5I5IA

Shewanella denitrificans nitrous oxide reductase, app form
Total Genus 170
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
170
sequence length
571
structure length
539
Chain Sequence
VHPGELDEYYGFWSGGHSGEVRILGIPSMRELMRIPVFNIDSATGWGITNESKRIKGDSAHLMTGDSHHPHMSMTDGSYNGKYVFINDKANSRVARIRCDVMKTDKMITIPNVQAIHGLRVQKVPYTKYVICNGEFYRSLFNVIDAEKMEVAFQVMVDGNLDNTDADYDGKYFFSTCYNSERDHVVVFSLERCLAALKAGKFTNYNGNKVPVLDGRKGSDLTRYIPVPKSPHGINTAPDGKYFVANGKLSPTVSVVEIARLDDVFSGKIQPRDAIVAEPELGLGPLHTAFDNKGNAFTTLFLDSQIAKWNIQDAIKAYNGEKVNYLRQKLDVHYQPGHNHTSQGETRDTDGKWLVVLCKFSKDRFLPVGPLRPENDQLIDISGDEMKLVHDGPTFAEPHDCMIVHRSKVKPQKLWTRDDPMFADTVAMAKQDGVTLEMDNKVIRDGNKVRVYMTSIAPNFGMNEFKVKLGDEVTVVVTNLDQVEDVTHGFCMTNHGVQMEVAPQATASVTFIANKPGVQWYYCNWFCHMEMRGRMLVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Nitrous-oxide reductase
publication title Role of Calcium in Secondary Structure Stabilization during Maturation of Nitrous Oxide Reductase.
pubmed doi rcsb
source organism Shewanella denitrificans (strain os217 / atcc baa-1090 / dsm 15013)
total genus 170
structure length 539
sequence length 571
chains with identical sequence B
ec nomenclature ec 1.7.2.4: Nitrous-oxide reductase.
pdb deposition date 2016-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18764 nos_propeller Nitrous oxide reductase propeller repeat
A PF18793 nos_propeller_2 Nitrous oxide reductase propeller repeat 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i5iA02
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5i5iA01
2XU9A 4N14A 4E54B 1KBVA 1JXFA 2H9MA 3FSAA 6PAZA 4QQEA 2H68A 4E9WA 4JHUA 4E9QA 4AEZA 1X9UA 4L3GD 4FAVD 3BQVA 2J55A 3X2QB 3FU9A 3SBQA 4GZ8A 3FSWA 1JOIA 3TU6A 5B7FA 3AL8B 4J77A 2H9NA 2BHFA 5E9NA 2BBKH 4G72B 5HE3B 4AOWA 4ENZA 3U25A 3OKYA 4L0PB 5C9ZB 4U1EI 1IBZA 1J5DA 1PCSA 1SJMA 2HZHA 2PPEA 2ZOOA 4YVDA 5C2VB 1U2VC 3MMYA 2OV0A 2P9PC 3ABKB 1AZRA 3CDZB 3I7HA 4L3HD 4ZOVA 3DIVA 3DM0A 4O3TB 3T6VA 1R1CA 1NIBA 2J56A 5A2Qg 4JSXC 3X1GA 1P22A 3I8CA 1TU2A 3NJHA 3QPKA 5F7BA 1A65A 2R7EB 3MZKA 4X60B 1Q47A 1BYPA 5I6LA 5I6MA 1MDAH 2YBAA 2IWEA 3UR4A 4A09A 1OLZA 2XX0A 4HAKA 2NRDA 4FB1D 4YSUA 1OCRB 4DP4X 5I28A 3AG1B 5HE2B 4XEIC 3IJ1A 3NJKA 2LLNA 2N0MA 4F2EA 3S8GB 3UKUC 2XWZA 1XB6A 3NJIA 4KO5A 4YVNA 1ZDSA 2P80A 3IN2A 5B7EA 4JSVC 4BH6A 5EMJB 5EMLB 3AG3B 3OKYB 1ET7A 2YAHA 1RI6A 3V5WB 4PNKB 4PSWB 1XKSA 1SNRA 3FS9A 2H47C 1PF3A 2I0RA 4KNUA 4BUJC 2GNQA 1E5YA 2P80D 1SQJA 2UXGA 2P9SC 5FKRA 4G56B 4QT8A 3NJGA 1JERA 1GS6X 1B3IA 4QL1A 5H17A 2DY2A 4JXMA 1HFUA 4DPBX 4KOCA 3WNIA 1BAWA 1GS7A 2PPCA 5CXCA 5C2WB 1ADWA 2FQFA 2YAPA 3UVLA 4F2FA 2IUQA 2XYIA 2GB2A 3GREA 3UVNA 2ZONA 2J56H 1RCYA 3NP3A 3V9EA 2IUPA 1OOWA 4P5RA 1I53A 1GS8A 1OMWB 1KDIA 3CZUB 4GGCA 4U7AA 2G99A 4E9RA 5LDUA 4ERQA 4CSPA 3SFZA 1A3ZA 3AY2A 4XYIA 4CY3A 5CXBA 5I26A 1OE3A 4GP8B 2DYSB 1SQ9A 2CJ3A 4KOBA 2RACA 2EINB 1B9XA 2WO2B 5IJ7E 5FKTA 3FU7A 4A2FA 3EI3A 4BDVA 2YXVA 4O45A 4G7SB 1L9PA 1ZIBA 2VM3A 2YAMA 2IH9A 4GXFA 3IIYA 4J79A 4N4YB 1JVOA 4Q8BA 1L9RA 2PCFA 4K3ID 5EARA 2Z2OA 1W6WA 3FPXA 3PPSA 2I7OA 5B1AB 3ABLB 1N68A 2XUWA 3NP4A 1V55B 3EI4B 2EBSA 3SBRA 4GYBA 1KBWA 2I0TA 1CYXA 3L4OD 4J84A 4JD2C 5IT9g 3JT2A 4GM9A 3X1NA 1MG2C 4E5ZA 1SHXA 3EH5B 2GBAA 2Q5BA 1JMXB 1JZGA 5I5IA 2HLEB 2AGWA 5EMMB 3F3PA 2BWDA 4RH4A 2IWKA 2UX6A 2HKRA 4ZOZA 2CE8A 1W6LA 1W8EA 2VMJA 4L1QD 3SMRA 3X1BA 3OL2A 1PLBA 3AH8B 4CI2A 4E54A 3NT0A 1PAZA 3L45A 1IKOP 3UKRC 1MZYA 4IA9A 2FJSA 3K27A 1XB3A 3J81g 4CY2A 2OK6A 4CZXA 1PEVA 3SVWD 2TSAA 2H6QA 3FSZA 3EI3B 3I7OA 4FA4D 2GIMA 3FT0A 3AG2B 4KNTA 3SQRA 1NPJA 2GC4C 2AANA 3KW7A 1AS6A 3NJJA 1HAWA 2IDUA 3FU8A 2YXWA 4PSXB 5H1MA 1ETJA 4E9XA 2P9LC 3KRXB 3QJRB 1TKWA 1N6FA 2BP0B 4KO6A 5B1JC 3WNJA 2B3IA 5I6NA 3IIWA 4ERZA 4CI1A 1ASQA 4FA9D 4OWRA 3MBWB 1JZFA 4A2EA 3CDZA 2OJ1A 2I3TA 3RN1D 1WA2X 4DP0X 3N0DA 1RKRA 3CIKB 3DSMA 4PXWA 4FA5D 2CO0C 2GHZA 1KDJA 1K8KC 4O3UB 2PPFA 2YAFA 2WSDA 2H9LA 4CY1A 4J78A 2UXFA 3PXLA 4M3HA 3OL2B 2R7EA 3NSCA 4GP5B 2HX8A 4WTQA 4YSOA 5FLXg 5EALA 5TDHB 4A2LA 1AG6A 3DXMC 2FTAA 1IUZA 1FA4A 2YB8B 3RFGA 3IN0A 5FKQA 3FYIB 3SBPA 1WS7A 3T6WA 2H3XA 5KDOB 4YSRA 1DZ0A 2UZYB 3C5MA 2PLTA 2GSMB 