4NC5A 1MS9A 2XZJA 1NMAN 1Z4ZA 4FJ6A 2QWCA 2XZKA 2SILA 5HUMA 5HUNA 1NCCN 1V3DA 2F25A 2VK6A 4HZXA 2QWEA 4GEZA 2VW2A 4QNPA 4BBWA 4XOGA 2JKBA 4XMAA 2HU0A 1EUTA 1MZ6A 1NNAA 2F29A 1N1SA 4YZ2A 4D8SA 4MWJA 4MWUA 1VCUA 1V3BA 4K1IA 1SO7A 2VWDA 4GZPA 2RKCA 1KITA 1N1YA 4YW1A 1USRA 4M4UA 4WA3A 4GB1A 4FOYA 1WCQA 3TI5A 2VW1A 4FP2A 1F8CA 2QWIA 4XJWA 4H53A 2ZB5A 4GZSA 2BERA 2YA4A 3CL2A 3W09A 4B7MA 3K39A 5HX0A 1IVFA 1W8OA 4KS2A 4GDIA 2H2NA 5F9TA 2HU4A 2X9MA 1MS1A 1W8NA 4FPGA 4GDJA 4YZ5A 3GVLA 4QN7A 4MJVA 2VK5A 3H73A 4J9TA 2F26A 4B7RA 4CPMA 1V0EA 1NN2A 2CMLA 2QWHA 4MWQA 1A4GA 1SNTA 4X49A 4XJZA 1MS8A 1B9SA 1B9TA 4MX0A 4XHXA 4FOQA 2QWBA 1INGA 1V3EA 4GZXA 1Z50A 3ALXA 4FPJA 3B7EA 1WCSA 1EURA 1MZ5A 4KS3A 4FPKA 4FP3A 4HZZA 4XJUA 4FOWA 1MR5A 4HZVA 3TICA 4K3YA 2W5OA 2VW0A 2HT8A 1EUUA 3O9KA 1W20A 4YZ4A 4CPZA 1B9VA 2VSMA 4FPOB 2XZIA 2VK7A 1Z4YA 1XOEA 1NNBA 4H52A 2HTQA 1IVDA 2F28A 4FPHA 4HZWA 2F10A 1E8TA 2HTRA 2BZDA 2YA8A 1NMBN 5M1ZA 4FOVA 2W38A 4XJAA 5B2CA 1F8BA 3NSSA 3T1EA 4X4AA 4FZHA 3SALA 4MZEA 2FHRA 1DILA 1F8EA 1W0OA 4YW3A 4FQ4A 3D11A 2C4AA 4CPYA 2HTUA 4B7QA 3TIBA 1L7FA 1NSBA 2XCYA 4GJTA 4WA4A 1S1DA 2H2UA 1MS3A 1NNCA 5B2DA 1A4QA 1Z4WA 3TI6A 1NMCA 3H72A 2SIMA 3PJQA 4B7NA 1SLLA 4XJRA 4CPLA 4FPLA 3K37A 4XHBA 1EUSA 3TIAA 2W5NA 2F12A 4MZAA 5JYYA 1L7GA 1SLIA 1VCJA 4M4NA 1W0PA 1S0IA 4GZWA 1NCBN 1NSDA 1MS5A 4XMIA 3TI8A 4QN3A 4QN4A 1V0ZA 2A75A 4FPYA 3TI4A 1F8DA 4FVKA 4QN5A 1S18A 4I00A 3D12A 4MWRA 2ZB6A 4XJ8A 1NCDN 4YW4A 2QWAA 2VSKA 1L7HA 1INHA 6NN9A 4B7JA 2B8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K1K A;  4YW5 A;  2HTW A;  1N1T A;  1INF A;  4YW2 A;  4GZT A;  1Z4X A;  4DGR A;  1DIM A;  1W21 A;  1V0F A;  4CPO A;  2HT7 A;  2QWJ A;  4NCS A;  2QWD A;  2YDT A;  2F27 A;  2C4L A;  2YA7 A;  1MS4 A;  2F24 A;  1Z4V A;  3SLI A;  2YDP A;  3K38 A;  5HUK A;  1IVB A;  4HIZ A;  3A71 A;  1INW A;  4WA5 A;  3O9J A;  1INV A;  1IVC A;  4MWX A;  4CPN A;  4XIO A;  2AH2 A;  3INB A;  1INY A;  4FPE A;  2HTV A;  4K1J A;  4YZ3 A;  1NCA N;  4UF7 A;  3SAN A;  4FPF A;  3GVJ A;  2F13 A;  1IVG A;  4YZ1 A;  1MWE A;  4MC7 A;  3SIL A;  2YA6 A;  3A72 A;  1USX A;  3NN9 A;  1W1X A;  1BJI A;  4JF7 A;  4KS5 A;  4FPC A;  3CL0 A;  1E8U A;  4MWV A;  4XE9 A;  1V2I A;  4XIK A;  3H71 A;  1MS0 A;  4KS1 A;  4XYX A;  4M4V A;  2QWF A;  7NN9 A;  4X6K A;  2QWK A;  5HUG A;  4X47 A;  1XOG A;  3TI3 A;  3B69 A;  3BEQ A;  3CYE A;  1E8V A;  4Q6K A;  3GVK A;  3JU4 A;  4XIL A;  4NN9 A;  4XJQ A;  4WEG A;  2SLI A;  3CKZ A;  2AEP A;  2VVZ A;  4M3M A;  4MJU A;  2BAT A;  2QWG A;  4GZQ A;  4MWL A;  3K3A A;  2AEQ A;  1S0J A;  2W20 A;  4XJ9 A;  4KS4 A;  4QN6 A;  3K36 A;  4MWY A;  1IVE A;  2F0Z A;  4GZO A;  4MWW A;  3OPZ A;  2HTY A;  2YA5 A;  1INX A;  2AGS A;  4SLI A;  2HT5 A;  3H6J A;  4HZY A;  2BF6 A;  1V3C A;  1NSC A;  1A14 N;  4WEF A;  3ALW A;  2F11 A;  5NN9 A;  1N1V A;  4K1H A;  4NC5 A;  1MS9 A;  2XZJ A;  1NMA N;  1Z4Z A;  4FJ6 A;  2QWC A;  2XZK A;  2SIL A;  5HUM A;  5HUN A;  1NCC N;  1V3D A;  2F25 A;  2VK6 A;  4HZX A;  2QWE A;  4GEZ A;  2VW2 A;  4QNP A;  4BBW A;  4XOG A;  2JKB A;  4XMA A;  2HU0 A;  1EUT A;  1MZ6 A;  1NNA A;  2F29 A;  1N1S A;  4YZ2 A;  4D8S A;  4MWJ A;  4MWU A;  1VCU A;  1V3B A;  4K1I A;  1SO7 A;  2VWD A;  4GZP A;  2RKC A;  1KIT A;  1N1Y A;  4YW1 A;  1USR A;  4M4U A;  4WA3 A;  4GB1 A;  4FOY A;  1WCQ A;  3TI5 A;  2VW1 A;  4FP2 A;  1F8C A;  2QWI A;  4XJW A;  4H53 A;  2ZB5 A;  4GZS A;  2BER A;  2YA4 A;  3CL2 A;  3W09 A;  4B7M A;  3K39 A;  5HX0 A;  1IVF A;  1W8O A;  4KS2 A;  4GDI A;  5F9T A;  2HU4 A;  2X9M A;  1MS1 A;  1W8N A;  4FPG A;  4GDJ A;  4YZ5 A;  3GVL A;  4QN7 A;  4MJV A;  2VK5 A;  3H73 A;  4J9T A;  2F26 A;  4B7R A;  4CPM A;  1V0E A;  1NN2 A;  2CML A;  2QWH A;  4MWQ A;  1A4G A;  1SNT A;  4X49 A;  4XJZ A;  1MS8 A;  1B9S A;  1B9T A;  4MX0 A;  4XHX A;  4FOQ A;  2QWB A;  1ING A;  1V3E A;  4GZX A;  1Z50 A;  3ALX A;  4FPJ A;  3B7E A;  1WCS A;  1EUR A;  1MZ5 A;  4KS3 A;  4FPK A;  4FP3 A;  4HZZ A;  4XJU A;  4FOW A;  1MR5 A;  4HZV A;  3TIC A;  4K3Y A;  2W5O A;  2VW0 A;  2HT8 A;  1EUU A;  3O9K A;  1W20 A;  4YZ4 A;  