5I3LA

Dpf3b in complex with h3k14ac peptide
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
112
structure length
112
Chain Sequence
VIPNNYCDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTLNMTEAVKTYKWQCIECKSCILCGTSENDDQLLFCDDCDRGYHMYCLNPPVAEPPEGSWSCHLCWELL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of DPF3b in complex with an acetylated histone peptide.
pubmed doi rcsb
molecule keywords Zinc finger protein DPF3
molecule tags Peptide binding protein
source organism Homo sapiens
total genus 24
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5i3lA00
2RSDA 3ZNIA 2VJEA 2L43A 2EGPA 5G0FA 4R2YA 1HYIA 2JRJA 2E6SA 2KU3A 3LRQA 1HYJA 2YSJA 3M99A 3SOXA 5B78A 4YBSA 2C2LA 4YAXA 2VJFA 4L58A 3GV4A 4A4CA 3IHPA 5B75A 1F62A 2MA6A 1G25A 2D8SA 2YT5A 4YC9A 5D1LB 2YREA 2QJ0A 4YATA 3ZVYA 3LQJA 4IC2A 4R8PK 4S3OB 5H1VA 2UZGA 2KGIA 3QZVA 3ZTGA 3KV6A 2LDRA 2VJEB 2KWNA 4N4FA 4YADA 2LXPC 4AP4A 3L1XA 4GNFA 3O35A 3M63A 4C9ZA 4I7DA 3T6RA 4B86C 2M6MA 5B8DA 3SOWA 4UI9B 3DPLR 3U5OA 3SOUA 2K4DA 1WEOA 2YSMA 2KGGA 2LRIC 1CHCA 3U5MA 5G04B 5C13A 4F52B 1WEEA 3HTKC 5TDRA 5B77A 2DX8A 3O70A 2XB1A 5LKZA 1JM7A 2E6RA 4N3WA 2Y1NA 4O64A 3HCTA 2CT2A 2M3HA 2YUCA 1LDJB 4I7BA 2LN0A 4R7EA 2K16A 1U6GB 3RTRB 2L5UA 5FEYA 4GB0A 3HCUA 3PHDA 3ZPVE 2YW8A 1ZBDB 4CA1A 2LGGA 2MT5A 3NG2A 2KFTA 3O33A 3ZPV1 5I3LA 4GNDA 2VPEA 1WGMA 1Z6UA 2LGLA 4BBQA 2MIQA 2YQMA 1WEUA 1JM7B 2EA6A 4WZ0A 3FL2A 1X4UA 2MUMA 2VPGA 5H1TA 4B7YC 4MVTA 5KH7A 4LJNA 2HYED 2VNFA 2NAAA 4CCGX 3HCSA 4A4BA 5B76A 2RI7A 4FK5A 4A49A 5TDWA 4IC3A 2Y43A 2CKLA 1XWHA 1WEVA 3MHSA 2ECTA 4UP5A 4TKPB 2F6JA 3LQIA 2QIZA 4ZQLA 4AVXA 3KNVA 3C5KA 3ASLA 4ZUXU 5H9MA 4Q6FA 2KREA 5AIUA 2KR4A 3N9NA 4GNEA 5J3XA 2ECWA 2VJFB 5KH3A 1FBVA 3EB6A 4XI1A 1WEPA 2PNXA 3RPGC 5JG6A 4LLBA 2LQ6A 3T7LA 4PTBA 2AN6A 2YHNA 1X4JA 2YHOA 2C2VS 3N9QA 4PPEA 4WZ3B 4BHWA 2CKLB 4WZ2A 3N9LA 4ZDTA 2ZETC 4GNGA 2G43A 1LDKC 2PUYA 2F42A 4V3LC 2I50A 1BORA 5B79A 4V3KC 4WA6A 5TBNA 1MM2A 5D1KB 4NN2A 1Z60A 1K2FA 2FSAA 2MNZA 5DKAA 4LK9A 2CSYA 2ECGA 3U5PA 2M1RA 2LGVA 2YQLA 2LV9A 3O7AA 3N9MA 2F6NA 2JMDA 3U5NA 1IYMA 5G05B 3PUQA 2EODA 2KE1A 3N9PA 3KV5A 4YBMA 2G45A 1WEMA 3RPGB 2MD8C 5D1MB 3KQIA 2M85A 3M62A 1MM3A 5FB0A 2G6QA 3DQVR 2CSZA 4W4UA 2KYUA 4FJCA 1VYXA 1Z2QA 2ECIA 1WE9A 2ECNA 1WEWA 2KWKA 4YABA 2BAYA 4YBTA 2ECVA 5C11A 3O36A 4P5OB 3MHHA 1E4UA 5TRBA 2HDPA 1JOCA 2KWOA 4FIPA 3GL6A 3PURA 4X3GA 2Y1MA 2LXHC 5FERA 5TABA 2YURA 