5IGOA 4LGNA 1VLXA 2BW5A 4J87A 4GGAA 3WKPA 2Y69B 4AKOA 1J9SA 4HHWA 4GP4B 2B4EA 1GY2A 3MXXA 3RFHA 1AAJA 3PSCB 3CVBA 4A7JA 3KRWB 3EH3B 3TBBA 3EMHA 4NSXA 2HESX 4D0KA 1CC3A 3CFSB 4E9VA 2XVBA 4TXVB 3V9CA 2AGLA 5K19A 6PCYA 4E9SA 2QC5A 3FM0A 4UAHA 2QXVA 4DP7X 2XV2A 3ASOB 3T6XA 4QLWA 3A0FA 3FGBA 3GYRA 3CVDA 4K9JA 5TK4A 2BW4A 4NB7A 2QPEB 1A4AA 1AQ8A 3EI1A 4KNSA 4HDJA 1ZPUA 1PZAA 3C9CA 2B5LA 5HE0B 1GXRA 1NTDA 3EF4A 1J5CA 5GMKn 1QHQA 1L9TA 2CN3A 3PAUA 5I5MA 5EM2B 3OD3A 1OV8A 3UVMA 3MZLA 4DP9X 4HZ1A 1PY0A 2HX9A 3EG6A 1OCOB 4Y5RD 1GOTB 4PBYA 4E9YA 4HCFA 5AFU3 2J55H 4J0WA 2XV3A 4A2GA 4LG9A 1M9WA 1JXGA 2BWIA 3J80g 4FAAB 1PBYB 1AANA 2H13A 3V9FA 5B1BB 2PM9B 1GSKA 3EWEA 2AGYA 4FHLA 5B1KA 2OVPB 2J5WA 4QRJA 1J9TA 2IUVA 4PAZA 2W88A 3EU7A 1ID2A 4ERYA 2G9AA 2GC7A 2I3SA 1PNDA 1EZLA 1KYAA 2FQEA 4A67A 4GM3A 3EI4A 2IWFA 1ASOA 1NIAA 3N2JA 3WIAA 4F7KA 5HQGA 2OCCB 2GC7C 1FWXA 1JVLA 1JOFA 3BWSA 3EI1B 2AGZA 5PAZA 2YAQA 4YSPA 2CCWA 3OQRA 3IJ0A 3I8EA 3JZGA 4PC0A 2FQGA 1XIPA 4QKTA 1GY1A 2OVRB 4YSAA 2Q7QA 5CYKB 3SCYA 1QLEB 1L0QA 2HXCA 4J81A 9PCYA 2A3TA 2AH0A 4BWTA 4E9TA 1GR7A 3QJUB 3PXSD 2VSMB 7PCYA 4GQ1A 1L9SA 2IAAA 5D4JA 2YNOA 1T5KA 2PCYA 4CC9A 4HCGA 1OCCB 2XL2A 3ASNB 4G70B 5TEFA 4A66A 2JXMA 5I5JA 2IURA 1AZUA 3EHBB 1MG3A 2Z2NA 1AZNA 1SFDA 4H5JA 1YLBB 4A0BB 2B5MA 2BP0A 1ASPA 1E67A 2XV0A 1B9YA 1ILUA 4BXSV 1HAUA 1KCWA 3OMIB 2H14A 4GQBB 3PSLA 1TEFA 1NR0A 4JT6C 1CURA 2P9IC 2FWLB 2P9KC 1WA0X 1ILSA 3QJQB 4AI7A 3MKSB 3OTTA 2OVQB 4YSDA 3NSFA 3UAEA 1NZRA 3ULEC 5FA5B 1E5ZA 1KV7A 1N70A 3BG0A 4W1TA 3SXTD 3NJLA 3X1FA 3NJMA 4PBZA 4YSEA 1ERJA 1TYQC 5FKSA 4A2MA 2IDQA 4ZOYA 1JJUB 3PE7A 2EIKB 1JMZB 7PAZA 4GGDA 2P9UC 5AMSA 2AZUA 3JPXA 3T6ZA 1A4BA 3AW5A 4J8GA 5GXIA 4J8BA 3FPYA 1KCBA 4AZUA 1AACA 3PVUB 1SF5A 3PLYA 1V10A 2HXAA 2YNNA 4J86A 2QT6A 2FT7A 1JXDA 4IMMA 2I7SA 3U4YA 3PCYA 4M4RB 3AG4B 5AKRA 1NICA 1PLAA 2HRGA 2WO3B 3TA4D 5IC7A 1OE2A 3PVWB 3ABGA 3WI9A 3JROA 4O1QD 4Y7RA 1SFHA 5A7EA 4A08B 4DP8X 2YAOA 4G7RB 3EI2B 4EWRA 2PPAA 3T9WA 4CSZA 3RYMA 2B08A 2H6NA 3UACA 5EAPA 4A11A 2UZXB 1JZHA 3JTBA 1JZIA 3OKWA 3OKTA 3FQYA 4Q89A 3JZNA 4DP1X 1GW0A 3C99A 1OF0A 1CYWA 3S8FB 4KO9A 2BZ7A 3NJNA 1XB8A 2AZAA 2FT6A 4YVUA 3NYKA 2VSKB 4DP5X 3IKOA 4JSPC 3JAMg 3VA6A 1FFTB 1R5MA 3HEIB 5EM2A 2XXFA 2X88A 4UANA 1KGYE 1SHWA 1SHYB 5FXYA 3NSDA 1OE1A 1AZBA 1SDDA 3IE9A 3NSYA 3K26A 1L9OA 2GI0A 4JSNC 4ZK8A 4TZ4A 2VM4A 1BYOA 3H56A 1L9QA 2Q9OA 3SWSD 2X87A 3RSEC 3SHFA 3GFCA 4ES0A 5FC9A 3T71A 1NIFA 2H3XC 1BQRA 2AH1A 1BEXA 2PM9A 1ZIAA 2OIZA 4J82A 4BK5C 3ZDWA 4CI3A 2PM7B 4HHGA 1MDAA 3OMNB 3PAZA 5HYNB 3F3FA 4A11B 1NWPA 2JKWA 2IDFA 3RN0D 1PI6A 2VN3A 1BQKA 5AFAA 2QDVA 1M57B 2YAEA 3ZX1A 3RMZD 5IJ8E 2EILB 1GYCA 3GXUB 4J73A 5EAMA 3TASA 2YQBA 4FWWA 4ESGA 2FT8A 2IDTA 5TF2A 1A4CA 2HJ4A 3PXTD 5GSAA 4H5IA 3SN6B 5CYKA 2BP8A 4CY5A 4YSQA 3RLMD 1SDDB 3DXKC 4GM8A 1IC0A 3N0EA 1CUOA 3ABMB 3I7NA 1MZZA 1GP2B 4OZUA 2H5UA 4AKPA 4KFMB 4JT5C 3ERXA 4A68A 5TEEA 1WAEA 3S3BB 4FA1D 1JZJA 3IEAA 4N8UA 5FQDA 4AKQA 3FYEB 5EHFA 2W18A 4BWUA 4AX3A 3BG1A 4A0AB 4ZN4A 3DTUB 3MX0B 3AL9A 4YL4A 3JZHA 2UX7A 4G71B 3NVNA 4A0BA 2EIMB 4DPAX 1RZQA 4P5SA 5EMKB 3JRPA 4LG8A 3UVKA 3F3GA 2ZWNA 5AZUA 2VW6A 2Z2PA 4CZVA 2FQDA 3H4FA 3RRMC 2BO0A 3ORVD 1QNIA 3AFCA 3H4HA 2AGXA 4CI8A 1JZEA 2IH8A 3CFVA 5K1CC 2HYEA 5D4IA 2H47A 3FRXA 1NDTA 2PPDA 2CE9A 2CN2A 3JB9L 2BP8B 3NJFA 4GMBA 4NERA 2AQ5A 1PLCA 4JKNA 1TEGA 1NWOA 3BVDB 4KO7A 1N6EA 2PBIB 3DWLC 4K3JB 1PMYA 3UABA 2AVFA 3DKHA 4DP6X 1AS7A 1U4CA 1NIDA 3VH0A 2PP7A 2H9PA 1IBYA 2IAAC 2PP9A 1ET5A 2YARA 4JHVA 3I2NA 1A8ZA 2BZCA 4FA7B 1N6DA 3IJCA 5H14A 4CZYA 1F56A 4A08A 3NVXA 5B7MA 2DYRB 3IBOA 4GQ2P 4YSCA 1VYHC 1XHMA 2J57G 1AR1B 5D4HA 1PGUA 2CNXA 2IDSA 2TRCB 2DV6A 4X63B 2W8CA 2XX1A 2YNPA 4DP2X 3EI2A 2UXVA 3ZBMA 3WKQA 1MG3C 4A09B 1J9RA 8PAZA 1V54B 3V7DB 1XMEB 3WG7B 4X3EA 3ZWLB 4W9ZA 5B3SB 1NINA 2OJYA 2MTAA 3UAAA 3ODTA 1RZPA 2PP8A 1ET8A 2VW7A 1WA1X 4HALA 5F7AA 2HX7A 4EF3A 1ZV2A 1BXAA 5PCYA 3VGZA 5I6OA 1PZBA 2CUAA 1NIEA 2EIJB 4D6VA 1EHKB 3GDCA 4YSSA 3HB3B 5THAA 1J9QA 2I85A 2PM6B 1AZCA 2FNWA 3OMAB 2YMUA 1NPNA 3W15A 4UF7C 3MKQA 3CG8A 3C75A 4A2HA 3SLED 3D12B 3FQ1A 4NAJA 2AFNA 1S4UX 2ZXWB 1BQ5A 1NEXB 2CBPA 