5HUNA

The crystal structure of neuraminidase from a/gyrfalcon/washington/41088-6/2014 influenza virus
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
389
structure length
389
Chain Sequence
GTYINNTEPICDVKGFAPFSKDNGIRVGSRGHIFVIREPFVSCSPVGCRTFFLTQGSLLNDKHSNGTVKDRSPFRTLMSVEVGQSPNVYQARFEAVAWSATACHDGKKWMAIGVTGPDSKAVAVVHYGGVPTDVVNSWAGDILRTQESSCTCIQGNCYWVMTDGPANRQAQYRIYKANQGKIIGRKDVSFSGGHIEECSCYPNDGKVECVCRDNWTGTNRPVLIISPDLSYRVGYLCAGLPSDTPRGEDTQFVGSCTSPMGNQGYGVKGFGFRQGTDVWVGRTISRTSRSGFEIIRIKNGWTQTSKEQIRRQVVVDNSNWSGYSGSFTLPVELSGRECLVPCFWVEMIRGRPEERTIWTSSSSIVMCGVDYEIADWSWHDGAILPFDID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Characterizations of Surface Proteins Hemagglutinin and Neuraminidase from Recent H5Nx Avian Influenza Viruses.
pubmed doi rcsb
molecule keywords Neuraminidase
molecule tags Viral protein
source organism Influenza a virus (a/gyrfalcon/washington/41088-6/2014(h5n8))
total genus 113
structure length 389
sequence length 389
ec nomenclature ec 3.2.1.18: Exo-alpha-sialidase.
pdb deposition date 2016-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00064 Neur Neuraminidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.120.10.10 Mainly Beta 6 Propeller Neuraminidase Neuraminidase 5hunA00
4YZ5A 1IVCA 5F9TA 1NMBN 3GVLA 2QWBA 4GZOA 1Z4VA 4YZ2A 3TICA 2QWEA 2VW1A 1SNTA 2AGSA 4B7NA 2F29A 4NC5A 1S0IA 4XOGA 3BEQA 2QWAA 4FPJA 4NN9A 3D12A 4X49A 4CPYA 3O9KA 4KS4A 1VCJA 4MWQA 2ZB5A 4HIZA 2XZKA 4FOVA 1N1SA 4MZEA 2W5NA 4KS5A 2HU4A 3K38A 4MWWA 4K1IA 4YW1A 2F13A 4CPZA 4B7JA 1IVEA 3INBA 1Z4XA 4CPLA 2QWHA 1V3DA 2SILA 4FPLA 2BZDA 4XJUA 1MS9A 3H71A 2BERA 1MS1A 1NNAA 4KS2A 4WEGA 1EUTA 1NNCA 4Q6KA 3K3AA 1NN2A 1WCQA 4B7RA 4X4AA 1MS5A 1B9SA 1INGA 1NCAN 1MWEA 2F25A 1V3BA 4YZ3A 4D8SA 1INVA 4GJTA 1MS4A 1VCUA 5HUNA 1INWA 4J9TA 4DGRA 1W20A 2HTRA 2YA5A 1W8OA 1Z50A 4XIKA 4FOWA 4YW5A 2F11A 4FPGA 1NCCN 2F28A 2B8HA 2AEQA 4YZ1A 4M3MA 1NMAN 2VK6A 2YDPA 1F8CA 1MR5A 2SLIA 1E8UA 3ALXA 1MZ6A 2F26A 2HU0A 4XYXA 4XHBA 2F24A 4CPOA 4GZPA 2F0ZA 1KITA 1DIMA 4HZWA 1NSBA 3CL2A 2QWKA 4GDIA 1V0FA 4MX0A 2SIMA 4CPNA 1EUSA 1N1YA 4FOYA 1SO7A 4B7QA 2QWGA 1L7FA 4NCSA 2HTWA 3ALWA 1INHA 3D11A 3H6JA 1INXA 2F10A 3SLIA 4YW3A 3CYEA 3H72A 4UF7A 4YZ4A 1EURA 2HTVA 4GZXA 2YA4A 2ZB6A 3JU4A 1A4GA 5HUKA 2RKCA 5HUMA 4H52A 4MWYA 1EUUA 4MWJA 1USXA 4QN6A 3H73A 1NSDA 3A71A 4MWXA 3TIBA 3OPZA 4FP2A 3T1EA 4GDJA 4M4NA 2QWIA 4YW2A 4FPFA 1WCSA 1NCBN 4WA4A 4JF7A 4B7MA 1E8VA 1XOGA 4GB1A 2HT7A 4QN5A 2VSKA 3K39A 1IVDA 4BBWA 4CPMA 4HZYA 1E8TA 2YA6A 4XE9A 5HX0A 4M4VA 4GZWA 1NSCA 1B9TA 4XILA 4WEFA 3PJQA 2VWDA 4XJZA 4K1JA 1IVFA 2XCYA 1INFA 4WA3A 4XMAA 4GEZA 3TIAA 4MJVA 1V0EA 2VW2A 2W5OA 1F8DA 2CMLA 4FOQA 4XJ9A 2FHRA 3GVJA 5NN9A 3SALA 5B2DA 4QNPA 1MS0A 1A4QA 2A75A 1N1VA 2W38A 4XJ8A 5B2CA 2XZJA 4KS1A 1B9VA 2W20A 1W21A 