2KIZA 2QICA 5DINA 3LQHA 4FO9A 2OXQC 5LKXA 1WESA 2K17A 2VPDA 2KWJA 2L80A 2XEUA 4AYCA 1FP0A 2FUUA 5KH9A 2MD7B 5LKUA 4AUQB 1RMDA 2IDAA 5FB1A 2FUIA 2YU4A 2L0BA 5H1UA 1WEQA 1X4IA 2YYRA 5AITA 2LGKA 3ZYQA 2MNYA 3L1ZB 3C6WA 2VP7A 2JMJA 4MSXA 2H0DA 1WFKA 3I2DA 1WENA 2ECJA 2L75A 4S3OC 4LADB 3VK6A 4UP0A 2K1JA 4I7CA 1V87A 5LCWB 1N87A 3V43A 4LKAA 4AYCB 1VD4A 1WIMA 3SHBA 1VFYA 2VPBA 3EB5A 4QF3A 3N9OA 4QF2A 1T1HA 4A0CD 3O34A 3L11A 5LKTA 1WILA 5EYAF 4L7XA 2MA5A 3O37A 3ZVZB 1DVPA 2H0DB 2JMIA
chains in the Genus database with same CATH superfamily
2RSDA 3ZNIA 2VJEA 2L43A 2EGPA 3M7KA 5G0FA 4R2YA 1HYIA 2JRJA 2E6SA 2KU3A 3LRQA 1HYJA 2YSJA 3M99A 3SOXA 5B78A 4YBSA 2C2LA 4YAXA 2VJFA 3FEHA 4L58A 2DJAA 3GV4A 2M13A 4A4CA 3IHPA 5B75A 5SVIA 1F62A 2MA6A 1G25A 2D8SA 2YT5A 4YC9A 5D1LB 2YREA 2QJ0A 4YATA 3ZVYA 3LQJA 4IC2A 4R8PK 4S3OB 5H1VA 2UZGA 2KGIA 3QZVA 3ZTGA 3KV6A 1MBMA 2LDRA 2VJEB 2KWNA 4N4FA 4YADA 2LXPC 4AP4A 3Q1DA 3L1XA 4GNFA 3O35A 3M63A 4C9ZA 3SUBA 4I7DA 4QQ4A 3T6RA 4B86C 5SVIB 2M6MA 5B8DA 3SOWA 4UI9B 3LVRE 2E61A 3DPLR 3U5OA 3SOUA 2K4DA 1WEOA 4Z0OA 2YSMA 2KGGA 2LRIC 1CHCA 3U5MA 5G04B 5C13A 4F52B 2OWAA 1WEEA 3HTKC 5TDRA 5B77A 2DX8A 3O70A 2XB1A 5LKZA 1JM7A 2E6RA 4N3WA 2Y1NA 4O64A 3HCTA 2CT2A 2M3HA 2YUCA 1LDJB 4I7BA 2LN0A 4R7EA 2JM3A 2K16A 1U6GB 3RTRB 2L5UA 5FEYA 4GB0A 3HCUA 3PHDA 3ZPVE 2YW8A 1ZBDB 4CA1A 2LGGA 2MT5A 3NG2A 2KFTA 3O33A 3ZPV1 2EGMA 4GNDA 5I3LA 2VPEA 1WGMA 2XOYA 1Z6UA 2LGLA 4BBQA 2MIQA 2D8UA 2YQMA 1WEUA 1JM7B 2EA6A 4WZ0A 2CRWA 3FL2A 1X4UA 2MUMA 2VPGA 5H1TA 4B7YC 4MVTA 5KH7A 4LJNA 2HYED 2VNFA 2NAAA 4CCGX 3HCSA 3LVQE 4A4BA 5B76A 2RI7A 4FK5A 4A49A 5SVXA 5TDWA 4IC3A 2Y43A 2CKLA 1XWHA 5K3QA 1WEVA 3MHSA 2ECTA 4UP5A 4TKPB 2F6JA 3LQIA 2QIZA 4ZQLA 4AVXA 3KNVA 3C5KA 4OGCA 3ASLA 4ZUXU 5H9MA 3H7HA 4Q6FA 2KREA 2L7PA 5AIUA 2KR4A 3N9NA 4GNEA 5J3XA 2ECWA 2VJFB 5KH3A 1FBVA 2IQJA 3EB6A 4XI1A 1WEPA 2PNXA 3RPGC 5JG6A 4LLBA 2LQ6A 3T7LA 4PTBA 2AN6A 2YHNA 1X4JA 2YHOA 2C2VS 3DDTA 3N9QA 4PPEA 4WZ3B 4BHWA 2CKLB 4WZ2A 3N9LA 4ZDTA 2ZETC 4GNGA 2G43A 1LDKC 2PUYA 2F42A 2YVRA 3KDEC 4V3LC 2FD4A 2I50A 1BORA 5B79A 4V3KC 4WA6A 5TBNA 1MM2A 2FFWA 5D1KB 4NN2A 1Z60A 1K2FA 2FSAA 2MNZA 5DKAA 4LK9A 5SVYA 2CSYA 2ECGA 3U5PA 2M1RA 2LGVA 2YQLA 2LV9A 3O7AA 3N9MA 2F6NA 2JMDA 3U5NA 1IYMA 5G05B 3PUQA 2EODA 2KE1A 2RR4A 3N9PA 3KV5A 4YBMA 1WEMA 2G45A 3RPGB 2MD8C 5D1MB 3KQIA 2M85A 1DCQA 3M62A 1MM3A 5FB0A 2G6QA 3DQVR 2CSZA 4W4UA 2KYUA 4FJCA 1VYXA 1Z2QA 