4BWWA 2JFCA 4X4KA 3QQXA 3QJTB 4BL0A 4Z8LA 3I89A 1MG2A 3UVOA 2XYBA 4MFHA 5ANHA 1UATA 5CXCB 3CVCA 3G5WA 5HE1B 4HIPA 4R7AB 1BXVA 4PCYA 3UADA 3ZIYA 4WKXA 2XL3A 3P4FA 5B4WA 4ZOXA 4DPCX 4I79A 2J57A 3QJSB 5GXHA 2Y1AA 1AS8A 3OW8A 5CXBB 3S3CB 1AG0A 2TSBA 1X9RA 1YFQA 2CAKA 1GG2B 5IY5B 3S3DB 4BXVA 2GC4A 2P9NC 3NVQA 2VW4A 2XXGA 3UGEA 3EH4B 5I6KA 2MTAH 2O9KA 2OK4A 3FU7B 2XU7A 2HKMA 4BDVB 4UI9R 1URIA 2DWTA 4GY4A 4HCIA 2HJBA 2MRYA 5B1JA 2QDWA 3AL8A 3E0CA 4A2DA 1PNCA 3PXWD 1M56B 3PAVA 3HFQA 5IGQA 4L9OA 3B7FA 1K32A 4G7QB 3FSVA 3SJLD 2H6KA 3N55A 2B5NA 2I0SA 2XLLA 5TK2A 2DWSA 4O9DA 3C75H 2CALA 4YSTA 1SF3A 2UXTA 2CO0A 3I7KA 2BCJB 3L4MD 5JWZA 1DYZA 1BXUA 4FAND 2HRHA 5AJAA 3AZUA 1E30A 4MK0B 1ZDQA 1AOZA 3FQ2A 2E86A 3KW8A 4E5ZB 1TBGA 3OM3B 1PZCA 1E65A 3X1EA 1OCZB 1A0RB 3I7LA 4J0XA 1AIZA 3I7PA 3TBCA 5I6PA 4X61B 1WS8A 4XYHA 3QJVB 5SXMA 4A0AA 2QPDB
chains in the Genus database with same CATH superfamily
3RPBA 2UY7A 2VDNA 1KYFA 4D0CB 3V0FA 4LKCA 4MDIB 4N2HA 2YQGA 1QPXA 3GI8H 3ZTEA 2H9MA 5EORL 4HQQL 5EUKA 1YHPA 2Z4TA 4JHUA 3ULUC 1IQDA 3P3TA 4J3TA 3NZUA 1AI1H 1YMHB 2ICWB 4K94C 3TO4B 2Y1YA 2AITA 4GXUN 5ECJE 4X5QA 1OAQH 3ALPA 3AL8B 2YRLA 4YHNA 5AOZA 5LXGL 3H9HA 4JRYE 3W5MA 2WHVA 2VE6B 5C0AA 2IJ0C 3MUUA 4JM2F 1U2VC 1AZRA 2CGRH 3V5KA 4F3FA 3INOA 5C0AD 4FNLL 1JZ6A 3DIVA 2XZQH 2CO2A 1ZEAH 2E7DA 3C8KB 2VKWA 2JJTC 2W07A 3QEGL 4TLSA 4PW4A 2DLTA 1FIGH 1Q9LA 5FUOL 4JB9L 4N26A 2E9IA 3B2DC 4PREB 5HJ3B 4F92B 4X60B 3FO0L 4OD3H 5AAPA 3QO0A 1WFUA 3GSNH 1K3IA 4QD2E 4JFHD 5E8DL 4Q4IA 3L3HA 4NNPL 5JIKA 1OARL 4TQIA 4YDJB 2AXJA 5I19L 1RI6A 2E9BA 5E6SA 5T1DH 5DHVH 3KCIA 2VQ4A 4M1CD 2DYPA 5EU4A 2GITA 4GEIA 4LP8A 2HPOA 3D05A 2CRMA 3QR1A 4L0ZA 5CKGA 3WJMA 4J3VA 1BZOA 2IPKA 2VLKA 3UPRB 2NY3C 2YD1A 2DYPD 2Z31B 4C4KO 2OA9A 3KLAA 2OX5A 4OGAD 2ZYRA 3SYAA 1F97A 4QXUL 5HI4C 3OXRB 4RMVA 2FEDD 3QZMA 3NGBB 5E4EB 1HN1A 3CFKA 4ZW6A 5MI0B 3M7OA 5EBWB 1FFOB 2ZCLL 1U3ZA 5LVEA 2CZNA 4TOYL 4NZRH 2YXVA 4LVOC 2P3YA 2ZT9C 3O2DH 3P3RA 1MIML 5HI5D 3SQOH 1A7NL 4F8LA 5LCVH 3QQ9C 3PWLA 1W6WA 1HEHC 4A55A 2OFQA 4C83A 5LWYL 1RPKA 4PIRF 3MFFB 1NOAA 3O2WH 2G3MA 3BZFA 2NT0A 3DJZA 4NZ8A 4UNTA 3ZDZA 1G1OA 1ZSDA 4WEEA 1MG2C 2JMRA 2YUXA 3G08A 2B2XL 5I8KL 4RFEA 1L0PA 1IGTB 4Y4FA 4ZDHA 4FYRA 4XAKE 1YEEH 2CSPA 1J0HA 1I7RB 2J71A 5IFHL 2HKRA 4NAQA 1K4CB 3VACA 4K7PH 2W59A 4GO8A 5CR1A 4Z7UF 1GCFA 3TCTA 1RVFH 4I3RL 4HWZB 3PGCA 4FJYA 2H6QA 1YN7B 4AJVA 1JTPA 3I7OA 2CGZA 2HG5A 4XNXL 4KNTA 5AG8A 3NPSC 1GAFH 1N64H 5ICUA 1OWRM 5FUCE 2K6YA 1HC1A 1H3GA 3QJRB 4CMMB 2ATAA 4XBPA 2AV1A 4WO4C 4RESB 1F6AA 5J3HC 4BH8B 4KUCD 4XB7A 4ZUVB 1AH1A 4NQEE 1JZFA 2Z91A 2I3TA 2HFGH 4R7XA 3F83A 4GH7B 2AV7A 4OF3A 3HHSB 1SMOA 4J78A 4NO0B 4APQD 2EICA 3BQUD 3HE7B 4GRLB 2GJPA 4L8BB 1XCQA 3WSQL 5EALA 3FBQA 4Z7OE 3WTXA 4DP0X 2Z9TA 4BELD 3DXMC 3M86A 5CD3A 3K74B 5FKQA 5DK3A 4RDQF 1PGRB 1UT9A 1NMCB 5HVHB 1H9DA 4IRJC 3OKMB 2ICEC 5C0BB 1MRDH 1KIUB 4LCWB 2XWTA 3Q2VA 3CXDH 3BPCA 1UC6A 4I2XA 4OSUH 5E6IA 4J87A 4I3SH 1CLZH 4WK2B 3RL1A 3HLKA 3IRCA 1K6QH 4J1UB 1E9OB 1TJMA 4DHLA 3PSCB 3VFMA 3CFSB 1AZZC 2AGLA 2WQSA 5KS9F 4C56B 4XVOA 4WK0A 4DP7X 1I75A 3QJFB 3T6XA 1WHPA 2R4SH 1TQBB 3CVDA 2WPGA 1NQBA 4NB7A 4HC1L 4JZJC 4E42B 2I25N 4X5LA 3R8QA 3SGDH 2NY5L 2E3VA 5T1JA 3CHQA 3UTTB 5CSZA 2VITA 3GKZA 3RWJB 4ZAKA 3D9AL 1SYSB 1U8HA 1SXNA 2C1PA 5IBLC 5EM2B 2EYRA 4N2BA 2ZUTA 2YRZA 1ADQA 2MCPL 2HKHL 5AW3B 3MZLA 1UWFA 4AWJC 4PGCA 4AYGA 4Y5RD 5BZWA 1XX9C 3BJLA 4N8VA 4NPYB 4JGUA 4ZAKD 1CT8A 1UURA 5HYEA 1OP5K 2GK2A 4G2AA 1KENL 4Y4KC 2WVVA 2X4NB 3GK8L 3QS3A 2X4TB 3FN3A 12E8L 1AANA 2XKNA 2BY0A 4NUPA 2YD3A 1BCIA 1WCQA 5HGHA 3WHXB 2CKNA 5TFSH 3GSNB 3GXFA 1IBGH 1TO5A 1NSNL 3MRCB 4D9SA 1L5GA 1KYAA 5ESQA 1I9JH 1NIAA 1JNNL 5GGRY 4D0DA 5JQIB 5DMGC 2D7QA 2XA8L 4PJ6A 3QORA 4ZUTB 1QPPA 2ZXQA 4ODHH 4MCYB 3WXWH 4J8RB 4Y1TA 4BGDA 3C5XA 1T0MA 4X4XB 3VXMB 5D2LA 4KK9D 1N10A 3N06B 1QO3B 3OR7B 2Z7WA 1BZDA 1YJDL 3VE0A 4P0DA 3H3BC 4RISL 3EJJX 3FT3B 1D7FA 4ZD3L 4ISVA 3PP3H 4L4VB 2PO6D 2IPTH 5TQ2H 1OGAE 2CIIB 4YJZL 2UZXA 4P57B 3W38A 1ZHNB 3CBJB 3UAJA 3I84A 4U4BA 3FXIC 4AT6B 1NEUA 1BFOA 4MZ3A 1I7ZB 1T83C 5E8NA 2O61B 4AIEA 3HG1B 4XOEA 5DRWA 3VTMA 3HPLA 5L7XL 3GZQA 