4XJAA 1F8BA 4SLIA 1SLIA 4MJUA 4XIOA 4K3YA 2BF6A 4QN7A 1SLLA 3K36A 4WA5A 1IVGA 4MWRA 2VK5A 3GVKA 4HZXA 3W09A 3CL0A 1INYA 4X6KA 4K1KA 4MWVA 1V2IA 2HTYA 2QWCA 4FPEA 2HTUA 4FVKA 1F8EA 1NNBA 1V3EA 1V3CA 1Z4WA 4FQ4A 3B69A 1DILA 4H53A 5M1ZA 2HT5A 4XJRA 3CKZA 4M4UA 2F12A 2QWDA 3TI5A 1IVBA 2F27A 2VVZA 1W0PA 2JKBA 4FJ6A 4MWLA 3TI8A 4FPKA 2VW0A 3O9JA 4FPYA 2AH2A 4FP3A 4GZSA 6NN9A 4XJWA 1MZ5A 1L7GA 2C4LA 1XOEA 5JYYA 2QWFA 4GZQA 1Z4ZA 2YDTA 1USRA 1NCDN 4FPHA 4MZAA 3SANA 4GZTA 1V0ZA 1MS8A 4MC7A 3A72A 4QN4A 1A14N 4HZZA 2QWJA 4FZHA 3SILA 3K37A 1L7HA 3TI6A 2HT8A 4MWUA 3B7EA 2BATA 4FPOB 4QN3A 1Z4YA 2VK7A 4K1HA 2C4AA 1W1XA 4FPCA 2VSMA 1BJIA 4I00A 3NN9A 4KS3A 1S0JA 4HZVA 2YA8A 1MS3A 4X47A 2AEPA 4XMIA 3TI3A 7NN9A 1W0OA 3TI4A 4YW4A 1W8NA 2HTQA 2YA7A 4XJQA 1NMCA 1N1TA 5HUGA 2X9MA 4XHXA 3NSSA 2XZIA
chains in the Genus database with same CATH superfamily
5FZJA 4CHBA 4HHOA 4GNBA 4YZ5A 1IVCA 5F9TA 1NMBN 3GVLA 2QWBA 4GZOA 5GX2A 5D9DA 1Z4VA 3V64C 4YZ2A 3TICA 4IFNX 2QWEA 3V1SA 2VW1A 1SNTA 2AGSA 5GX4A 4C1YA 3SREA 5FNQA 5CGJA 4B7NA 4GNCA 3O4PA 2F29A 4NC5A 1S0IA 2H2UA 4XOGA 3E5ZA 3HLHA 1S1DA 4D4UA 3BEQA 2QWAA 4FPJA 4NN9A 3D12A 4X49A 4CPYA 4CSDA 3O9KA 4KS4A 1VCJA 4MWQA 2GVWA 2ZB5A 3NO0A 4HIZA 4Q1UA 1PJXA 2XZKA 4FOVA 1N1SA 4MZEA 2W5NA 4KS5A 2GVVA 2HU4A 3K38A 5D9BA 4IMBA 4MWWA 4K1IA 4YW1A 2F13A 4CPZA 3ADEA 4B7JA 1IVEA 3S2KA 3INBA 1Z4XA 4CPLA 2QWHA 3FW0A 1V3DA 1N6DA 2SILA 4FPLA 5FWWA 1N6FA 2BZDA 4XJUA 3SRGA 1MS9A 3H71A 5GX3A 2BERA 1Q7FA 3WN7A 1MS1A 3KYAA 5FNSA 4A0PA 1NNAA 4HHQA 4KS2A 4WEGA 1EUTA 1IJQA 1NNCA 4Q6KA 3S94A 3UC1A 3K3AA 1NN2A 1WCQA 4B7RA 4X4AA 3WWAA 1MS5A 1B9SA 3LI3A 2DG1A 1INGA 1NCAN 3Q6TA 1MWEA 2F25A 1V3BA 5D9CA 4YZ3A 4D8SA 1INVA 1CQ1A 5FNUA 4GJTA 1MS4A 1VCUA 2WOZA 1INWA 4GN7A 4J9TA 5HUNA 4DGRA 1W20A 2HTRA 5GTQA 2YA5A 1W8OA 3HRPA 1Z50A 4XIKA 5GX5A 4FOWA 4YW5A 3WW9A 2F11A 4FPGA 2Z32A 4IYGA 1NCCN 2F28A 2B8HA 2AEQA 3ZGCA 4YZ1A 4AGIA 4M3MA 1NMAN 2VAQA 3AMSA 2IAXA 4D52C 2VK6A 2YDPA 1F8CA 3Q6KA 1MR5A 2SLIA 1E8UA 3ALXA 1MZ6A 2F26A 2HU0A 4XYXA 4XHBA 2F24A 2GVUA 4CPOA 4GZPA 4ZY3A 2F0ZA 2IAWA 1KITA 1DIMA 4HZWA 1NSBA 2ISMA 3CL2A 2QWKA 4GDIA 2ZZKA 1V0FA 4MX0A 2SIMA 5FNRA 4CPNA 4ZLRA 1EUSA 1N1YA 4FOYA 4GNAA 1SO7A 3VNHA 4B7QA 2QWGA 1L7FA 1E1AA 4NCSA 4AH4A 1ZGKA 2HTWA 3ALWA 1INHA 3IAXA 3D11A 3H6JA 1POOA 4D52B 1INXA 2F10A 4G3NA 4L7CA 3U0SA 3SLIA 4YW3A 3CYEA 3H72A 4ASCA 4O5SA 2IAOA 4YZ4A 1EURA 4UF7A 2FLUX 2HTVA 4GZXA 2YA4A 1U6DX 2FPBA 1C9UA 2ZB6A 3JU4A 1A4GA 4XMBA 5H47A 5HUKA 2RKCA 5HUMA 4H52A 4MWYA 1EUUA 4MWJA 1USXA 4QN6A 3H73A 1NSDA 3A71A 4MWXA 2FPCA 3TIBA 3OPZA 3WDZA 1IUBA 4IFLX 4FP2A 2W8BB 3T1EA 4GDJA 1ZI0A 2VPJA 1RWLA 3Q6PA 4M4NA 2QWIA 4YW2A 4FPFA 1WCSA 1NCBN 4WA4A 3L6VA 5GX1A 4JF7A 4B7MA 1E8VA 1XOGA 4GB1A 2IASA 2HT7A 3V65B 4QN5A 2VSKA 3K39A 1IVDA 4BBWA 4CPMA 4HZYA 1E8TA 3ZGDA 2YA6A 2IAVA 