2ECIA 1WE9A 3JUEA 3O47A 2ECNA 1WEWA 2KWKA 4YABA 2BAYA 3FAOA 4YBTA 3FM8C 4H9DA 2ECVA 5C11A 2KKXA 3O36A 4P5OB 3MHHA 1E4UA 5TRBA 2DSMA 2HDPA 1JOCA 2XOCA 2KWOA 4FIPA 3GL6A 3PURA 4X3GA 2Y1MA 2CONA 2LXHC 5FERA 3MDBC 5TABA 2YURA 2KIZA 2QICA 5DINA 2XP0A 3LQHA 4FO9A 2OXQC 4Z0RA 5LKXA 1WESA 2CRRA 2JUNA 2K17A 2VPDA 2KWJA 2L80A 2B0OE 2XEUA 4AYCA 3DWDA 2P57A 1FP0A 2FUUA 3FANA 5KH9A 2MD7B 5LKUA 2LAUA 4AUQB 3FJUB 1RMDA 3LJUX 2IDAA 5FB1A 2FUIA 2CSVA 2YU4A 2L0BA 5H1UA 3LDYA 1WEQA 1X4IA 2KKYA 2YYRA 5AITA 2LGKA 3ZYQA 2MNYA 3L1ZB 3C6WA 2VP7A 2JMJA 2MKEA 4MSXA 3T9KA 2H0DA 1WFKA 3I2DA 1WENA 2XOZA 2ECJA 2L75A 4S3OC 4LADB 4O62A 3VK6A 4UP0A 2K1JA 4I7CA 1V87A 5LCWB 1N87A 3V43A 4LKAA 4AYCB 1VD4A 1WIMA 3SHBA 1VFYA 2VPBA 3EB5A 4QF3A 3N9OA 4QF2A 3PLWA 1T1HA 4A0CD 3O34A 4OGEA 3L11A 5LKTA 1WILA 5EYAF 3E2DA 4L7XA 2MA5A 3O37A 3ZVZB 2EXUA 4F1PA 1DVPA 2H0DB 2JMIA
chains in the Genus database with same CATH topology
2RSDA 3ZNIA 2VJEA 2L43A 2EGPA 5G0FA 4R2YA 1HYIA 2JRJA 2E6SA 2KU3A 3LRQA 1HYJA 2YSJA 3M99A 3SOXA 5B78A 4YBSA 2C2LA 4YAXA 2VJFA 4L58A 3GV4A 4A4CA 3IHPA 5B75A 1F62A 2MA6A 1G25A 2D8SA 2YT5A 4YC9A 5D1LB 2YREA 2QJ0A 4YATA 3ZVYA 3LQJA 4IC2A 4R8PK 4S3OB 5H1VA 2UZGA 2KGIA 3QZVA 3ZTGA 3KV6A 2LDRA 2VJEB 2KWNA 4N4FA 4YADA 2LXPC 4AP4A 3L1XA 4GNFA 3O35A 3M63A 4C9ZA 4I7DA 3T6RA 4B86C 2M6MA 5B8DA 3SOWA 4UI9B 3DPLR 3U5OA 3SOUA 2K4DA 1WEOA 2YSMA 2KGGA 2LRIC 1CHCA 3U5MA 5G04B 5C13A 4F52B 1WEEA 3HTKC 5TDRA 5B77A 2DX8A 3O70A 2XB1A 5LKZA 1JM7A 2E6RA 4N3WA 2Y1NA 4O64A 3HCTA 2CT2A 2M3HA 2YUCA 1LDJB 4I7BA 2LN0A 4R7EA 2K16A 1U6GB 3RTRB 2L5UA 5FEYA 4GB0A 3HCUA 3PHDA 3ZPVE 2YW8A 1ZBDB 4CA1A 2LGGA 2MT5A 3NG2A 2KFTA 3O33A 3ZPV1 5I3LA 4GNDA 2VPEA 1WGMA 1Z6UA 2LGLA 4BBQA 2MIQA 2YQMA 1WEUA 1JM7B 2EA6A 4WZ0A 3FL2A 1X4UA 2MUMA 2VPGA 5H1TA 4B7YC 4MVTA 5KH7A 4LJNA 2HYED 2VNFA 2NAAA 4CCGX 3HCSA 4A4BA 5B76A 2RI7A 4FK5A 4A49A 5TDWA 4IC3A 2Y43A 2CKLA 1XWHA 1WEVA 3MHSA 2ECTA 4UP5A 4TKPB 2F6JA 3LQIA 2QIZA 4ZQLA 4AVXA 3KNVA 3C5KA 3ASLA 4ZUXU 5H9MA 4Q6FA 2KREA 5AIUA 2KR4A 3N9NA 4GNEA 5J3XA 2ECWA 2VJFB 5KH3A 1FBVA 3EB6A 4XI1A 1WEPA 2PNXA 3RPGC 5JG6A 4LLBA 2LQ6A 3T7LA 4PTBA 2AN6A 2YHNA 1X4JA 2YHOA 2C2VS 3N9QA 4PPEA 4WZ3B 4BHWA 2CKLB 4WZ2A 3N9LA 4ZDTA 2ZETC 4GNGA 2G43A 1LDKC 2PUYA 2F42A 4V3LC 2I50A 1BORA 5B79A 4V3KC 4WA6A 5TBNA 1MM2A 5D1KB 4NN2A 1Z60A 1K2FA 2FSAA 2MNZA 5DKAA 4LK9A 2CSYA 2ECGA 3U5PA 2M1RA 2LGVA 2YQLA 2LV9A 3O7AA 3N9MA 2F6NA 2JMDA 3U5NA 1IYMA 5G05B 3PUQA 2EODA 2KE1A 3N9PA 3KV5A 4YBMA 2G45A 1WEMA 3RPGB 2MD8C 5D1MB 3KQIA 2M85A 3M62A 1MM3A 5FB0A 2G6QA 3DQVR 2CSZA 4W4UA 2KYUA 4FJCA 1VYXA 1Z2QA 2ECIA 1WE9A 2ECNA 1WEWA 2KWKA 4YABA 2BAYA 4YBTA 2ECVA 5C11A 3O36A 4P5OB 3MHHA 1E4UA 5TRBA 2HDPA 1JOCA 2KWOA 4FIPA 3GL6A 3PURA 4X3GA 2Y1MA 2LXHC 5FERA 5TABA 2YURA 2KIZA 2QICA 5DINA 3LQHA 4FO9A 2OXQC 5LKXA 1WESA 2K17A 2VPDA 2KWJA 2L80A 2XEUA 4AYCA 1FP0A 2FUUA 5KH9A 2MD7B 5LKUA 4AUQB 1RMDA 2IDAA 5FB1A 2FUIA 2YU4A 2L0BA 5H1UA 1WEQA 1X4IA 2YYRA 5AITA 2LGKA 3ZYQA 2MNYA 3L1ZB 3C6WA 2VP7A 2JMJA 4MSXA 2H0DA 1WFKA 3I2DA 1WENA 2ECJA 2L75A 4S3OC 4LADB 3VK6A 4UP0A 2K1JA 4I7CA 1V87A 5LCWB 1N87A 3V43A 4LKAA 4AYCB 1VD4A 1WIMA 3SHBA 1VFYA 2VPBA 3EB5A 4QF3A 3N9OA 4QF2A 1T1HA 4A0CD 3O34A 3L11A 5LKTA 1WILA 5EYAF 4L7XA 2MA5A 3O37A 3ZVZB 1DVPA 2H0DB 2JMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RSD A;  3ZNI A;  2VJE A;  2L43 A;  2EGP A;  5G0F A;  4R2Y A;  1HYI A;  2JRJ A;  2E6S A;  2KU3 A;  3LRQ A;  1HYJ A;  2YSJ A;  3M99 A;  3SOX A;  5B78 A;  4YBS A;  2C2L A;  4YAX A;  2VJF A;  4L58 A;  3GV4 A;  4A4C A;  3IHP A;  5B75 A;  1F62 A;  2MA6 A;  1G25 A;  2D8S A;  2YT5 A;  4YC9 A;  5D1L B;  2YRE A;  2QJ0 A;  4YAT A;  3ZVY A;  3LQJ A;  4IC2 A;  4R8P K;  4S3O B;  5H1V A;  2UZG A;  2KGI A;  3QZV A;  3ZTG A;  3KV6 A;  2LDR A;  2VJE B;  2KWN A;  4N4F A;  4YAD A;  2LXP C;  4AP4 A;  3L1X A;  4GNF A;  3O35 A;  3M63 A;  4C9Z A;  4I7D A;  3T6R A;  4B86 C;  2M6M A;  5B8D A;  3SOW A;  4UI9 B;  3DPL R;  3U5O A;  3SOU A;  2K4D A;  1WEO A;  2YSM A;  2KGG A;  2LRI C;  1CHC A;  3U5M A;  5G04 B;  5C13 A;  4F52 B;  1WEE A;  3HTK C;  5TDR A;  5B77 A;  2DX8 A;  3O70 A;  2XB1 A;  5LKZ A;  1JM7 A;  2E6R A;  4N3W A;  2Y1N A;  4O64 A;  3HCT A;  2CT2 A;  2M3H A;  2YUC A;  1LDJ B;  4I7B A;  2LN0 A;  4R7E A;  2K16 A;  1U6G B;  3RTR B;  2L5U A;  5FEY A;  4GB0 A;  3HCU A;  3PHD A;  3ZPV E;  2YW8 A;  1ZBD B;  4CA1 A;  2LGG A;  2MT5 A;  3NG2 A;  2KFT A;  3O33 A;  3ZPV 1;  5I3L A;  4GND A;  2VPE A;  1WGM A;  1Z6U A;  2LGL A;  4BBQ A;  2MIQ A;  2YQM A;  1WEU A;  1JM7 B;  2EA6 A;  4WZ0 A;  3FL2 A;  1X4U A;  2MUM A;  2VPG A;  5H1T A;  4B7Y C;  4MVT A;  5KH7 A;  4LJN A;  2HYE D;  2VNF A;  2NAA A;  4CCG X;  3HCS A;  4A4B A;  5B76 A;  2RI7 A;  4FK5 A;  4A49 A;  5TDW A;  4IC3 A;  2Y43 A;  2CKL A;  1XWH A;  1WEV A;  3MHS A;  2ECT A;  4UP5 A;  4TKP B;  2F6J A;  3LQI A;  2QIZ A;  4ZQL A;  4AVX