1DSFH 3TJHD 1ICTA 1SF5A 3QQNA 3PVUB 2NY6B 2YNNA 2P52A 2VMCA 5HVFB 2A6DB 2BY1A 3APDA 2QV2A 5CO1A 3MRMA 2I7SA 4LAQL 2LU5A 3G6DL 3E8UL 3EYQD 4ODBD 5MENB 2QEJA 2YSTA 1IGIL 4PBDA 3KPNA 4JPKH 1NDMB 1URLA 2FB4L 3Q13A 2KPWA 4RVBA 4D9QD 2PW1A 3OBAA 4NIYE 3RTQC 2ZYSA 3MCYA 2KDGA 4KI5E 4N0YH 4AEHH 3BVTA 4DIXA 2F74A 1I9RL 2BMKA 1EAOA 4RFNC 3NYKA 1RIUL 3IKOA 3KWWA 1I2MB 4LEOB 1FFTB 3H2QA 5DWPA 5TPWH 1Z32X 2IANB 2X88A 4QT5A 3CDGB 1VKXA 2P8MB 3CLEH 3IETB 1SDDA 2BOLA 1Q72H 2NUPB 3KYAA 3QJHB 5CMAB 3V0EA 4L3EB 4OZGA 2MHAB 4TZ4A 4UDUB 1NANH 4G6AC 3AREC 1EJ6A 3ZDXE 3D39E 1YYCA 4LKXB 1A0QH 1YEWA 3H85A 4NQVA 2CO1A 3RJQB 1CFTB 3ZQXA 4J82A 3HN3A 4LRNH 3VI3A 3GMNB 1MRCH 3HE6A 1CE1H 1IZKA 2XPGB 3V4VB 1NGYB 4FG2A 3GMRA 1Z9SB 3RIAK 3WJJA 4M48H 5DRZB 4OZHF 2R0LH 3HE6D 4O2FA 4FEIA 4CN4A 5C71A 1TYEA 1UD4A 3CN0A 5DZOA 1CXEA 1XIWB 4JY6B 4LLYA 2XA3A 4PI0A 4CY5A 3C09B 4OGZA 4AN0A 1IC0A 5DVKA 3FUEA 4L1SA 2ZG3A 5BMFH 2A9NH 5IVZB 3GEWB 4PJDA 1QX1A 5C08B 3L4VA 1P84K 3VXPB 3NRPA 7TAAA 1SEBA 5IGOA 5I73B 4PVMA 3Q7JA 4KK6D 3VGAB 5I73C 1FYHB 1OLLA 3V0JA 3OGCB 1DQIA 1RZQA 2BFVL 2W38A 3GLDA 3MRNA 1WT5C 3CC5A 3VX1A 5AAMC 2AK4A 3NJXA 3BVWA 4Y16B 1E9QB 2VAAB 2NUTA 2AK1H 2R23B 5C6TL 4LSPH 1HHHB 5IB4B 1KTDB 3RU8L 1HESA 1EVUA 5C6WH 3FRXA 5GGQH 5F8RC 2DQUL 4XC1H 3NJFA 4LL9A 4BH7B 5IROC 3GMMB 4CU7A 1TEGA 5KSBB 4XBEH 4AQ1B 3Q44A 5A3ID 3UZEC 2ALAA 3GPSA 3RWFB 3V4UH 2IAAC 1ET5A 3W37A 4ZQTA 2GBVA 3VB9A 5IWLA 3SKUD 4A08A 3L3OB 1BVNP 2P46B 5HYJE 1V3MA 5D4HA 4GI8A 5TDPB 3FB8A 3VQ1C 3EI2A 2W8CA 4ZTOH 1T1YA 4DP2X 4QF1B 5C0NC 1XH1A 3N43F 4PG2A 1TTAA 3SCMA 1Q94A 3WG7B 4OY9A 3D18B 5H4YA 3ODTA 2B4CL 5I6OA 3DOIA 5MERB 4D6VA 3SCMD 4ELMA 4O02H 3IAQA 3G7TA 2IC2A 3OMAB 5K69A 4KZDH 2OTPA 4FFWD 4IOIB 1PZ2A 3O3BB 5IF0B 2AFNA 1BQ5A 1OQXA 3QDMA 5EOTA 2GT9B 1Q9OB 1SGKA 3I9AA 4HJJL 2VDLH 2XYBA 2GBTA 1RZ7L 5IV2B 3S37L 1P84J 5KAQF 1K4DB 3H7BB 3QDMD 3PQYA 1XSOA 5EU7C 5CEZE 2CJUL 3MOBL 2P24B 3W9EB 4TSBH 1IIKA 3SOBL 1HILB 1VZ3A 3QJSB 3GBML 4WU7A 1LEGB 2HH0H 3CTTA 3RWGB 4IK6A 3MLYL 3PQYD 5IGXH 4S2SA 4WV1A 3KR3L 5KVMC 1CF1A 3MJ9H 5F71A 2D4FA 3QUKB 2SEBA 1RUMH 5TDNA 4YLCA 5I6KA 2EXYC 3BIKA 4HCIA 3MLVL 4K3JL 4NJ9H 4A2DA 1CZ8H 2N3JA 1QATA 3E0GA 3LEXA 3CV5A 3TJEH 1YDPB 4RRPG 2VLRB 4JZOB 1ED3B 2OP4L 4DUVA 3RX5A 2YD9A 3C6LB 4O2CA 4JPIA 3O6FA 1NMAL 2AKRA 2ZKHL 4U0QB 1MAMH 4XE5B 1KBKA 5HDBA 2NCEA 3I9IA 1E65A 3LNIA 4X61B 4JRXE 1WFJA 1TZGH 1WS8A 2EKSA 4I18C 4JO1L 4PJXE 4ZTPH 3TPUB 4Q6KA 3MRJA 3GD1I 5LB1A 2HFFB 4MJIA 2H68A 1H8OA 2GEEA 3P0GB 2BXYA 4WW1A 4D9RE 2FVNA 5E5MA 2YD4A 3FKUS 5HY9B 4GG6B 4PB0L 4ZOBA 4JJ5B 2YS4A 2LVCA 2CDGB 3T0ED 2V2TA 2VC2B 1IAOB 5E9NA 4LQFH 2KHAA 3NEOA 1OIOA 3LSOB 1PCSA 1P4BL 3U9PL 4MDJB 5HHXH 3NH7H 2DH3A 1DQDL 1EWHA 2OV0A 5HI3D 3UTOA 4K3DH 2HTLD 1LYQA 3CDZB 1PD1A 3ELQA 4ZMQA 3A3YB 1Y7VA 3T3ME 1LO2L 3PUUA 4MAUH 4G6ML 1YQVL 3I02A 3KPLA 4G8FB 1GHFL 4CVZA 1T66D 4KZCA 2NY2B 3SSGA 4U6XB 1JK9B 1Z0NA 2COQA 4P9HH 1U2YA 4XOCA 4YHOL 5F7BA 1OSPL 2R7EB 5F6HJ 4LLUA 1EJOH 3DXAA 4K3EL 3QCVL 4HGMA 4DUWA 2V0AA 2FEEL 2VO5A 3MGAA 5H4ZA 5I28A 2PYEB 3IUJA 3I6LD 4EQ3A 3QXUA 2N0MA 3FU5A 5I0XA 2JKXA 4NWTH 4HAGA 3PGDB 4W9EC 2V2XB 4JPWH 4I0PC 4S1RH 1HHGA 5AUMB 3EYVB 5KOMC 3NFSL 1OSZA 1EUTA 4M6NL 4L4TE 3KVDD 4QOKE 3L8QA 3VFOB 3B7SA 4JO8A 3CFCH 4KV5E 3R4RA 4H8VA 3BDXA 1CGUA 2BNUA 4OFYD 5GGTA 2KQNA 4XH2B 5KG9B 2YAPA 4B5ZA 1UQSA 2XYIA 1JUFA 2VJ0A 5BXFB 2FJGB 2FBJH 4IRSD 3SKNA 4P5RA 1OTTC 2L7QA 3QI9A 4PJFA 3VI4F 5GRJL 1OMWB 3DV6B 4HIHB 3TEZA 5I8EB 4E9RA 5ERWB 2CGYA 4NUGH 5AD0A 4YO0A 5BOJA 3KPQA 3SFZA 3MYZA 1V27A 4X6DF 1LE5A 4UTBL 1SQ9A 4PR5B 1DBJL 1AMYA 1FNHA 3DTDA 4U0RB 4B27A 3SEPA 1LWRA 1KGCD 1G9HA 3OKEB 3QFJE 5EOCL 2VM3A 2C9XA 3PNWB 1YEDA 1R3IL 3JYCA 5HTSA 2XDWA 3BW9A 4WFHE 3HAEG 2R2HA 1YRKA 2AXGA 2V7HB 3O4OC 4R7VA 4M8RA 5FYLD 8FABB 5DC4B 4DTGL 1A3LL 2W9EL 1FZJB 2XG4B 5E9DA 3EADA 1J05B 4ZBJA 4YK4C 3SBRA 5KSAA 4WTWA 3L4OD 2MPVA 5CUSL 4IHOA 1AO7B 1W15A 2DICA 3FT2A 5E9DD 3ZLQC 4X7SL 2D03H 1PKQA 5KSAD 3P69A 1ITCA 3H2WA 4IMKC 4D0CA 5EN2B 4MDIA 1ZANH 4N2GA 1XR9B 4PWHA 3EJYD 3V0VA 4DO4A 3RFZB 2O5XL 4H0GA 2OM5A 2ZXEB 4PG9B 2ICWA 2TSAA 2X4RB 3TO4A 4EE2A 3UTSB 1WICA 3O41A 4XC3H 1NBCA 4XNMB 