4XE9A 3DASA 4R40A 4M4VA 5HX0A 2DG0A 4GZWA 1NSCA 1B9TA 4XILA 1N6EA 5F72C 4WEFA 3PJQA 2VWDA 4XJZA 4K1JA 1IVFA 2XCYA 4L7BA 1IUCA 1INFA 1QLGA 4WA3A 4XMAA 4GEZA 1X2JA 3TIAA 4MJVA 1V0EA 2VW2A 2W5OA 1F8DA 2CMLA 4FOQA 4CH9A 2ZW9A 3II7A 4XJ9A 3FVZA 2GVXA 1QBIA 2FHRA 3GVJA 5NN9A 3SALA 5B2DA 4QNPA 3G4EA 1MS0A 1C5KA 1A4QA 2A75A 3HLIA 2G8SA 5FNTA 1N1VA 2W38A 4XJ8A 5B2CA 3VNGA 2XZJA 4KS1A 1B9VA 2W20A 3SOQA 1W21A 4XJAA 1F8BA 4SLIA 1SLIA 4MJUA 3I1CA 4XIOA 5FZNA 4K3YA 2BF6A 4QN7A 1SLLA 3K36A 4N1BA 4WA5A 5EX7A 1IVGA 4MWRA 2VK5A 3GVKA 4HZXA 4HW6A 3W09A 3CL0A 3G4HA 1INYA 4D52A 4X6KA 4K1KA 4MWVA 1V2IA 3S8VA 2HTYA 2QWCA 4FPEA 2HTUA 4FVKA 1F8EA 3LI5A 4ZGCA 1NNBA 1V3EA 1RWIA 2FP8A 1V3CA 1K32A 2IVZA 1Z4WA 4FQ4A 2FP9A 3B69A 1DILA 4H53A 5M1ZA 4C1YB 4AGTA 3SOVA 2HT5A 4XJRA 3CKZA 4M4UA 4O5TA 2F12A 2QWDA 3TI5A 3LI4A 1IVBA 2F27A 1CRZA 2VVZA 1W0PA 2JKBA 4FJ6A 4MWLA 3AMRA 3TI8A 4FPKA 1CRUA 2W8BA 3DR2A 2VW0A 3O9JA 4FPYA 4GN8A 2AH2A 4FP3A 4JMLA 2V91A 4GZSA 6NN9A 4XJWA 1MZ5A 1L7GA 2C4LA 1XOEA 1N7DA 5JYYA 2QWFA 4YY8A 1SUUA 4GZQA 3KGGA 1Z4ZA 2YDTA 2QE8A 1USRA 1S18A 1NCDN 4IN4A 4FPHA 4MZAA 3SOBB 3SANA 3BYCA 4GZTA 2H2NA 1X2RA 1OFZA 1V0ZA 1MS8A 2IAQA 4MC7A 3A72A 1CVMA 4GN9A 4PWZA 1A14N 4QN4A 4HZZA 2QWJA 4L7DA 2XN4A 3A9GA 4FZHA 3SILA 2ZWAA 3K37A 5EO8A 4DG6A 2POOA 1L7HA 3TI6A 1V04A 2HT8A 4MWUA 2IAUA 3B7EA 2BATA 4FPOB 2DYHA 4QN3A 2IARA 3TC9A 1NPEA 1Z4YA 2VK7A 2HQSA 4K1HA 2C4AA 2DSOA 1W1XA 4FPCA 2VSMA 1BJIA 4I00A 1WP5A 3NN9A 4KS3A 5EO7A 1S0JA 4HZVA 4AHAA 2YA8A 4IFJA 2GHSA 1MS3A 4X47A 2AEPA 4XMIA 3TI3A 1H6LA 7NN9A 1W0OA 2IATA 2IAPA 2P4OA 3P5BL 3A9HA 3S8ZA 3TI4A 4YW4A 4IQKA 1W8NA 2HTQA 2YA7A 4XJQA 1NMCA 2OJHA 1N1TA 4UOUA 5HUGA 2X9MA 4XHXA 3NSSA 2XZIA
chains in the Genus database with same CATH topology
4YZ5A 1IVCA 5F9TA 1NMBN 3GVLA 2QWBA 4GZOA 1Z4VA 4YZ2A 3TICA 2QWEA 2VW1A 1SNTA 2AGSA 4B7NA 4NC5A 2F29A 1S0IA 2H2UA 4XOGA 1S1DA 3BEQA 2QWAA 4FPJA 4NN9A 3D12A 4X49A 4CPYA 3O9KA 4KS4A 1VCJA 4MWQA 2ZB5A 4HIZA 2XZKA 4FOVA 1N1SA 4MZEA 2W5NA 4KS5A 2HU4A 3K38A 4MWWA 4K1IA 4YW1A 2F13A 4CPZA 4B7JA 1IVEA 3INBA 1Z4XA 4CPLA 2QWHA 1V3DA 2SILA 4FPLA 2BZDA 4XJUA 1MS9A 3H71A 2BERA 1MS1A 1NNAA 4KS2A 4WEGA 1EUTA 1NNCA 4Q6KA 3K3AA 1NN2A 1WCQA 4B7RA 4X4AA 1MS5A 1B9SA 1INGA 1NCAN 1MWEA 2F25A 1V3BA 4YZ3A 4D8SA 1INVA 4GJTA 1MS4A 1VCUA 5HUNA 1INWA 4J9TA 4DGRA 1W20A 2HTRA 2YA5A 1W8OA 1Z50A 4XIKA 4FOWA 4YW5A 2F11A 4FPGA 1NCCN 2F28A 2B8HA 2AEQA 4YZ1A 4M3MA 1NMAN 2VK6A 2YDPA 1F8CA 1MR5A 2SLIA 1E8UA 3ALXA 1MZ6A 2F26A 2HU0A 4XYXA 4XHBA 2F24A 4CPOA 4GZPA 2F0ZA 1KITA 1DIMA 4HZWA 1NSBA 3CL2A 2QWKA 4GDIA 1V0FA 4MX0A 2SIMA 4CPNA 1EUSA 1N1YA 4FOYA 1SO7A 4B7QA 2QWGA 1L7FA 4NCSA 2HTWA 3ALWA 1INHA 3D11A 3H6JA 1INXA 2F10A 3SLIA 4YW3A 3CYEA 3H72A 4UF7A 4YZ4A 1EURA 2HTVA 4GZXA 2YA4A 2ZB6A 3JU4A 1A4GA 5HUKA 2RKCA 5HUMA 4H52A 4MWYA 1EUUA 4MWJA 1USXA 