A;  3KNV A;  3C5K A;  3ASL A;  4ZUX U;  5H9M A;  4Q6F A;  2KRE A;  5AIU A;  2KR4 A;  3N9N A;  4GNE A;  5J3X A;  2ECW A;  2VJF B;  5KH3 A;  1FBV A;  3EB6 A;  4XI1 A;  1WEP A;  2PNX A;  3RPG C;  5JG6 A;  4LLB A;  2LQ6 A;  3T7L A;  4PTB A;  2AN6 A;  2YHN A;  1X4J A;  2YHO A;  2C2V S;  3N9Q A;  4PPE A;  4WZ3 B;  4BHW A;  2CKL B;  4WZ2 A;  3N9L A;  4ZDT A;  2ZET C;  4GNG A;  2G43 A;  1LDK C;  2PUY A;  2F42 A;  4V3L C;  2I50 A;  1BOR A;  5B79 A;  4V3K C;  4WA6 A;  5TBN A;  1MM2 A;  5D1K B;  4NN2 A;  1Z60 A;  1K2F A;  2FSA A;  2MNZ A;  5DKA A;  4LK9 A;  2CSY A;  2ECG A;  3U5P A;  2M1R A;  2LGV A;  2YQL A;  2LV9 A;  3O7A A;  3N9M A;  2F6N A;  2JMD A;  3U5N A;  1IYM A;  5G05 B;  3PUQ A;  2EOD A;  2KE1 A;  3N9P A;  3KV5 A;  4YBM A;  2G45 A;  1WEM A;  3RPG B;  2MD8 C;  5D1M B;  3KQI A;  2M85 A;  3M62 A;  1MM3 A;  5FB0 A;  2G6Q A;  3DQV R;  2CSZ A;  4W4U A;  2KYU A;  4FJC A;  1VYX A;  1Z2Q A;  2ECI A;  1WE9 A;  2ECN A;  1WEW A;  2KWK A;  4YAB A;  2BAY A;  4YBT A;  2ECV A;  5C11 A;  3O36 A;  4P5O B;  3MHH A;  1E4U A;  5TRB A;  2HDP A;  1JOC A;  2KWO A;  4FIP A;  3GL6 A;  3PUR A;  4X3G A;  2Y1M A;  2LXH C;  5FER A;  5TAB A;  2YUR A;  2KIZ A;  2QIC A;  5DIN A;  3LQH A;  4FO9 A;  2OXQ C;  5LKX A;  1WES A;  2K17 A;  2VPD A;  2KWJ A;  2L80 A;  2XEU A;  4AYC A;  1FP0 A;  2FUU A;  5KH9 A;  2MD7 B;  5LKU A;  4AUQ B;  1RMD A;  2IDA A;  5FB1 A;  2FUI A;  2YU4 A;  2L0B A;  5H1U A;  1WEQ A;  1X4I A;  2YYR A;  5AIT A;  2LGK A;  3ZYQ A;  2MNY A;  3L1Z B;  3C6W A;  2VP7 A;  2JMJ A;  4MSX A;  2H0D A;  1WFK A;  3I2D A;  1WEN A;  2ECJ A;  2L75 A;  4S3O C;  4LAD B;  3VK6 A;  4UP0 A;  2K1J A;  4I7C A;  1V87 A;  5LCW B;  1N87 A;  3V43 A;  4LKA A;  4AYC B;  1VD4 A;  1WIM A;  3SHB A;  1VFY A;  2VPB A;  3EB5 A;  4QF3 A;  3N9O A;  4QF2 A;  1T1H A;  4A0C D;  3O34 A;  3L11 A;  5LKT A;  1WIL A;  5EYA F;  4L7X A;  2MA5 A;  3O37 A;  3ZVZ B;  1DVP A;  2H0D B;  2JMI A; 
#chains in the Genus database with same CATH topology
 2RSD A;  3ZNI A;  2VJE A;  2L43 A;  2EGP A;  3M7K A;  5G0F A;  4R2Y A;  1HYI A;  2JRJ A;  2E6S A;  2KU3 A;  3LRQ A;  1HYJ A;  2YSJ A;  3M99 A;  3SOX A;  5B78 A;  4YBS A;  2C2L A;  4YAX A;  2VJF A;  3FEH A;  4L58 A;  2DJA A;  3GV4 A;  2M13 A;  4A4C A;  3IHP A;  5B75 A;  5SVI A;  1F62 A;  2MA6 A;  1G25 A;  2D8S A;  2YT5 A;  4YC9 A;  5D1L B;  2YRE A;  2QJ0 A;  4YAT A;  3ZVY A;  3LQJ A;  4IC2 A;  4R8P K;  4S3O