3O8XC 3TESA 5AWNH 4E41B 4YHKL 4ONFH 2P9LC 4GQ9H 4R0LC 4AMKH 3TO4D 2MPAL 3MCKA 3UJIL 1SYVB 4X6EA 2GFBB 3LXCA 3QHFL 5DJ6B 1Y1UA 3QG7H 4QYAA 4XPBH 2X89D 3MRQB 3N0DA 1E4KA 3T0VA 3CIKB 1THAA 4FYSA 3C60C 3C8KA 2XWBA 1K8KC 3LTVA 1XH0A 3I74A 2IGFH 5DO2C 4B7IA 4P9HC 3CZLA 3ZKMD 2HFTA 4CGUB 4ZX3A 4IQHA 2W1NA 4WWKB 2JCCE 2W95A 1QYGH 2DKMA 1XZ0B 2D7MA 3BLKA 3D30A 3WHE1 4QWWD 2XTLA 1LO0L 4N1HB 4YGVA 4AY0A 2UZYB 2CHXA 3RGVC 2GSMB 5A2AA 1SJEA 1LEIB 4YDJA 3TEUA 1TKWB 5EUOF 5EEUA 2O5ZL 1AAJA 1CFNB 1YECL 4Z23A 3OC5A 3T09A 4NSXA 3OLGA 5DVLA 1G43A 3GLEA 4E9VA 5TF1H 3MV7E 3SYQA 1SN0A 2L3BA 4H0LC 4HXAH 1MFAL 1S5HB 1WTGT 2CO3A 3UPRA 2YGQA 4DO5A 4YDIH 4D0BB 3UG5A 5LBSH 3PRZA 5BO1L 4D94A 5KSVA 2OMYA 3WTUA 3S36H 2OMVB 3PAUA 1A7QH 3BAWA 3S4SG 3FQUB 2WNGA 1BMGA 3OXRA 2Z31D 3IFNH 1LP9A 4G8GE 2ZXDA 5EBWA 1FFOA 4WJ5B 4XN4A 4P4KD 3ZDYB 4L5FE 2ZTBA 1KB5L 2PF6A 4HZAA 5IEKB 1LO4H 3QZWB 5KW9L 4BP9A 3ORJA 3UTPD 3MUGB 1AHKA 4NZFA 5JORB 5DLML 4BM7A 2Y2TA 7FABH 4KX7A 3APFA 2JELH 2BKLA 2I3SA 1VGEH 4JPVL 1BJ1J 1MAKA 3Q48A 3MFFA 4NS0A 2CA4A 4HT1L 1TNNA 4LOUD 1FYTB 3K71B 2AGZA 1TJXA 4N90D 1A7RL 4XWOD 4AG4H 4OGYH 1MFDH 5I6XB 5DYOB 1I7RA 1H5BC 3CFNA 3HN5A 3O4LE 4XN5A 1K4CA 4PRIB 1T20A 5IB5B 3MRHB 2XQYG 4N1CA 4HWZA 4JG0L 3BPNB 4TUKH 3S35X 3BP7B 4X8JB 4HXBH 1EAQA 2VDKH 3CDFA 5GPRA 4F5CA 4Z8FH 4NGHL 4CMMA 3CBKB 3F7QA 2D9QB 4ZUVA 2RQ8A 5DJXB 5I18L 2V2WB 1O6TA 3FU3A 3CVHH 1BQLL 4LP4A 3SDYL 3VQLA 3GMLB 4UM8B 3L3DB 4X7FC 3V6FB 3K0YA 3MSPA 3L5XH 4Z7QF 5FKSA 4N2OA 3PE7A 4M7KH 4GXVH 35C8H 2WTRB 2AQ2A 2AZUA 2XICA 2CHNA 3AW5A 3SGJC 3TURA 2HWZL 1JNJA 3JPXA 5GXIA 5DUJA 2HLFC 4RX4A 3IJ7A 5DGRA 2HXAA 4JE0A 3C5ZC 3DROB 2J73A 4ZFGL 4NO0D 1MNUL 2DMHA 4M5TA 3UPAA 1DBAH 3OKMA 3HE7D 4GRLD 4M4RB 1A1OB 4WGVB 4RX4D 5CP3H 5KBPA 2WO3B 4LCWA 3H0TB 5IMMB 1Q0EA 3ABGA 3JWOH 1J1OH 4YDLC 4CC4A 1A2YA 5BV7L 2QTVA 4WK2A 3SJVE 1XTLA 3FC8A 2WKOF 4J1UA 1WVZA 3O4JA 3CC1A 5C0BD 1PG7W 2CLVB 4KRPC 3UACA 4LCWD 1RK1A 2QR0A 3T3MF 1T89C 4OFDA 4KXZH 1I7UB 3QJFA 5HHME 4ZUSB 4J5VA 3S8FB 2HAZA 2XTJC 1H3PH 4GAGH 1O6SB 4HHAB 3VU2A 2AZAA 2QJDA 4E42A 3J27A 4GLRH 3JAMg 3O3DB 4NUMA 4C56D 4DCQA 1SYSA 4HDIB 1M2OA 1F3DH 5EM2A 1OTUD 3P30H 2P44B 3NCJH 4XMZA 4M8QB 1TPXC 1SHYB 3O81A 3KLHD 4PJBB 1TG8A 3O2VH 3NSDA 3OF6D 3TIEB 3NSYA 3UTTD 3TS8A 1HZLA 2BC4A 3NAAH 1L9QA 3VRLE 3GS4A 4PJ9C 2X4NA 1SXZA 4HLJA 4CNIB 2CMRL 4AXWB 4NC2B 4BK5C 3UC2A 5I1LA 2XY2A 2AJVL 1WEJH 4FYTA 3BEWB 3RJOA 3GSNA 3V0GA 3WHXA 2ZOWA 1KOAA 5EN3A 2B5IB 3KPSE 4PP2B 4CRPA 3EYSH 3V79C 1JFHA 1QR4A 5F7FA 3CFUA 4X99A 2IDTA 2X2UA 5M5TA 1A4CA 1E42A 3IXAA 2LABA 4XVJL 2G5BB 4I13B 4OCWL 1WE5A 3AB0C 2YD0A 4H8WC 3PWVB 4MYWB 3GMOB 4ZUTA 1IE4A 5DHVA 2EVIA 4MCYA 3FHEA 1G7LB 4J8RA 4RETB 5JIQA 4ZUUB 1E4WL 4JQXA 4X4XA 3COOA 4ZUWB 1MWAL 3HUJF 3ERXA 1QO3A 4TSCH 3N04A 3V7MA 1FFRA 1CDBA 1WAEA 4M5ZL 2DIJA 4QCIA 5DFTA 1FG2B 1NUGA 1DJWA 2V3EA 3VXMD 3FO9B 3EI3A 1OM3L 3FT3A 3LEVL 5M5RA 1J0JA 4YL4A 1G4MA 2OZ4H 4N2IA 5E99H 5F7KC 2CIIA 3GO1H 4G3YH 4P57A 4XCFH 2AJUH 5C0AE 5E2JA 2A1WH 3ORVD 3OKDB 4NCDA 4AT6A 1AQHA 4L4VD 1D2PA 3QXDB 1I7ZA 4QI3A 1ZVHA 3QCTL 2WQAA 2O61A 1QKZL 1OD7A 3HG1A 5LCVA 1PEZA 2BP8B 3MLSL 1BGXL 2VDMH 2VXVH 2VJXA 3KJ4B 3U30C 3VFGL 4DN3L 2G75B 3G6JA 1NFDB 3S3JA 3L54A 5DQDL 2AEQL 4FADA 4IS6B 3C5SB 3VDBA 5E2TH 2EDJA 3HG1D 2A6DA 4DP6X 1NDGB 1NIDA 4UQ2A 1TEYA 1NOLA 5IVXB 2NY6D 4KQ4H 4KJWD 2A99A 5B7MA 1NDMA 4W9GC 4OZFG 1T2XA 4GSXA 4JFZL 1GGCL 2YNPA 2HN7A 2B20A 1BZQK 5MEND 1Z66A 1QASA 1SXCA 3GSOB 3VWJC 3F5WB 4NFBA 4GKNB 2Y2WA 1BM3H 5JHAA 2PP8A 3DHPA 4YSCA 1T2QH 2WCGA 4BCXA 1GYAA 1NIEA 4L8SC 3DA0A 3GDCA 4F9LC 3LS4H 4TMPA 4LEOA 1F58H 3AFLA 2EIZB 5FYJH 2IANA 1LO5A 1XGZA 3D4ZA 5CCKL 1XD0A 2VLKE 2P8MA 3BUYB 2WUCL 4L2LA 3IETA 1S9WB 2NUPA 3QJHA 5CMAA 4L3EA 3CVHB 2MHAA 4UDUA 3BP5B 2IAND 1OQOA 1S7UA 2FLBT 3II3A 3QHZL 4YXHH 2AJZB 2EZ0C 2F1AA 4LKXA 2VR8A 4L3ED 4XODA 1CFTA 4HJ0C 4JO3H 3BLBA 1C9SA 1RUAH 5F0LB 4I79A 1GOGA 3BESR 3DOSB 3EUDA 3TBTB 1VFMA 1I1YA 2Y1AA 4BCYA 1ZOXA 1BQSA 1X9RA 3KVPA 3V4VA 2CAKA 4ZO6A 5IY5B 4MKMA 2WXFA 3EGSB 3NVQA 1Z9SA 2VW4A 2XXGA 3CSYB 4UQAA 2O9KA 5DRZA 3MNWB 4NUQA 1D5XB 1MPAL 2X12A 2X4UB 3EYFB 4TVPD 3HG5A 2DM7A 4GRWH 2CBMA 4LSRL 