4QN6A 3H73A 1NSDA 3A71A 4MWXA 3TIBA 3OPZA 4FP2A 3T1EA 4GDJA 4M4NA 2QWIA 4YW2A 4FPFA 1WCSA 1NCBN 4WA4A 4JF7A 4B7MA 1E8VA 1XOGA 4GB1A 2HT7A 4QN5A 2VSKA 3K39A 1IVDA 4BBWA 4CPMA 4HZYA 1E8TA 2YA6A 4XE9A 5HX0A 4M4VA 4GZWA 1NSCA 1B9TA 4XILA 4WEFA 3PJQA 2VWDA 4XJZA 4K1JA 1IVFA 2XCYA 1INFA 4WA3A 4XMAA 4GEZA 3TIAA 4MJVA 1V0EA 2VW2A 2W5OA 1F8DA 2CMLA 4FOQA 4XJ9A 2FHRA 3GVJA 5NN9A 3SALA 5B2DA 4QNPA 1MS0A 1A4QA 2A75A 1N1VA 2W38A 4XJ8A 5B2CA 2XZJA 4KS1A 1B9VA 2W20A 1W21A 4XJAA 1F8BA 4SLIA 1SLIA 4MJUA 4XIOA 4K3YA 2BF6A 4QN7A 1SLLA 3K36A 4WA5A 1IVGA 4MWRA 2VK5A 3GVKA 4HZXA 3W09A 3CL0A 1INYA 4X6KA 4K1KA 4MWVA 1V2IA 2HTYA 2QWCA 4FPEA 2HTUA 4FVKA 1F8EA 1NNBA 1V3EA 1V3CA 1Z4WA 4FQ4A 3B69A 1DILA 4H53A 5M1ZA 2HT5A 4XJRA 3CKZA 4M4UA 2F12A 2QWDA 3TI5A 1IVBA 2F27A 2VVZA 1W0PA 2JKBA 4FJ6A 4MWLA 3TI8A 4FPKA 2VW0A 3O9JA 4FPYA 2AH2A 4FP3A 4GZSA 6NN9A 4XJWA 1MZ5A 1L7GA 2C4LA 1XOEA 5JYYA 2QWFA 4GZQA 1Z4ZA 2YDTA 1USRA 1S18A 1NCDN 4FPHA 4MZAA 3SANA 4GZTA 2H2NA 1V0ZA 1MS8A 4MC7A 3A72A 4QN4A 1A14N 4HZZA 2QWJA 4FZHA 3SILA 3K37A 1L7HA 3TI6A 2HT8A 4MWUA 3B7EA 2BATA 4FPOB 4QN3A 1Z4YA 2VK7A 4K1HA 2C4AA 1W1XA 4FPCA 2VSMA 1BJIA 4I00A 3NN9A 4KS3A 1S0JA 4HZVA 2YA8A 1MS3A 4X47A 2AEPA 4XMIA 3TI3A 7NN9A 1W0OA 3TI4A 4YW4A 1W8NA 2HTQA 2YA7A 4XJQA 1NMCA 1N1TA 5HUGA 2X9MA 4XHXA 3NSSA 2XZIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YZ5 A;  1IVC A;  5F9T A;  1NMB N;  3GVL A;  2QWB A;  4GZO A;  1Z4V A;  4YZ2 A;  3TIC A;  2QWE A;  2VW1 A;  1SNT A;  2AGS A;  4B7N A;  2F29 A;  4NC5 A;  1S0I A;  4XOG A;  3BEQ A;  2QWA A;  4FPJ A;  4NN9 A;  3D12 A;  4X49 A;  4CPY A;  3O9K A;  4KS4 A;  1VCJ A;  4MWQ A;  2ZB5 A;  4HIZ A;  2XZK A;  4FOV A;  1N1S A;  4MZE A;  2W5N A;  4KS5 A;  2HU4 A;  3K38 A;  4MWW A;  4K1I A;  4YW1 A;  2F13 A;  4CPZ A;  4B7J A;  1IVE A;  3INB A;  1Z4X A;  4CPL A;  2QWH A;  1V3D A;  2SIL A;  4FPL A;  2BZD A;  4XJU A;  1MS9 A;  3H71 A;  2BER A;  1MS1 A;  1NNA A;  4KS2 A;  4WEG A;  1EUT A;  1NNC A;  4Q6K A;  3K3A A;  1NN2 A;  1WCQ A;  4B7R A;  4X4A A;  1MS5 A;  1B9S A;  1ING A;  1NCA N;  1MWE A;  2F25 A;  1V3B A;  4YZ3 A;  4D8S A;  1INV A;  4GJT A;  1MS4 A;  1VCU A;  5HUN A;  1INW A;  4J9T A;  4DGR A;  1W20 A;  2HTR A;  2YA5 A;  1W8O A;  1Z50 A;  4XIK A;  4FOW A;  4YW5 A;  2F11 A;  4FPG A;  1NCC N;  2F28 A;  2B8H A;  2AEQ A;  4YZ1 A;  4M3M A;  1NMA N;  2VK6 A;  2YDP A;  1F8C A;  1MR5 A;  2SLI A;  1E8U A;  3ALX A;  1MZ6 A;  2F26 A;  2HU0 A;  4XYX A;  4XHB A;  2F24 A;  4CPO A;  4GZP A;  2F0Z A;  1KIT A;  1DIM A;  4HZW A;  1NSB A;  3CL2 A;  2QWK A;  4GDI A;  1V0F A;  4MX0 A;  2SIM A;  4CPN A;  1EUS A;  1N1Y A;  4FOY A;  1SO7 A;  4B7Q A;  2QWG A;  1L7F A;  4NCS A;  2HTW A;  3ALW A;  1INH A;  3D11 A;  3H6J A;  1INX A;  2F10 A;  3SLI A;  4YW3 A;  3CYE A;  3H72 A;  4UF7 A;  4YZ4 A;  1EUR A;  2HTV