4CPZ A;  1B9V A;  2VSM A;  4FPO B;  2XZI A;  2VK7 A;  1Z4Y A;  1XOE A;  1NNB A;  4H52 A;  2HTQ A;  1IVD A;  2F28 A;  4FPH A;  4HZW A;  2F10 A;  1E8T A;  2HTR A;  2BZD A;  2YA8 A;  1NMB N;  5M1Z A;  4FOV A;  2W38 A;  4XJA A;  5B2C A;  1F8B A;  3NSS A;  3T1E A;  4X4A A;  4FZH A;  3SAL A;  4MZE A;  2FHR A;  1DIL A;  1F8E A;  1W0O A;  4YW3 A;  4FQ4 A;  3D11 A;  2C4A A;  4CPY A;  2HTU A;  4B7Q A;  3TIB A;  1L7F A;  1NSB A;  2XCY A;  4GJT A;  4WA4 A;  1MS3 A;  1NNC A;  5B2D A;  1A4Q A;  1Z4W A;  3TI6 A;  1NMC A;  3H72 A;  2SIM A;  3PJQ A;  4B7N A;  1SLL A;  4XJR A;  4CPL A;  4FPL A;  3K37 A;  4XHB A;  1EUS A;  3TIA A;  2W5N A;  2F12 A;  4MZA A;  5JYY A;  1L7G A;  1SLI A;  1VCJ A;  4M4N A;  1W0P A;  1S0I A;  4GZW A;  1NCB N;  1NSD A;  1MS5 A;  4XMI A;  3TI8 A;  4QN3 A;  4QN4 A;  1V0Z A;  2A75 A;  4FPY A;  3TI4 A;  1F8D A;  4FVK A;  4QN5 A;  4I00 A;  3D12 A;  4MWR A;  2ZB6 A;  4XJ8 A;  1NCD N;  4YW4 A;  2QWA A;  2VSK A;  1L7H A;  1INH A;  6NN9 A;  4B7J A;  2B8H A; 
#chains in the Genus database with same CATH topology
 4K1K A;  4DG6 A;  4YW5 A;  2HTW A;  1N1T A;  4GNA A;  1INF A;  4YW2 A;  4GZT A;  1Z4X A;  4DGR A;  3SRG A;  3DR2 A;  1DIM A;  1W21 A;  5FWW A;  1V0F A;  5FZJ A;  4CPO A;  1K32 A;  2HT7 A;  2QWJ A;  4NCS A;  2QWD A;  2YDT A;  2F27 A;  2C4L A;  4Q1U A;  3O4P A;  2YA7 A;  5D9C A;  1MS4 A;  2F24 A;  3FW0 A;  1Z4V A;  2IAR A;  3SLI A;  2YDP A;  3K38 A;  3SOB B;  5HUK A;  1IVB A;  4HIZ A;  3A71 A;  1INW A;  4WA5 A;  3O9J A;  1INV A;  4IN4 A;  1IVC A;  4ZY3 A;  4MWX A;  4CPN A;  4XIO A;  5FNU A;  2AH2 A;  3INB A;  2HQS A;  1INY A;  4FPE A;  2HTV A;  4K1J A;  4YZ3 A;  1NCA N;  2W8B B;  4GNC A;  4UF7 A;  3SAN A;  4FPF A;  3GVJ A;  3KGG A;  2F13 A;  3AMR A;  1IVG A;  3IAX A;  3SRE A;  4YZ1 A;  1MWE A;  4MC7 A;  3SIL A;  3V65 B;  2YA6 A;  3A72 A;  1USX A;  3NN9 A;  1RWL A;  4A0P A;  1W1X A;  1BJI A;  4JF7 A;  5H47 A;  4KS5 A;  1C5K A;  4C1Y A;  4D52 A;  4FPC A;  4L7C A;  3CL0 A;  1E8U A;  4MWV A;  3DAS A;  4XE9 A;  4AGT A;  3II7 