1ZLUK 3RI5K 3BGFB 1XIWA 3LRGA 5EO0B 4ZFFB 4OM1L 3WMPA 4KKNA 5JPMA 5MEOB 4QAWA 2G2PA 3SJLD 2EYSB 2A6IB 4LNRB 2FHCA 1BLNB 2WQWA 4FHJA 1EX0A 3IDXH 1AKJB 4LCYB 3L4MD 2OSWA 1BM7A 1XIWD 1DYZA 5GZND 3V0WL 1BVKB 5IVZA 1WGOA 2DMGA 2N56A 2EVFA 2JV6A 3ECVA 4LL4A 2ZCKL 2J2ZB 3MNZA 4HETA 2R0WL 1I1FB 5E1GA 5EMYA 3TBCA 4OLVH 5FWQA 4IBYA 4K2UL 2PR9A 4P3CH 2XU9A 3CN4A 5C08D 3OGCA 5I1JH 1RIHH 3FSAA 3UMNA 2WLNA 4K23H 2VXSL 4BHUI 4MD0B 4F15B 1E9QA 2VAAA 1YCSA 3PXJA 2R23A 4M6OH 5AG9A 3GXDA 5IB4A 1EHXA 1KTDA 4RA0C 1IGJA 4HK0A 1IAMA 5D93C 2HVBA 3SE4A 4Y16D 4EN3C 1WAPA 1IGCH 3LPOA 3FTGA 4PJEF 4AL8L 1J5DA 4BH7A 1EHLH 3GMMA 4YE4L 3WY2A 2P8PB 1UTCA 3ESOA 4AQ1A 5EPMB 3GZPA 3HZMB 3VXUA 3I7HA 1EGJH 3RWFA 4XX5A 2OR9H 2FDBP 4XPHH 3DM0A 3L9YA 2J8UE 4LCCC 3Q8EA 1CLCA 4OD2A 3L3OA 2ITFA 4XN8A 2QGEA 4BFOA 5TDPA 2NDGA 4ABQA 4QF1A 4MAYA 2NZIA 2IWEA 1JZ4A 3QEHB 4I2XE 4RAVB 3ARVA 4AUUA 1TF4A 4N24A 3D18A 4AYBA 4JREC 4HH8A 2EDOA 2PXYC 2B0SH 2V7NA 1E8YA 3V6ZB 4OVVA 1TJHL 4JSVC 4F7EA 2XVGA 5MERA 1B0IA 3IDIB 3RQ3A 3LNFA 4LSQL 4LEXH 3FTWA 4PNKB 4WNQB 1XKSA 1XMWA 4IOIA 5KUKA 2BSCA 3O3BA 3PUCA 1E50A 4HYTB 1FZMB 4IGBC 1JERA 3S96A 2P5WB 4X2UA 2CR3A 5L4IA 1I8LA 4V2BA 1FGVH 2GT9A 2PW2B 1ZXKA 1Q9OA 3K8MA 4XPGH 2FNBA 3UC0L 2NSQA 1MCFA 1K4DA 3H7BA 4F2FA 1FNSL 2DTSA 4U31A 2P24A 3W9EA 2J56H 4UYQA 3V9EA 4DGYH 1HILA 3T3PB 3DNKA 3RWGA 3EH1A 1SQMA 2DYSB 4PS4H 5TTRA 3OMZA 3JWNC 1ZHBB 3QPQD 3TPKA 3ZUNC 1KWGA 4YDVB 5IJ7E 1CF8L 1TQVA 2HU8A 1P5VA 4WI6A 1HL8A 1YEGL 4N5ED 1FO0B 3ZSTA 1BG1A 3FPXA 1YDPA 4OIFA 3KEHA 2VLRA 4JZOA 3QRGL 5B1AB 5L8LB 5FHBH 1S8DB 3IDUA 4F9PA 4BQ8A 2WIMA 3C6LA 3TT3L 3ZPDA 3K6DA 1V5JA 3IWVA 4YHLH 4GM9A 2VLRD 3DRTB 3W81A 4GS7B 5D2LE 1ZXQA 2EP6A 1HXKA 3ML9A 3TPUA 3RUGB 3C6LD 1B0WA 3OL2A 1PLBA 4G59C 5GS1C 3WKMH 3G3LA 2DDQL 2HFFA 4RWYH 2F15A 5T5NF 3S5LG 5SWSD 3QJXA 3J81g 5HY9A 1A9BB 4GG6A 3AXIA 3HIZA 4YNYB 4JJ5A 4EPSA 3FONB 5ALBL 4LASH 3EI3B 2CDGA 3F8UB 5DVOA 2GC4C 2AANA 2JKJA 3NJJA 1IAOA 4J2QA 4PPTA 4PSXB 5T5FL 3HOGA 1Q1JL 5I6NA 1FORH 1WAAF 4MDJA 2BHUA 2H7WA 3P02A 4ZFZA 1AHWA 3DX2A 3RN1D 3CDZA 1A6UH 4HU2A 3P4MB 4XNZC 4S1QL 2ZSWB 2GHZA 2FEEI 2Y24A 1FHNA 3BWUF 4G8FA 1VERA 1NCCH 4GRWB 1NGPL 4U6XA 1JK9A 3EO9H 2R7EA 4D9QE 1E4XI 3F6LA 3RBSA 1WIUA 2Q20A 2FLMA 2JIXB 5CLXA 5T1LB 4NKOB 3LB6C 2YB8B 2PYEA 3IN0A 3A4FA 4L05A 1JV5B 1N6VA 3ECWA 3T6WA 4AENB 1KXVA 3MR9B 3PHOB 3IS1X 4H26B 5F0PB 2BW5A 4GGAA 4AKOA 4MXQD 5AUMA 2WKGA 3EYVA 1IKFH 4GBXA 2MOQA 3EH3B 3EMHA 5FO2A 1B0RA 3VFOA 5DVMA 5EV7A 1N59B 1HIMH 4U7MA 2ZJSL 4XH2A 1NUDA 3UO1H 5DFWH 5KG9A 3L7FA 4JFSA 2R4RH 1VPOL 1IFGA 2B5LA 3PDOA 5BXFA 2FJGA 5K1JA 1G6RH 3FUKA 2QSCL 4JY5L 4GFXA 1PY0A 3DV6A 1KJ2B 4HIHA 5I8EA 3IDYB 5ERWA 3EG6A 4EI5C 2MTPA 4M7ZC 1JHLL 1W0WB 4IYKA 3VI3E 2E8ZA 1SHSA 4NIKB 4HCFA 4PJ5A 4WEUD 4IM8A 4Y5XC 4LPXA 2X05A 4FNPA 2K78A 4AGLA 3L17A 2H13A 4GINA 3R0NA 5B1BB 2PM9B 3PNWA 5DMIH 1HOCB 2AGYA 3OF7A 4N86A 2RFXB 3KBHE 3FNKA 4QR7A 4UQCA 3DECA 1MEXL 4I89A 2V7HA 2WB7A 4KMLB 3WFDL 5CSBA 8FABA 2XG4A 4KJPC 3V6OA 1J05A 4Y5YC 3T0DA 3VM5A 2GC7C 1EK3A 4GAAA 4QJ3B 1M7UA 3BWSA 2YLKA 5A6IA 4FJ6A 5M5VA 2YAQA 1AQKL 2HJLB 2K8MA 3C2AH 3Q2NA 5FO8A 1UA6H 2H2PD 4PJDE 4DGWC 2OVRB 1UEMA 2BSDA 2WWMC 2EDTA 3FMGL 4QO1B 4M9OA 1AO7D 1EMTL 3FFCA 3N42B 5A2CA 3RFZA 2YQ3A 3EDFA 3W2DL 5AOIA 2VDLA 3MJ7B 1NEPA 4PG9A 1DVFB 1XSJA 1W72L 3GFUA 1O9WA 2X4RA 1AC6A 4PFEA 3UTSA 3X13B 3AWGA 4CC9A 3U4KA 5CJ5A 4XNMA 1AY1H 3DUHA 3MRKB 3THML 3LQZB 5TEFA 1GC1H 2AK4E 4IBLT 4M1DH 5IQLA 3TZVB 4P06A 3WD5L 2UWEA 3WUWB 1EHAA 4OGXL 1GIGH 1E67A 2QKIB 4FQHA 5D1QA 1SYVA 2C3XA 3HZYB 1MCLA 2GFBA 3PNRB 1XCTB 3MJ9A 5DJ6A 4E41D 1TEFA 4L1QD 4FMVA 2MKWA 3F7RA 5E2VL 3MRQA 1BIIB 4NNXB 3MLRL 1NZRA 5IQMA 3ASWA 4NBMA 3B5GA 1Y6NR 5B38B 3BE1H 3STZB 4ZOYA 4PJ8C 1BZ9B 3KYMB 4U6YB 3T6ZA 4KUCF 3Q2WA 3VG0H 2WWKO 4WWKA 3U7YL 4OCMC 4WGKA 2FT7A 2OL3H 1FQ9C 5B21A 3U7WH 4IMMA 1MNNA 4KAQH 3VH8B 1YNKL 2UZYA 3H9ZA 4WWKD 4U1NB 5DVNA 2ZUSA 1LEIA 2F9BT 1SFHA 2EXWC 2ICCA 1CFNA 3T9WA 1T03L 2RBLA 4ELME 5DRNA 2LAAA 2ZYIA 3P4OB 2A9MH 2EC9U 3ZZLA 2J8UF 4QUOA 4KO9A 1S5HA 3UMTA 4NLAA 9CGTA 1OAZL 3QDME 3R1GL 2Q7NA 4D0BA 1GGBH 5CZXD 5KVGL 3WL9B 1ZK9A 4R5XA 4XO4A 2OMVA 3BKJH 4Z95L 2YPVH 