A;  4GZX A;  2YA4 A;  2ZB6 A;  3JU4 A;  1A4G A;  5HUK A;  2RKC A;  5HUM A;  4H52 A;  4MWY A;  1EUU A;  4MWJ A;  1USX A;  4QN6 A;  3H73 A;  1NSD A;  3A71 A;  4MWX A;  3TIB A;  3OPZ A;  4FP2 A;  3T1E A;  4GDJ A;  4M4N A;  2QWI A;  4YW2 A;  4FPF A;  1WCS A;  1NCB N;  4WA4 A;  4JF7 A;  4B7M A;  1E8V A;  1XOG A;  4GB1 A;  2HT7 A;  4QN5 A;  2VSK A;  3K39 A;  1IVD A;  4BBW A;  4CPM A;  4HZY A;  1E8T A;  2YA6 A;  4XE9 A;  5HX0 A;  4M4V A;  4GZW A;  1NSC A;  1B9T A;  4XIL A;  4WEF A;  3PJQ A;  2VWD A;  4XJZ A;  4K1J A;  1IVF A;  2XCY A;  1INF A;  4WA3 A;  4XMA A;  4GEZ A;  3TIA A;  4MJV A;  1V0E A;  2VW2 A;  2W5O A;  1F8D A;  2CML A;  4FOQ A;  4XJ9 A;  2FHR A;  3GVJ A;  5NN9 A;  3SAL A;  5B2D A;  4QNP A;  1MS0 A;  1A4Q A;  2A75 A;  1N1V A;  2W38 A;  4XJ8 A;  5B2C A;  2XZJ A;  4KS1 A;  1B9V A;  2W20 A;  1W21 A;  4XJA A;  1F8B A;  4SLI A;  1SLI A;  4MJU A;  4XIO A;  4K3Y A;  2BF6 A;  4QN7 A;  1SLL A;  3K36 A;  4WA5 A;  1IVG A;  4MWR A;  2VK5 A;  3GVK A;  4HZX A;  3W09 A;  3CL0 A;  1INY A;  4X6K A;  4K1K A;  4MWV A;  1V2I A;  2HTY A;  2QWC A;  4FPE A;  2HTU A;  4FVK A;  1F8E A;  1NNB A;  1V3E A;  1V3C A;  1Z4W A;  4FQ4 A;  3B69 A;  1DIL A;  4H53 A;  5M1Z A;  2HT5 A;  4XJR A;  3CKZ A;  4M4U A;  2F12 A;  2QWD A;  3TI5 A;  1IVB A;  2F27 A;  2VVZ A;  1W0P A;  2JKB A;  4FJ6 A;  4MWL A;  3TI8 A;  4FPK A;  2VW0 A;  3O9J A;  4FPY A;  2AH2 A;  4FP3 A;  4GZS A;  6NN9 A;  4XJW A;  1MZ5 A;  1L7G A;  2C4L A;  1XOE A;  5JYY A;  2QWF A;  4GZQ A;  1Z4Z A;  2YDT A;  1USR A;  1NCD N;  4FPH A;  4MZA A;  3SAN A;  4GZT A;  1V0Z A;  1MS8 A;  4MC7 A;  3A72 A;  4QN4 A;  1A14 N;  4HZZ A;  2QWJ A;  4FZH A;  3SIL A;  3K37 A;  1L7H A;  3TI6 A;  2HT8 A;  4MWU A;  3B7E A;  2BAT A;  4FPO B;  4QN3 A;  1Z4Y A;  2VK7 A;  4K1H A;  2C4A A;  1W1X A;  4FPC A;  2VSM A;  1BJI A;  4I00 A;  3NN9 A;  4KS3 A;  1S0J A;  4HZV A;  2YA8 A;  1MS3 A;  4X47 A;  2AEP A;  4XMI A;  3TI3 A;  7NN9 A;  1W0O A;  3TI4 A;  4YW4 A;  1W8N A;  2HTQ A;  2YA7 A;  4XJQ A;  1NMC A;  1N1T A;  5HUG A;  2X9M A;  4XHX A;  3NSS A;  2XZI A; 
#chains in the Genus database with same CATH topology
 5FZJ A;  4CHB A;  4HHO A;  4GNB A;  4YZ5 A;  1IVC A;  5F9T A;  1NMB N;  3GVL A;  2QWB A;  4GZO A;  5GX2 A;  5D9D A;  1Z4V A;  3V64 C;  4YZ2 A;  3TIC A;  4IFN X;  2QWE A;  3V1S A;  2VW1 A;  1SNT A;  2AGS A;  5GX4 A;  4C1Y A;  3SRE A;  5FNQ A;  5CGJ A;  4B7N A;  4GNC A;  3O4P A;  2F29 A;  4NC5 A;  1S0I A;  2H2U A;  4XOG A;  3E5Z A;  3HLH A;  1S1D A;  4D4U A;  3BEQ A;  2QWA A;  4FPJ A;  4NN9 A;  3D12 A;  4X49 A;  4CPY A;  4CSD A;  3O9K A;  4KS4 A;  1VCJ A;  4MWQ A;  2GVW A;  2ZB5 A;  3NO0 A;  4HIZ A;  4Q1U A;  1PJX A;  2XZK A;  4FOV A;  1N1S A;  4MZE A;  2W5N A;  4KS5 A;  2GVV A;  2HU4 A;  3K38 A;  5D9B A;  4IMB A;  4MWW A;  4K1I A;  4YW1 A;  2F13 