B;  5H1V A;  2UZG A;  2KGI A;  3QZV A;  3ZTG A;  3KV6 A;  1MBM A;  2LDR A;  2VJE B;  2KWN A;  4N4F A;  4YAD A;  2LXP C;  4AP4 A;  3Q1D A;  3L1X A;  4GNF A;  3O35 A;  3M63 A;  4C9Z A;  3SUB A;  4I7D A;  4QQ4 A;  3T6R A;  4B86 C;  5SVI B;  2M6M A;  5B8D A;  3SOW A;  4UI9 B;  3LVR E;  2E61 A;  3DPL R;  3U5O A;  3SOU A;  2K4D A;  1WEO A;  4Z0O A;  2YSM A;  2KGG A;  2LRI C;  1CHC A;  3U5M A;  5G04 B;  5C13 A;  4F52 B;  2OWA A;  1WEE A;  3HTK C;  5TDR A;  5B77 A;  2DX8 A;  3O70 A;  2XB1 A;  5LKZ A;  1JM7 A;  2E6R A;  4N3W A;  2Y1N A;  4O64 A;  3HCT A;  2CT2 A;  2M3H A;  2YUC A;  1LDJ B;  4I7B A;  2LN0 A;  4R7E A;  2JM3 A;  2K16 A;  1U6G B;  3RTR B;  2L5U A;  5FEY A;  4GB0 A;  3HCU A;  3PHD A;  3ZPV E;  2YW8 A;  1ZBD B;  4CA1 A;  2LGG A;  2MT5 A;  3NG2 A;  2KFT A;  3O33 A;  3ZPV 1;  2EGM A;  4GND A;  5I3L A;  2VPE A;  1WGM A;  2XOY A;  1Z6U A;  2LGL A;  4BBQ A;  2MIQ A;  2D8U A;  2YQM A;  1WEU A;  1JM7 B;  2EA6 A;  4WZ0 A;  2CRW A;  3FL2 A;  1X4U A;  2MUM A;  2VPG A;  5H1T A;  4B7Y C;  4MVT A;  5KH7 A;  4LJN A;  2HYE D;  2VNF A;  2NAA A;  4CCG X;  3HCS A;  3LVQ E;  4A4B A;  5B76 A;  2RI7 A;  4FK5 A;  4A49 A;  5SVX A;  5TDW A;  4IC3 A;  2Y43 A;  2CKL A;  1XWH A;  5K3Q A;  1WEV A;  3MHS A;  2ECT A;  4UP5 A;  4TKP B;  2F6J A;  3LQI A;  2QIZ A;  4ZQL A;  4AVX A;  3KNV A;  3C5K A;  4OGC A;  3ASL A;  4ZUX U;  5H9M A;  3H7H A;  4Q6F A;  2KRE A;  2L7P A;  5AIU A;  2KR4 A;  3N9N A;  4GNE A;  5J3X A;  2ECW A;  2VJF B;  5KH3 A;  1FBV A;  2IQJ A;  3EB6 A;  4XI1 A;  1WEP A;  2PNX A;  3RPG C;  5JG6 A;  4LLB A;  2LQ6 A;  3T7L A;  4PTB A;  2AN6 A;  2YHN A;  1X4J A;  2YHO A;  2C2V S;  3DDT A;  3N9Q A;  4PPE A;  4WZ3 B;  4BHW A;  2CKL B;  4WZ2 A;  3N9L A;  4ZDT A;  2ZET C;  4GNG A;  2G43 A;  1LDK C;  2PUY A;  2F42 A;  2YVR A;  3KDE C;  4V3L C;  2FD4 A;  2I50 A;  1BOR A;  5B79 A;  4V3K C;  4WA6 A;  5TBN A;  1MM2 A;  2FFW A;  5D1K B;  4NN2 A;  1Z60 A;  1K2F A;  2FSA A;  2MNZ A;  5DKA A;  4LK9 A;  5SVY A;  2CSY A;  2ECG A;  3U5P A;  2M1R A;  2LGV A;  2YQL A;  2LV9 A;  3O7A A;  3N9M A;  2F6N A;  2JMD A;  3U5N A;  1IYM A;  5G05 B;  3PUQ A;  2EOD A;  2KE1 A;  2RR4 A;  3N9P A;  3KV5 A;  4YBM A;  1WEM A;  2G45 A;  3RPG B;  2MD8 C;  5D1M B;  3KQI A;  2M85 A;  1DCQ A;  3M62 A;  1MM3 A;  5FB0 A;  2G6Q A;  3DQV R;  2CSZ A;  4W4U A;  2KYU A;  4FJC A;  1VYX A;  1Z2Q A;  2ECI A;  1WE9 A;  3JUE A;  3O47 A;  2ECN A;  1WEW A;  