3FQUA 3QUZA 1SPDA 1OE1A 2L7EA 3D25B 3LRSA 3PQYE 4J28A 4DEUA 3SDXE 5I9QC 2AEWA 4WJ5A 5ICZA 1VDGA 3SBWC 3RSEC 4UT7H 3TC9A 3GNML 3DETD 3ROLB 5IEKA 3QZWA 2VM9A 1N67A 5FGCE 3SGEI 4JDTH 2HT2D 4FQ1L 2P42B 1UJTA 3MUGA 5JORA 2KL6A 5LGJB 4KHTH 1LVEA 2EKJA 4I1PA 4XP4H 3RVTC 3V0AC 3RN0D 1BQKA 2OW7A 4NJAH 2VUOA 2NZ9C 3N1QC 4J73A 4ORGB 2I60L 4NP4L 3L48A 2ZICA 1JNLH 1OW0A 3FTUA 1V7MH 5GGRB 3K71A 2FX9H 3TN0B 4MMXA 1S7WA 3L4YA 4JKLA 5DEGB 3WN6A 2JSFA 4BA8A 3EQ8A 5DYOA 1MCWM 2VDPB 5HDBE 4PRIA 1FYTD 4BRVA 4EI6B 5IB5A 3BFWA 1HCZA 3GXNA 3U0WH 1N19A 3GXPA 5IEHB 3POHA 3UTQB 4PD4K 1TYJA 4B9FA 2XWEA 3BPOC 4RGMB 4ESKA 1XF5A 3TGXA 4UT9H 4JT5C 3RIFK 3WNMA 4PRID 5BQ7B 3B8SA 1GGIH 4X8JA 4Z7WF 5EHFA 2NY0B 4QHKJ 2W18A 3WO4C 3O0RH 2NX5B 3LKNB 4TUJB 3K3QA 3V4PL 5CN1A 5CINH 1YNTB 2WXRA 3ZE1A 3VXSA 3TYGH 5DJXA 1SY6L 3HS8A 2V2WA 2WBXA 4D8OA 4NQSB 3H4FA 2BO0A 1XF2A 2XZAH 3GMLA 4UM8A 1I1RA 3HG4A 3V6FA 2G2NA 4IIQB 3F2LA 3RJDA 3Q05A 1WFMA 4JKNA 1U33A 3HG3A 1MUJB 4WWID 2ZOLB 3DROA 4JUTA 3KJ6H 5I30L 5E08L 2FGWL 3I6LE 2AVFA 2LW3A 4E5XA 2AQ1A 2PP9A 4JHVA 4M4RA 1A1OA 3GIZL 4CZYA 3H0TA 5IMMA 3DDGA 3SKJL 3GDBA 1S4IA 5J9PA 4X7EC 3NZ8B 1LQBC 2XX1A 3L4UA 4G42A 4WK4B 4XP9H 1NCAL 2CLVA 1B0GB 3QVAA 1IBHA 5ESAB 3MRFB 3UAAA 1ET8A 3HCVB 1JF1B 4QXWA 1BYNA 4XVSL 4MXWH 4ZUSA 3IUNA 1O6SA 4HHAA 5I1HL 5THAA 3EIFA 4GUPA 5CD5D 3FJTA 1P0SE 4QGTA 1NPNA 4HDIA 4TVUA 2CXKA 1RFDL 3CG8A 5KYWA 4WW2C 4M8QA 3SLED 1K8IB 2OBGA 4PJBA 5C0GB 2HUEA 3CU1A 1RUKL 3TIEA 1JCKA 1YEHH 5K59F 2NY3B 4PD4J 2BNRA 4PJFE 3ZK0A 1GZHC 1E27A 5AB1A 3FFOA 4ACPA 3G5WA 5I76B 1KGCE 1RULL 1FL3A 1QZ1A 4CNIA 1FL6A 3MXVH 4WQOA 4S1SL 2X9ZA 1HI6B 3BEWA 4P2YA 3D4GA 2F7IA 5FYLE 4PP2A 2D0FA 2TSBA 3GM0A 2VMEA 1CLYH 1YFQA 5AAWA 1BBDL 5DD3H 3MRDB 4P23B 1G9ML 3HI6L 4KKCC 1A1NB 5AOLA 4KTDH 4OLZL 2G5BA 4GB9A 1TQCC 1DCLA 5E9DE 5GISL 3WLWC 1IC7H 2JJUA 3PWVA 3QQ4B 4PYHA 1DCEA 2X4PB 3B7FA 5DEFA 2GCYA 2QVIA 1FAIL 1G7LA 1CDJA 4O9DA 4P8QA 4ZUUA 1JPSH 1RUPL 2HA1A 1IQWL 1PKQE 2DEWX 2WANA 3NSXA 3L3IB 3EYOB 4J3OG 3FO2B 3V0HA 3EQ7A 1OTSD 4KH9A 4WZ9A 2B59B 2VRQA 5LBSA 2FL5B 3FO9A 1A0RB 2RCSL 5J6GB 5K1NA 2F2HA 4DP4X 4F8QA 1DR9A 3BDYL 3PHAA 2H0JA 5DZPA 3BGAA 4Y7MA 4AEZA 1WBZB 5E2WL 1E28B 4YDZA 3B7TA 3NIFB 3OKDA 4N22A 2FSEB 3QXDA 4GKSB 4MD4B 1Z9LA 3FSWA 3P0VH 4FA6A 5F93C 1IVTA 4J77A 3CLFL 4POZD 2BHFA 4O9HH 1M7IB 1BWWA 2ZCZA 3QPXL 3K6OA 5GJTH 2G75A 1NFDA 2WYZA 5ACMA 5C2VB 5C0CA 1VA9A 1DVQA 1HOEA 3MROB 5GZOA 4IRZL 5IOKA 3OKLB 5HVWA 3NCWA 4YXKL 3T6VA 5IVXA 3ZKQD 3QH3B 3ARGC 5K9QG 2APBA 4G1MA 5GZOD 3O6LL 2AEPL 3Q06A 1MQKH 3IMWA 1T6VN 3JQOB 1WD8A 1CFVH 1UWEH 1CE6B 4KZ0A 4K4KA 2GBUA 1Q0XH 3V5HA 4EUPH 1XF4B 3HC3H 1DFBH 4IRJB 3NCYS 2Y36L 4HAKA 3F5WA 1OCRB 4GKNA 2V17L 3CIAA 2PTTB 4F37K 3N44B 2CDEB 2VDKA 5HYSB 4Z0XA 1J48A 5FYKU 5BRQA 4JFDA 5GHWH 2AJXL 5KVEE 5EMLB 4X6CB 3BX7C 3X17A 4YEFA 1IAKB 3OAYK 5GIRA 4YFLI 4BUJC 3BUYA 5JOEA 2VLMD 1F4AA 1S9WA 2VQTA 4FQIH 4PBVC 3LPPA 1B3IA 4ANWA 1EIBA 4TQEL 3CVHA 3BP5A 4UIKL 3VM7A 2AJZA 2DS4A 2RGSA 3HS0A 4NWUL 1SEQL 4MA1C 5F0JB 3UTPE 1WZKA 5IHHA 1OOWA 1U8LB 3HNTL 2WAHA 3TWCH 4PJCA 3DOSA 3TBTA 4NQTA 4Y4KB 4PWKA 5TJWK 3Q1SH 4Q14A 5CP3A 3CSYA 4Y4HD 2WO2B 2HKFL 3MNWA 4N90E 1D5XA 5I1IL 2EDNA 2X4UA 3EYFA 4AQOA 1O7SA 1U8KB 1KYOK 3IIYA 2Y25A 4JM2B 1RJZB 5ELIA 4OIIL 1AD9B 4ZFFA 5MEOA 1LDPH 2QMJA 2EYSA 2A6IA 5D72L 2V37A 3SDXF 1JVKA 4RFOL 2X9XA 1AKJA 2F5BL 4LCYA 4JM4L 4P9MH 5KVFH 2DJMA 1BVKA 5LXGH 3A47A 4JD2C 1TOXA 4FRWA 3A67L 1PFCA 5EMMB 3KM2A 2XBZA 2ERJC 1AKJD 1V3LA 3UO8B 2H0FA 4ONHB 5E94A 1T04B 3Q5OA 1ORQA 4LFHG 5C92A 4I4WB 1MCWW 4P49A 5FUOH 1FV1B 5HDOA 4MD0A 4CY2A 3SVWD 3VFSB 4HF5L 3FO0H 3AG2B 5FGSA 5IQOA 1E5TA 5K9QI 4RMQA 1E9PB 2JXMB 3WEXB 4U1LB 2PCFB 1ETJA 1KFAL 3EOTL 4NNPH 3KGTA 3N40F 4CSSA 2IQ9L 2P8PA 4YPGA 1U8MB 5IB3A 5EPMA 4YZWA 3HZMA 4LDLB 3IMSA 5I19H 2KZWA 2APWA 2CO0C 4JQVA 5T8IA 1WZLA 2WLZA 4WI4A 4Q9RL 4GUOA 1CTNA 3BWAB 3IDJB 2WSDA 3K2UL 4G9DB 4K9EH 5I5RA 3A4EA 3CX5J 5ID0A 2A77H 3NSCA 5C0BE 1T1ZB 3D3VB 4LCWE 4X0NA 4A2LA 3L5HA 4N8VG 5L6YL 5ACZB 4IJ3C 5DGQA 4HIXL 4NN7B 3UYPB 3QEQB 3V6ZA 5DT1L 2P47B 2OS7A 3ZO9A 1XL4A 4MJ4A 4QXUH 4YS4A 1A7PL 1KBBA 1J86A 2Y7QB 4N3UA 4C56E 1GJWA 2QZQA 1RMFH 