A;  4CPZ A;  3ADE A;  4B7J A;  1IVE A;  3S2K A;  3INB A;  1Z4X A;  4CPL A;  2QWH A;  3FW0 A;  1V3D A;  1N6D A;  2SIL A;  4FPL A;  5FWW A;  1N6F A;  2BZD A;  4XJU A;  3SRG A;  1MS9 A;  3H71 A;  5GX3 A;  2BER A;  1Q7F A;  3WN7 A;  1MS1 A;  3KYA A;  5FNS A;  4A0P A;  1NNA A;  4HHQ A;  4KS2 A;  4WEG A;  1EUT A;  1IJQ A;  1NNC A;  4Q6K A;  3S94 A;  3UC1 A;  3K3A A;  1NN2 A;  1WCQ A;  4B7R A;  4X4A A;  3WWA A;  1MS5 A;  1B9S A;  3LI3 A;  2DG1 A;  1ING A;  1NCA N;  3Q6T A;  1MWE A;  2F25 A;  1V3B A;  5D9C A;  4YZ3 A;  4D8S A;  1INV A;  1CQ1 A;  5FNU A;  4GJT A;  1MS4 A;  1VCU A;  2WOZ A;  1INW A;  4GN7 A;  4J9T A;  5HUN A;  4DGR A;  1W20 A;  2HTR A;  5GTQ A;  2YA5 A;  1W8O A;  3HRP A;  1Z50 A;  4XIK A;  5GX5 A;  4FOW A;  4YW5 A;  3WW9 A;  2F11 A;  4FPG A;  2Z32 A;  4IYG A;  1NCC N;  2F28 A;  2B8H A;  2AEQ A;  3ZGC A;  4YZ1 A;  4AGI A;  4M3M A;  1NMA N;  2VAQ A;  3AMS A;  2IAX A;  4D52 C;  2VK6 A;  2YDP A;  1F8C A;  3Q6K A;  1MR5 A;  2SLI A;  1E8U A;  3ALX A;  1MZ6 A;  2F26 A;  2HU0 A;  4XYX A;  4XHB A;  2F24 A;  2GVU A;  4CPO A;  4GZP A;  4ZY3 A;  2F0Z A;  2IAW A;  1KIT A;  1DIM A;  4HZW A;  1NSB A;  2ISM A;  3CL2 A;  2QWK A;  4GDI A;  2ZZK A;  1V0F A;  4MX0 A;  2SIM A;  5FNR A;  4CPN A;  4ZLR A;  1EUS A;  1N1Y A;  4FOY A;  4GNA A;  1SO7 A;  3VNH A;  4B7Q A;  2QWG A;  1L7F A;  1E1A A;  4NCS A;  4AH4 A;  1ZGK A;  2HTW A;  3ALW A;  1INH A;  3IAX A;  3D11 A;  3H6J A;  1POO A;  4D52 B;  1INX A;  2F10 A;  4G3N A;  4L7C A;  3U0S A;  3SLI A;  4YW3 A;  3CYE A;  3H72 A;  4ASC A;  4O5S A;  2IAO A;  4YZ4 A;  1EUR A;  4UF7 A;  2FLU X;  2HTV A;  4GZX A;  2YA4 A;  1U6D X;  2FPB A;  1C9U A;  2ZB6 A;  3JU4 A;  1A4G A;  4XMB A;  5H47 A;  5HUK A;  2RKC A;  5HUM A;  4H52 A;  4MWY A;  1EUU A;  4MWJ A;  1USX A;  4QN6 A;  3H73 A;  1NSD A;  3A71 A;  4MWX A;  2FPC A;  3TIB A;  3OPZ A;  3WDZ A;  1IUB A;  4IFL X;  4FP2 A;  2W8B B;  3T1E A;  4GDJ A;  1ZI0 A;  2VPJ A;  1RWL A;  3Q6P A;  4M4N A;  2QWI A;  4YW2 A;  4FPF A;  1WCS A;  1NCB N;  4WA4 A;  3L6V A;  5GX1 A;  4JF7 A;  4B7M A;  1E8V A;  1XOG A;  4GB1 A;  2IAS A;  2HT7 A;  3V65 B;  4QN5 A;  2VSK A;  3K39 A;  1IVD A;  4BBW A;  4CPM A;  4HZY A;  1E8T A;  3ZGD A;  2YA6 A;  2IAV A;  4XE9 A;  3DAS A;  4R40 A;  4M4V A;  5HX0 A;  2DG0 A;  4GZW A;  1NSC A;  1B9T A;  4XIL A;  1N6E A;  5F72 C;  4WEF A;  3PJQ A;  2VWD A;  4XJZ A;  4K1J A;  1IVF A;  2XCY A;  4L7B A;  1IUC A;  1INF A;  1QLG A;  4WA3 A;  4XMA A;  4GEZ A;  1X2J A;  3TIA A;  4MJV A;  1V0E A;  2VW2 A;  2W5O A;  1F8D A;  2CML A;  4FOQ A;  4CH9 A;  2ZW9 A;  3II7 A;  4XJ9 A;  3FVZ A;  2GVX A;  1QBI A;  2FHR A;  3GVJ A;  5NN9 A;  3SAL A;  5B2D A;  4QNP A;  3G4E A;  1MS0 A;  1C5K A;  1A4Q A;  2A75 A;  3HLI A;  2G8S A;  5FNT A;  1N1V A;  2W38 A;  4XJ8 A;  5B2C A;  3VNG A;  2XZJ A;  4KS1 A;  