A;  1V2I A;  4XIK A;  3H71 A;  1MS0 A;  4KS1 A;  4XYX A;  3WWA A;  3VNG A;  3G4E A;  4M4V A;  2QWF A;  7NN9 A;  4X6K A;  2QWK A;  5CGJ A;  5HUG A;  4X47 A;  1XOG A;  3TI3 A;  3B69 A;  3BEQ A;  3CYE A;  5FNQ A;  1E8V A;  4Q6K A;  3GVK A;  1E1A A;  3JU4 A;  3Q6T A;  4XIL A;  4NN9 A;  4XJQ A;  4IMB A;  4WEG A;  2SLI A;  4GN8 A;  3LI3 A;  3CKZ A;  2AEP A;  2DSO A;  4D52 C;  2VAQ A;  2VVZ A;  2V91 A;  4G3N A;  4M3M A;  1WP5 A;  4MJU A;  3FVZ A;  2IAV A;  2BAT A;  4ZLR A;  2QWG A;  4GZQ A;  4MWL A;  2POO A;  3K3A A;  3S8Z A;  2AEQ A;  1S0J A;  2ZZK A;  2W20 A;  4XJ9 A;  4KS4 A;  4QN6 A;  3S8V A;  3K36 A;  4MWY A;  1IVE A;  2F0Z A;  5EO7 A;  3AMS A;  3NO0 A;  3OPZ A;  4GZO A;  2HTY A;  4MWW A;  2YA5 A;  2IAW A;  1X2R A;  5D9D A;  1INX A;  2AGS A;  3Q6K A;  4SLI A;  2HT5 A;  4IYG A;  3H6J A;  3L6V A;  2IAQ A;  4HZY A;  2BF6 A;  2WOZ A;  1V3C A;  1NSC A;  1A14 N;  4WEF A;  3ALW A;  2F11 A;  5NN9 A;  1N1V A;  4AHA A;  4D4U A;  4K1H A;  4NC5 A;  1MS9 A;  1OFZ A;  3WN7 A;  2XZJ A;  5GX4 A;  1NMA N;  1Z4Z A;  4FJ6 A;  2QWC A;  1ZGK A;  2XZK A;  2SIL A;  4ASC A;  5HUM A;  5HUN A;  1NCC N;  1V3D A;  2F25 A;  2VK6 A;  4O5T A;  4HZX A;  2QWE A;  4GEZ A;  2VW2 A;  4QNP A;  1QBI A;  4BBW A;  2GVV A;  4XOG A;  2JKB A;  4XMA A;  2HU0 A;  5GTQ A;  1EUT A;  4IFL X;  1MZ6 A;  1NNA A;  4CH9 A;  2F29 A;  2IAX A;  4R40 A;  1N1S A;  2GHS A;  3S94 A;  4YZ2 A;  5FNR A;  4D8S A;  4MWJ A;  4MWU A;  1VCU A;  1V3B A;  4K1I A;  1SO7 A;  4ZGC A;  3V1S A;  1ZI0 A;  2VWD A;  4GZP A;  2RKC A;  4HHQ A;  1KIT A;  1N1Y A;  4CHB A;  4YW1 A;  1USR A;  4M4U A;  4WA3 A;  1CQ1 A;  4FOY A;  4GB1 A;  2DG0 A;  3I1C A;  1WCQ A;  3TI5 A;  2VW1 A;  4FP2 A;  1F8C A;  2QWI A;  4XJW A;  4H53 A;  2W8B A;  2ZB5 A;  3SOV A;  1IUB A;  5EO8 A;  2IVZ A;  5GX2 A;  4GZS A;  2GVU A;  2BER A;  1C9U A;  2YA4 A;  3CL2 A;  4IFN X;  3W09 A;  4HHO A;  3UC1 A;  4B7M A;  2P4O A;  3K39 A;  2G8S A;  2GVX A;  1U6D X;  5HX0 A;  2FP9 A;  1IVF A;  1W8O A;  2IAS A;  4JML A;  4KS2 A;  4GDI A;  2H2N A;  