2KWK A;  4YAB A;  2BAY A;  3FAO A;  4YBT A;  3FM8 C;  4H9D A;  2ECV A;  5C11 A;  2KKX A;  3O36 A;  4P5O B;  3MHH A;  1E4U A;  5TRB A;  2DSM A;  2HDP A;  1JOC A;  2XOC A;  2KWO A;  4FIP A;  3GL6 A;  3PUR A;  4X3G A;  2Y1M A;  2CON A;  2LXH C;  5FER A;  3MDB C;  5TAB A;  2YUR A;  2KIZ A;  2QIC A;  5DIN A;  2XP0 A;  3LQH A;  4FO9 A;  2OXQ C;  4Z0R A;  5LKX A;  1WES A;  2CRR A;  2JUN A;  2K17 A;  2VPD A;  2KWJ A;  2L80 A;  2B0O E;  2XEU A;  4AYC A;  3DWD A;  2P57 A;  1FP0 A;  2FUU A;  3FAN A;  5KH9 A;  2MD7 B;  5LKU A;  2LAU A;  4AUQ B;  3FJU B;  1RMD A;  3LJU X;  2IDA A;  5FB1 A;  2FUI A;  2CSV A;  2YU4 A;  2L0B A;  5H1U A;  3LDY A;  1WEQ A;  1X4I A;  2KKY A;  2YYR A;  5AIT A;  2LGK A;  3ZYQ A;  2MNY A;  3L1Z B;  3C6W A;  2VP7 A;  2JMJ A;  2MKE A;  4MSX A;  3T9K A;  2H0D A;  1WFK A;  3I2D A;  1WEN A;  2XOZ A;  2ECJ A;  2L75 A;  4S3O C;  4LAD B;  4O62 A;  3VK6 A;  4UP0 A;  2K1J A;  4I7C A;  1V87 A;  5LCW B;  1N87 A;  3V43 A;  4LKA A;  4AYC B;  1VD4 A;  1WIM A;  3SHB A;  1VFY A;  2VPB A;  3EB5 A;  4QF3 A;  3N9O A;  4QF2 A;  3PLW A;  1T1H A;  4A0C D;  3O34 A;  4OGE A;  3L11 A;  5LKT A;  1WIL A;  5EYA F;  3E2D A;  4L7X A;  2MA5 A;  3O37 A;  3ZVZ B;  2EXU A;  4F1P A;  1DVP A;  2H0D B;  2JMI A; 
#chains in the Genus database with same CATH homology
 2RSD A;  3ZNI A;  2VJE A;  2L43 A;  2EGP A;  5G0F A;  4R2Y A;  1HYI A;  2JRJ A;  2E6S A;  2KU3 A;  3LRQ A;  1HYJ A;  2YSJ A;  3M99 A;  3SOX A;  5B78 A;  4YBS A;  2C2L A;  4YAX A;  2VJF A;  4L58 A;  3GV4 A;  4A4C A;  3IHP A;  5B75 A;  1F62 A;  2MA6 A;  1G25 A;  2D8S A;  2YT5 A;  4YC9 A;  5D1L B;  2YRE A;  2QJ0 A;  4YAT A;  3ZVY A;  3LQJ A;  4IC2 A;  4R8P K;  4S3O B;  5H1V A;  2UZG A;  2KGI A;  3QZV A;  3ZTG A;  3KV6 A;  2LDR A;  2VJE B;  2KWN A;  4N4F A;  4YAD A;  2LXP C;  4AP4 A;  3L1X A;  4GNF A;  3O35 A;  3M63 A;  4C9Z A;  4I7D A;  3T6R A;  4B86 C;  2M6M A;  5B8D A;  3SOW A;  4UI9 B;  3DPL R;  3U5O A;  3SOU A;  2K4D A;  1WEO A;  2YSM A;  2KGG A;  2LRI C;  1CHC A;  3U5M A;  5G04 B;  5C13 A;  4F52 B;  1WEE A;  3HTK C;  5TDR A;  5B77 A;  2DX8 A;  3O70 A;  2XB1 A;  5LKZ A;  1JM7 A;  2E6R A;  4N3W A;  2Y1N A;  4O64 A;  3HCT A;  2CT2 A;  2M3H A;  2YUC A;  1LDJ B;  4I7B A;  2LN0 A;  4R7E A;  2K16 A;  1U6G B;  3RTR B;  2L5U A;  5FEY A;  4GB0 A;  3HCU A;  3PHD A;  3ZPV E;  2YW8 A;  1ZBD B;  4CA1 A;  2LGG A;  2MT5 A;  3NG2 A;  2KFT A;  3O33 A;  3ZPV 1;  