1B9V A;  2W20 A;  3SOQ A;  1W21 A;  4XJA A;  1F8B A;  4SLI A;  1SLI A;  4MJU A;  3I1C A;  4XIO A;  5FZN A;  4K3Y A;  2BF6 A;  4QN7 A;  1SLL A;  3K36 A;  4N1B A;  4WA5 A;  5EX7 A;  1IVG A;  4MWR A;  2VK5 A;  3GVK A;  4HZX A;  4HW6 A;  3W09 A;  3CL0 A;  3G4H A;  1INY A;  4D52 A;  4X6K A;  4K1K A;  4MWV A;  1V2I A;  3S8V A;  2HTY A;  2QWC A;  4FPE A;  2HTU A;  4FVK A;  1F8E A;  3LI5 A;  4ZGC A;  1NNB A;  1V3E A;  1RWI A;  2FP8 A;  1V3C A;  1K32 A;  2IVZ A;  1Z4W A;  4FQ4 A;  2FP9 A;  3B69 A;  1DIL A;  4H53 A;  5M1Z A;  4C1Y B;  4AGT A;  3SOV A;  2HT5 A;  4XJR A;  3CKZ A;  4M4U A;  4O5T A;  2F12 A;  2QWD A;  3TI5 A;  3LI4 A;  1IVB A;  2F27 A;  1CRZ A;  2VVZ A;  1W0P A;  2JKB A;  4FJ6 A;  4MWL A;  3AMR A;  3TI8 A;  4FPK A;  1CRU A;  2W8B A;  3DR2 A;  2VW0 A;  3O9J A;  4FPY A;  4GN8 A;  2AH2 A;  4FP3 A;  4JML A;  2V91 A;  4GZS A;  6NN9 A;  4XJW A;  1MZ5 A;  1L7G A;  2C4L A;  1XOE A;  1N7D A;  5JYY A;  2QWF A;  4YY8 A;  1SUU A;  4GZQ A;  3KGG A;  1Z4Z A;  2YDT A;  2QE8 A;  1USR A;  1S18 A;  1NCD N;  4IN4 A;  4FPH A;  4MZA A;  3SOB B;  3SAN A;  3BYC A;  4GZT A;  2H2N A;  1X2R A;  1OFZ A;  1V0Z A;  1MS8 A;  2IAQ A;  4MC7 A;  3A72 A;  1CVM A;  4GN9 A;  4PWZ A;  1A14 N;  4QN4 A;  4HZZ A;  2QWJ A;  4L7D A;  2XN4 A;  3A9G A;  4FZH A;  3SIL A;  2ZWA A;  3K37 A;  5EO8 A;  4DG6 A;  2POO A;  1L7H A;  3TI6 A;  1V04 A;  2HT8 A;  4MWU A;  2IAU A;  3B7E A;  2BAT A;  4FPO B;  2DYH A;  4QN3 A;  2IAR A;  3TC9 A;  1NPE A;  1Z4Y A;  2VK7 A;  2HQS A;  4K1H A;  2C4A A;  2DSO A;  1W1X A;  4FPC A;  2VSM A;  1BJI A;  4I00 A;  1WP5 A;  3NN9 A;  4KS3 A;  5EO7 A;  1S0J A;  4HZV A;  4AHA A;  2YA8 A;  4IFJ A;  2GHS A;  1MS3 A;  4X47 A;  2AEP A;  4XMI A;  3TI3 A;  1H6L A;  7NN9 A;  1W0O A;  2IAT A;  2IAP A;  2P4O A;  3P5B L;  3A9H A;  3S8Z A;  3TI4 A;  4YW4 A;  4IQK A;  1W8N A;  2HTQ A;  2YA7 A;  4XJQ A;  1NMC A;  2OJH A;  1N1T A;  4UOU A;  5HUG A;  2X9M A;  4XHX A;  3NSS A;  2XZI A; 
#chains in the Genus database with same CATH homology
 4YZ5 A;  1IVC A;  5F9T A;  1NMB N;  3GVL A;  2QWB A;  4GZO A;  1Z4V A;  4YZ2 A;  3TIC A;  2QWE A;  2VW1 A;  1SNT A;  2AGS A;  4B7N A;  4NC5 A;  2F29 A;  1S0I A;  2H2U A;  4XOG A;  1S1D A;  3BEQ A;  2QWA A;  4FPJ A;  4NN9 A;  3D12 A;  4X49 A;  4CPY A;  3O9K A;  4KS4 A;  1VCJ A;  4MWQ A;  2ZB5 A;  4HIZ A;  2XZK A;  4FOV A;  1N1S A;  4MZE A;  2W5N A;  4KS5 A;  2HU4 A;  3K38 A;  4MWW A;  4K1I A;  4YW1 A;  2F13 A;  4CPZ A;  4B7J A;  1IVE A;  3INB A;  1Z4X A;  4CPL A;  2QWH A;  1V3D A;  2SIL A;  4FPL A;  2BZD A;  4XJU A;  1MS9 A;  3H71 A;  2BER A;  1MS1 A;  1NNA A;  4KS2 A;  4WEG A;  1EUT A;  1NNC A;  4Q6K A;  3K3A A;  1NN2 A;  1WCQ A;  4B7R A;  4X4A A;  1MS5 A;  1B9S A;  1ING A;  1NCA N;  1MWE A;  2F25 A;  1V3B A;  4YZ3 A;  4D8S A;  1INV A;  4GJT A;  1MS4 A;  1VCU