5F9T A;  2HU4 A;  1CRZ A;  3Q6P A;  2X9M A;  1MS1 A;  1W8N A;  4FPG A;  2IAT A;  4GDJ A;  2DG1 A;  4YZ5 A;  3GVL A;  2VPJ A;  1N6E A;  2FPB A;  2ZW9 A;  4QN7 A;  4MJV A;  2VK5 A;  3H73 A;  4J9T A;  2F26 A;  4B7R A;  4CPM A;  1V0E A;  3E5Z A;  1NN2 A;  2CML A;  2QWH A;  4O5S A;  4MWQ A;  1A4G A;  1SNT A;  4X49 A;  4XJZ A;  3ADE A;  1MS8 A;  1B9S A;  1B9T A;  1H6L A;  4MX0 A;  4XHX A;  4FOQ A;  2QWB A;  1ING A;  1V3E A;  2ZWA A;  4GZX A;  1Z50 A;  3ALX A;  4FPJ A;  3U0S A;  3B7E A;  3WDZ A;  1WCS A;  3KYA A;  1EUR A;  4L7B A;  1MZ5 A;  4KS3 A;  3HLI A;  4FPK A;  4FP3 A;  4HZZ A;  4XJU A;  4FOW A;  1MR5 A;  4HZV A;  3TIC A;  3ZGD A;  1QLG A;  4K3Y A;  2W5O A;  2VW0 A;  2HT8 A;  1EUU A;  3O9K A;  1W20 A;  4UOU A;  4YZ4 A;  5FNS A;  2FP8 A;  4CPZ A;  3P5B L;  5FNT A;  1B9V A;  3TC9 A;  2VSM A;  4GN7 A;  5D9B A;  4FPO B;  2XZI A;  2VK7 A;  2XN4 A;  1Z4Y A;  1CRU A;  1NNB A;  1XOE A;  4H52 A;  1PJX A;  3HRP A;  2HTQ A;  1IVD A;  2F28 A;  4FPH A;  5FZN A;  1V04 A;  4HZW A;  2F10 A;  1N6D A;  1E8T A;  2Z32 A;  4AGI A;  2HTR A;  2IAU A;  2BZD A;  2YA8 A;  1NMB N;  5M1Z A;  4FOV A;  2W38 A;  4XJA A;  5B2C A;  1F8B A;  3NSS A;  3T1E A;  3V64 C;  4X4A A;  4FZH A;  5GX1 A;  4C1Y B;  3SAL A;  4D52 B;  4IQK A;  4MZE A;  2OJH A;  2FHR A;  3LI4 A;  1DIL A;  3A9H A;  1F8E A;  1W0O A;  3S2K A;  4YW3 A;  4FQ4 A;  3D11 A;  2C4A A;  1RWI A;  4CPY A;  3BYC A;  2HTU A;  3SOQ A;  4B7Q A;  3TIB A;  1L7F A;  1NSB A;  2XCY A;  3VNH A;  4GJT A;  4WA4 A;  1S1D A;  2H2U A;  1MS3 A;  1NNC A;  5B2D A;  1A4Q A;  1IUC A;  2FPC A;  1Z4W A;  4AH4 A;  5EX7 A;  4PWZ A;  1IJQ A;  3A9G A;  3TI6 A;  1NMC A;  3H72 A;  2SIM A;  3PJQ A;  4XMB A;  4IFJ A;  4B7N A;  1SLL A;  4XJR A;  4CPL A;  4FPL A;  3K37 A;  2GVW A;  4XHB A;  4GN9 A;  4L7D A;  1EUS A;  3HLH A;  1NPE A;  3TIA A;  2W5N A;  2F12 A;  4MZA A;  5JYY A;  1L7G A;  1SLI A;  3WW9 A;  1VCJ A;  1N7D A;  4M4N A;  5GX5 A;  3ZGC A;  1N6F A;  1W0P A;  1S0I A;  4YY8 A;  4GZW A;  1NCB N;  1NSD A;  1MS5 A;  4XMI A;  1SUU