5I3L A;  4GND A;  2VPE A;  1WGM A;  1Z6U A;  2LGL A;  4BBQ A;  2MIQ A;  2YQM A;  1WEU A;  1JM7 B;  2EA6 A;  4WZ0 A;  3FL2 A;  1X4U A;  2MUM A;  2VPG A;  5H1T A;  4B7Y C;  4MVT A;  5KH7 A;  4LJN A;  2HYE D;  2VNF A;  2NAA A;  4CCG X;  3HCS A;  4A4B A;  5B76 A;  2RI7 A;  4FK5 A;  4A49 A;  5TDW A;  4IC3 A;  2Y43 A;  2CKL A;  1XWH A;  1WEV A;  3MHS A;  2ECT A;  4UP5 A;  4TKP B;  2F6J A;  3LQI A;  2QIZ A;  4ZQL A;  4AVX A;  3KNV A;  3C5K A;  3ASL A;  4ZUX U;  5H9M A;  4Q6F A;  2KRE A;  5AIU A;  2KR4 A;  3N9N A;  4GNE A;  5J3X A;  2ECW A;  2VJF B;  5KH3 A;  1FBV A;  3EB6 A;  4XI1 A;  1WEP A;  2PNX A;  3RPG C;  5JG6 A;  4LLB A;  2LQ6 A;  3T7L A;  4PTB A;  2AN6 A;  2YHN A;  1X4J A;  2YHO A;  2C2V S;  3N9Q A;  4PPE A;  4WZ3 B;  4BHW A;  2CKL B;  4WZ2 A;  3N9L A;  4ZDT A;  2ZET C;  4GNG A;  2G43 A;  1LDK C;  2PUY A;  2F42 A;  4V3L C;  2I50 A;  1BOR A;  5B79 A;  4V3K C;  4WA6 A;  5TBN A;  1MM2 A;  5D1K B;  4NN2 A;  1Z60 A;  1K2F A;  2FSA A;  2MNZ A;  5DKA A;  4LK9 A;  2CSY A;  2ECG A;  3U5P A;  2M1R A;  2LGV A;  2YQL A;  2LV9 A;  3O7A A;  3N9M A;  2F6N A;  2JMD A;  3U5N A;  1IYM A;  5G05 B;  3PUQ A;  2EOD A;  2KE1 A;  3N9P A;  3KV5 A;  4YBM A;  2G45 A;  1WEM A;  3RPG B;  2MD8 C;  5D1M B;  3KQI A;  2M85 A;  3M62 A;  1MM3 A;  5FB0 A;  2G6Q A;  3DQV R;  2CSZ A;  4W4U A;  2KYU A;  4FJC A;  1VYX A;  1Z2Q A;  2ECI A;  1WE9 A;  2ECN A;  1WEW A;  2KWK A;  4YAB A;  2BAY A;  4YBT A;  2ECV A;  5C11 A;  3O36 A;  4P5O B;  3MHH A;  1E4U A;  5TRB A;  2HDP A;  1JOC A;  2KWO A;  4FIP A;  3GL6 A;  3PUR A;  4X3G A;  2Y1M A;  2LXH C;  5FER A;  5TAB A;  2YUR A;  2KIZ A;  2QIC A;  5DIN A;  3LQH A;  4FO9 A;  2OXQ C;  5LKX A;  1WES A;  2K17 A;  2VPD A;  2KWJ A;  2L80 A;  2XEU A;  4AYC A;  1FP0 A;  2FUU A;  5KH9 A;  2MD7 B;  5LKU A;  4AUQ B;  1RMD A;  2IDA A;  5FB1 A;  2FUI A;  2YU4 A;  2L0B A;  5H1U A;  1WEQ A;  1X4I A;  2YYR A;  5AIT A;  2LGK A;  3ZYQ A;  2MNY A;  3L1Z B;  3C6W A;  2VP7 A;  2JMJ A;  4MSX A;  2H0D A;  1WFK A;  3I2D A;  1WEN A;  2ECJ A;  2L75 A;  4S3O C;  4LAD B;  3VK6 A;  4UP0 A;  2K1J A;  4I7C A;  1V87 A;  5LCW B;  1N87 A;  3V43 A;  4LKA A;  4AYC B;  1VD4 A;  1WIM A;  3SHB A;  1VFY A;  2VPB A;  3EB5 A;  4QF3 A;  3N9O A;  4QF2 A;  1T1H A;  4A0C D;  3O34 A;  3L11 A;  5LKT A;  1WIL A;  5EYA F;  4L7X A;  2MA5 A;  3O37 A;  3ZVZ B;  1DVP A;  2H0D B;  2JMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...