A;  5HUN A;  1INW A;  4J9T A;  4DGR A;  1W20 A;  2HTR A;  2YA5 A;  1W8O A;  1Z50 A;  4XIK A;  4FOW A;  4YW5 A;  2F11 A;  4FPG A;  1NCC N;  2F28 A;  2B8H A;  2AEQ A;  4YZ1 A;  4M3M A;  1NMA N;  2VK6 A;  2YDP A;  1F8C A;  1MR5 A;  2SLI A;  1E8U A;  3ALX A;  1MZ6 A;  2F26 A;  2HU0 A;  4XYX A;  4XHB A;  2F24 A;  4CPO A;  4GZP A;  2F0Z A;  1KIT A;  1DIM A;  4HZW A;  1NSB A;  3CL2 A;  2QWK A;  4GDI A;  1V0F A;  4MX0 A;  2SIM A;  4CPN A;  1EUS A;  1N1Y A;  4FOY A;  1SO7 A;  4B7Q A;  2QWG A;  1L7F A;  4NCS A;  2HTW A;  3ALW A;  1INH A;  3D11 A;  3H6J A;  1INX A;  2F10 A;  3SLI A;  4YW3 A;  3CYE A;  3H72 A;  4UF7 A;  4YZ4 A;  1EUR A;  2HTV A;  4GZX A;  2YA4 A;  2ZB6 A;  3JU4 A;  1A4G A;  5HUK A;  2RKC A;  5HUM A;  4H52 A;  4MWY A;  1EUU A;  4MWJ A;  1USX A;  4QN6 A;  3H73 A;  1NSD A;  3A71 A;  4MWX A;  3TIB A;  3OPZ A;  4FP2 A;  3T1E A;  4GDJ A;  4M4N A;  2QWI A;  4YW2 A;  4FPF A;  1WCS A;  1NCB N;  4WA4 A;  4JF7 A;  4B7M A;  1E8V A;  1XOG A;  4GB1 A;  2HT7 A;  4QN5 A;  2VSK A;  3K39 A;  1IVD A;  4BBW A;  4CPM A;  4HZY A;  1E8T A;  2YA6 A;  4XE9 A;  5HX0 A;  4M4V A;  4GZW A;  1NSC A;  1B9T A;  4XIL A;  4WEF A;  3PJQ A;  2VWD A;  4XJZ A;  4K1J A;  1IVF A;  2XCY A;  1INF A;  4WA3 A;  4XMA A;  4GEZ A;  3TIA A;  4MJV A;  1V0E A;  2VW2 A;  2W5O A;  1F8D A;  2CML A;  4FOQ A;  4XJ9 A;  2FHR A;  3GVJ A;  5NN9 A;  3SAL A;  5B2D A;  4QNP A;  1MS0 A;  1A4Q A;  2A75 A;  1N1V A;  2W38 A;  4XJ8 A;  5B2C A;  2XZJ A;  4KS1 A;  1B9V A;  2W20 A;  1W21 A;  4XJA A;  1F8B A;  4SLI A;  1SLI A;  4MJU A;  4XIO A;  4K3Y A;  2BF6 A;  4QN7 A;  1SLL A;  3K36 A;  4WA5 A;  1IVG A;  4MWR A;  2VK5 A;  3GVK A;  4HZX A;  3W09 A;  3CL0 A;  1INY A;  4X6K A;  4K1K A;  4MWV A;  1V2I A;  2HTY A;  2QWC A;  4FPE A;  2HTU A;  4FVK A;  1F8E A;  1NNB A;  1V3E A;  1V3C A;  1Z4W A;  4FQ4 A;  3B69 A;  1DIL A;  4H53 A;  5M1Z A;  2HT5 A;  4XJR A;  3CKZ A;  4M4U A;  2F12 A;  2QWD A;  3TI5 A;  1IVB A;  2F27 A;  2VVZ A;  1W0P A;  2JKB A;  4FJ6 A;  4MWL A;  3TI8 A;  4FPK A;  2VW0 A;  3O9J A;  4FPY A;  2AH2 A;  4FP3 A;  4GZS A;  6NN9 A;  4XJW A;  1MZ5 A;  1L7G A;  2C4L A;  1XOE A;  5JYY A;  2QWF A;  4GZQ A;  1Z4Z A;  2YDT A;  1USR A;  1S18 A;  1NCD N;  4FPH A;  4MZA A;  3SAN A;  4GZT A;  2H2N A;  1V0Z A;  1MS8 A;  4MC7 A;  3A72 A;  4QN4 A;  1A14 N;  4HZZ A;  2QWJ A;  4FZH A;  3SIL A;  3K37 A;  1L7H A;  3TI6 A;  2HT8 A;  4MWU A;  3B7E A;  2BAT A;  4FPO B;  4QN3 A;  1Z4Y A;  2VK7 A;  4K1H A;  2C4A A;  1W1X A;  4FPC A;  2VSM A;  1BJI A;  4I00 A;  3NN9 A;  4KS3 A;  1S0J A;  4HZV A;  2YA8 A;  1MS3 A;  4X47 A;  2AEP A;  4XMI A;  3TI3 A;  7NN9 A;  1W0O A;  3TI4 A;  4YW4 A;  1W8N A;  2HTQ A;  2YA7 A;  4XJQ A;  1NMC A;  1N1T A;  5HUG A;  2X9M A;  4XHX A;  3NSS A;  2XZI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...