A;  4HW6 A;  3TI8 A;  4CSD A;  1CVM A;  2FLU X;  4QN3 A;  1POO A;  4QN4 A;  1V0Z A;  5F72 C;  2A75 A;  4FPY A;  4N1B A;  1Q7F A;  3TI4 A;  3G4H A;  1F8D A;  4FVK A;  2ISM A;  1S18 A;  4QN5 A;  4I00 A;  3D12 A;  1X2J A;  4MWR A;  2ZB6 A;  4XJ8 A;  1NCD N;  2IAP A;  2QE8 A;  2IAO A;  5GX3 A;  4YW4 A;  2QWA A;  2VSK A;  1L7H A;  1INH A;  2DYH A;  6NN9 A;  3LI5 A;  4GNB A;  4B7J A;  2B8H A; 
#chains in the Genus database with same CATH homology
 4K1K A;  4YW5 A;  2HTW A;  1N1T A;  1INF A;  4YW2 A;  4GZT A;  1Z4X A;  4DGR A;  1DIM A;  1W21 A;  1V0F A;  4CPO A;  2HT7 A;  2QWJ A;  4NCS A;  2QWD A;  2YDT A;  2F27 A;  2C4L A;  2YA7 A;  1MS4 A;  2F24 A;  1Z4V A;  3SLI A;  2YDP A;  3K38 A;  5HUK A;  1IVB A;  4HIZ A;  3A71 A;  1INW A;  4WA5 A;  3O9J A;  1INV A;  1IVC A;  4MWX A;  4CPN A;  4XIO A;  2AH2 A;  3INB A;  1INY A;  4FPE A;  2HTV A;  4K1J A;  4YZ3 A;  1NCA N;  4UF7 A;  3SAN A;  4FPF A;  3GVJ A;  2F13 A;  1IVG A;  4YZ1 A;  1MWE A;  4MC7 A;  3SIL A;  2YA6 A;  3A72 A;  1USX A;  3NN9 A;  1W1X A;  1BJI A;  4JF7 A;  4KS5 A;  4FPC A;  3CL0 A;  1E8U A;  4MWV A;  4XE9 A;  1V2I A;  4XIK A;  3H71 A;  1MS0 A;  4KS1 A;  4XYX A;  4M4V A;  2QWF A;  7NN9 A;  4X6K A;  2QWK A;  5HUG A;  4X47 A;  1XOG A;  3TI3 A;  3B69 A;  3BEQ A;  3CYE A;  1E8V A;  4Q6K A;  3GVK A;  3JU4 A;  4XIL A;  4NN9 A;  4XJQ A;  4WEG A;  2SLI A;  3CKZ A;  2AEP A;  2VVZ A;  4M3M A;  4MJU A;  2BAT A;  2QWG A;  4GZQ A;  4MWL A;  3K3A A;  2AEQ A;  1S0J A;  2W20 A;  4XJ9 A;  4KS4 A;  4QN6 A;  3K36 A;  4MWY A;  1IVE A;  2F0Z A;  4GZO A;  4MWW A;  3OPZ A;  2HTY A;  2YA5 A;  1INX A;  2AGS A;  4SLI A;  2HT5 A;  3H6J A;  4HZY A;  2BF6 A;  1V3C A;  1NSC A;  1A14 N;  4WEF A;  3ALW A;  2F11 A;  5NN9 A;  1N1V A;  4K1H A;  4NC5 A;  1MS9 A;  2XZJ A;  1NMA N;  1Z4Z A;  4FJ6 A;  2QWC A;  2XZK A;  2SIL A;  5HUM A;  5HUN A;  1NCC N;  1V3D A;  2F25 A;  2VK6 A;  4HZX A;  2QWE A;  4GEZ A;  2VW2 A;  4QNP A;  4BBW A;  4XOG A;  2JKB A;  4XMA A;  2HU0 A;  1EUT A;  1MZ6 A;  1NNA A;  2F29 A;  1N1S A;  4YZ2 A;  4D8S A;  4MWJ A;  4MWU A;  1VCU A;  1V3B A;  4K1I A;  1SO7 A;  2VWD A;  4GZP A;  2RKC A;  1KIT A;  1N1Y A;  4YW1 A;  1USR A;  4M4U A;  4WA3 A;  4GB1 A;  4FOY A;  1WCQ A;  3TI5 A;  2VW1 A;  4FP2 A;  1F8C A;  2QWI A;  4XJW A;  4H53 A;  2ZB5 A;  4GZS A;  2BER A;  2YA4 A;  3CL2 A;  3W09 A;  4B7M A;  3K39 A;  5HX0 A;  1IVF A;  1W8O A;  4KS2 A;  4GDI A;  2H2N A;  5F9T A;  2HU4 A;  2X9M A;  1MS1 A;  1W8N A;  4FPG A;  4GDJ A;  4YZ5 A;  3GVL A;  4QN7 A;  4MJV A;  2VK5 A;  3H73 A;  4J9T A;  2F26 A;  4B7R A;  4CPM A;  1V0E A;  1NN2 A;  2CML A;  2QWH A;  4MWQ A;  1A4G A;  1SNT A;  4X49 A;  4XJZ A;  1MS8 A;  1B9S A;  1B9T A;  4MX0 A;  4XHX A;  4FOQ A;  2QWB A;  1ING A;  1V3E A;  4GZX A;  1Z50 A;  3ALX A;  4FPJ A;  3B7E A;  1WCS A;  1EUR A;  1MZ5 A;  4KS3 A;  4FPK A;  4FP3 A;  4HZZ A;  4XJU A;  4FOW A;  1MR5 A;  4HZV A;  3TIC A;  4K3Y A;  2W5O A;  2VW0 A;  2HT8 A;  1EUU A;  3O9K A;  1W20 A;  4YZ4 A;  4CPZ A;  1B9V A;  2VSM A;  4FPO B;  2XZI A;  2VK7 A;  1Z4Y A;  1XOE A;  1NNB A;  4H52 A;  2HTQ A;  1IVD A;  2F28 A;  4FPH A;  4HZW A;  2F10 A;  1E8T A;  2HTR A;  2BZD A;  2YA8 A;  1NMB N;  5M1Z A;  4FOV A;  2W38 A;  4XJA A;  5B2C A;  1F8B A;  3NSS A;  3T1E A;  4X4A A;  4FZH A;  3SAL A;  4MZE A;  2FHR A;  1DIL A;  1F8E A;  1W0O A;  4YW3 A;  4FQ4 A;  3D11 A;  2C4A A;  4CPY A;  2HTU A;  4B7Q A;  3TIB A;  1L7F A;  1NSB A;  2XCY A;  4GJT A;  4WA4 A;  1S1D A;  2H2U A;  1MS3 A;  1NNC A;  5B2D A;  1A4Q A;  1Z4W A;  3TI6 A;  1NMC A;  3H72 A;  2SIM A;  3PJQ A;  4B7N A;  1SLL A;  4XJR A;  4CPL A;  4FPL A;  3K37 A;  4XHB A;  1EUS A;  3TIA A;  2W5N A;  2F12 A;  4MZA A;  5JYY A;  1L7G A;  1SLI A;  1VCJ A;  4M4N A;  1W0P A;  1S0I A;  4GZW A;  1NCB N;  1NSD A;  1MS5 A;  4XMI A;  3TI8 A;  4QN3 A;  4QN4 A;  1V0Z A;  2A75 A;  4FPY A;  3TI4 A;  1F8D A;  4FVK A;  4QN5 A;  1S18 A;  4I00 A;  3D12 A;  4MWR A;  2ZB6 A;  4XJ8 A;  1NCD N;  4YW4 A;  2QWA A;  2VSK A;  1L7H A;  1INH A;  6NN9 A;  4B7J A;  2B8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...