4OUUB 4FNRA 3MXXA 4WNQA 4QTIL 3B37A 3N5AA 3EFFB 3HG0A 4TOYH 4D0KA 3OZ9H 5F97E 2APFA 1HYRC 5F96L 3UTTE 2FWOB 1IT9L 2P5WA 3KVQA 3LQAH 1SLWA 3HAEH 2PW2A 1MXGA 3A0FA 2OMZB 4R90L 2E6QA 4ZI8A 3ESNA 4AX4A 4S0SD 1CGWA 2VXTL 1N4XH 3TA3C 1EDQA 3VO0A 1KFGA 2VDMA 1QHQA 3S48A 3SDAB 3T3PA 4K8RD 4DP9X 1GH7A 1GGUA 2P43B 3KGRA 1S78D 1NCJA 4QAMB 2B2XH 1RHHA 3MUHL 5AFU3 1U58B 1F2XK 2YEZB 4YDVA 3J80g 3L4TA 1IARB 5HGDA 1FO0A 3GSRB 4YC2B 2D31B 2WXKA 3NQKA 4I3RH 4HVBA 2KMWA 2W0FA 4XNXH 1A02N 1ES0A 4CMHC 1S8DA 2YQ2A 3WIAA 3GM8A 4U49A 4MA8H 1HZKA 2J5LC 2VB5A 1FVEB 3BUQA 2HKAA 5A2IH 3IJ0A 3VXME 2FQGA 3IXTB 3ATEA 4NO5B 1JPFB 1YYML 4XMUA 4OCYL 3G5VB 3D33A 4KDTC 1C08B 3P9MB 5D70L 1RZGB 1COBA 1OM9A 4R4NC 4X8XA 4A7SA 1UM4L 4L4VE 4YNYA 3STLB 2IDCA 1XEUA 3OZLA 3WSQH 5CJOH 2YA0A 1VENA 5T3ZD 1ZS8A 1AHMA 1AQDA 4APXB 4PWJA 5KS9B 1F02I 4DZ8B 2KQMA 1UZGA 4DERA 5DJ8B 3HG1E 4JT6C 2P9KC 1ZA3B 1G94A 2WGNB 3A4DA 3GRWL 3KH3A 3P4MA 2OVQB 2ZSWA 4LCUA 2PUQT 2P28B 3X1FA 4DAGL 4OQTH 2CHWA 1GKOA 4K9EC 3RVVC 3K1KC 3QO1A 2XQBH 2EACA 3FRUB 4DW2H 4FKKA 4HULB 5MENE 1MW1A 1CLOL 3PYCA 2JIXA 2K6ZA 2QELA 4NZUL 5KYUA 2G60L 5T1LA 1QFHA 2NY5H 1XGTB 3QWRA 3R18A 4NKOA 4F57L 4QHNB 2BSTB 1JV5A 3DRQA 2KYIA 2MCPH 3MR9A 5IW1A 3WFBH 5D7IF 2JIXD 4H26A 2MNWA 5T1LD 3QWRD 3LZFL 4HS8L 4G6KL 5F9WC 3MLXL 2ZUQB 4G7RB 4HZLB 1X5XA 2QL1A 4PB9L 4OAWB 1KENH 2ATPB 2PABA 3U4BL 7CGTA 2Y7LA 2VDOH 4EOWL 3LQAC 3MLZH 2BRRL 2IANE 3IFLL 5BUAA 3D7PA 1PDKA 5HGAB 1LWJA 3SKOB 4CKQA 1I85C 2R0ZL 4L3EE 1O75A 3HEIB 3KPPA 1D3CA 1JNNH 4AH2B 2WNXA 1JGEA 1KJ2A 1T5XB 3PS6A 3DHMA 3R8BB 1ZT7B 5L0QC 1O7DE 4F7EB 1H6UA 2NNAB 3BKYL 1HL4A 1W0WA 3AU0A 1QRKA 1YEJL 4KGJA 1UYWL 5DU7A 5FO9B 2O6PA 5SX5K 3BP4B 5I2IB 5I75B 4HEPA 4LPCA 5FC9A 3GFCA 4TVPE 4ES0A 1OY3B 3NN8A 4L1DA 3JZYA 3NZSA 2PM9A 4GKZB 3RTLA 3D06A 3V2AR 5F2FA 1HOCA 1L7IL 2BJML 2RFXA 4KNQA 5I1CL 3N41F 4OLXH 4H40A 5JQ6L 4KGLA 1KIPB 1W9XA 4PJ7F 2VN3A 3H55A 5C0RL 5HJGA 3TT1L 3GXUB 1VIWA 1Y0LA 1AP2B 4ZD3H 3PJSA 4B96A 2VMDA 2F8VA 3IMVA 3QWOB 4F7MB 2HJ4A 3PY9A 3QXAA 1NGQL 4LO9A 4NQDA 3EF7A 5C08E 5D2NA 5CXPA 4BFRA 1SUHA 4GM8A 4QO1A 4XVTL 2AQSA 3DO4A 4OM0L 4XPTH 2LT9A 3MJ7A 1QFWM 4TRPH 5TEEA 1DO5A 4RBPK 1MCRA 2NY4C 4I18B 2VYRE 3ECBB 3MRKA 4PRHB 3LQZA 2G2RB 4AX3A 5AVYB 1DVFD 3E9TA 1KULA 1AJ7L 3GBDA 2ZX7A 1MFBL 2QKIA 4ODSH 4EDXB 1JSYA 5EULV 3E8UH 3HZYA 1BF5A 3BJ91 1XCTA 1IGIH 3KPTA 4RQQB 4HH9A 3TZVD 1BIIA 1CYGA 1TLMA 4NNXA 1T1WB 2FB4H 5FW6A 4R7DB 5KJRL 1RLBA 4G7YL 1YEKH 3QE5A 3VFRA 4MMZB 5B38A 5KSBE 5F3BA 3STZA 1JZEA 2IH8A 4OGQC 1Z0MA 4TULL 1BZ9A 4U6YA 5KVDE 4X8CA 4PW9A 1TTCA 5GXBB 2KDYA 3BVDB 3QBTB 1RIUH 4N28A 4OTXL 3DKHA 4J8QA 5IK3B 3LN5B 4MQ7A 2WUBL 5KYXB 3VH8A 1S7QB 4U1NA 3KCPB 1GMIA 1JP5A 4TVPL 5F9OL 5TE7H 2CNXA 1HZHH 3VMPA 1H3VA 1Z9OA 4AVJA 5I1KH 3ZBMA 5I1DB 8PAZA 1XSIA 1PX8A 4Y0GA 2FO1A 5HYFA 4M5YL 1TCMA 3P4OA 4HS6B 4OZHB 4N8PA 4IW4C 4P5TA 4JG1L 4KRNA 5F7AA 1UZ6F 3GT6A 4I0PB 4Z3TA 5J1AB 3X3FH 3OB0H 2WBJA 3WL9A 3GBLA 3WMQA 1KACB 5EEXA 4DPRA 3HNVL 4PWFA 2WZAA 3CFBA 5K1VA 1NUFA 4FFYL 3D25A 1MHCB 4X5PA 1ZD6A 2X1QA 4BWWA 3QUYC 3IGLA 4N6QA 3OX8B 1PSKL 5HE1B 4ICWA 3ROLA 4KQ3L 3WN5C 3WUZA 4M5SA 4X4ME 5B4WA 4IBWA 3SPVB 5GGVL 3A21A 4HWBL 5C0IB 5GXHA 3FRPB 3MRBB 4FQXC 4MHHG 4NKIH 3OW8A 2FX8L 3S6CA 3S3DB 4ZT1A 2VLRE 1KTKE 4NUJB 3B83A 15C8L 2R27A 1JGDB 4UI9R 3TN0A 2BFVH 2WYIA 5DEGA 5B1JA 3O4OB 1CXKA 3RNKA 5BOZG 1IGYB 5F1IB 2VDPA 4L3FA 4NKMB 3D0VA 1HHKB 3V7AG 3TN0D 5IEHA 3SE6A 1IC5H 3RU8H 3TF7C 1JS4A 2E4FA 4NDMB 2DQUH 1N0LB 4HOWA 3TIDB 1NCNA 2WK2A 1FGNL 4EXPX 4J0XA 5I82A 1BQHG 5J13B 3N43B 4QHPA 4GT0A 2CK0L 4GG6E 3LKNA 2HRPL 2MH4A 4TUJA 4N14A 3QW9A 5FR3A 2H45A 2NY0D 3GC3A 2HTKD 4BE5A 2NX5D 4NQSA 2L7UA 3VSVA 3ULUD 4P2AA 5E4IA 1M05B 1LEKB 3PWPD 3UERA 3IGAB 4IIQA 3SYPA 3OKYA 1Z5YD 1K72A 5C9ZB 2B4CH 2QPUA 4K73A 1YYLH 3MKGA 3CQPA 4IDJH 4OLYL 4R9HA 1MUJA 4WFGD 2WOYA 5D5MF 2K3TA 2DQGL 3C60B 1FZKA 3DBXB 4WWOA 4PS7A 2OSXA 3MLPA 3LKOA 4XO8A 3IMRA 4X98A 1HEZA 4UMSA 3O3AB 2GTQA 3ES6B 2PYEE 2OYPA 1C5DB 1DANU 1G7QB 3FQ4A 4DKEL 2UYLA 4G82A 4WK4A 4HJJH 3BXNA 1B0GA 1EFQA 2NXYC 3RGVB 2XZZA 3MOBH 3QGVA 1JF1A 2IV8A 4NHUB 5AKVA 3S8GB 5FX3A 4TLKA 4NX0A 2CHDA 3GBMH 5F1KC 5AYQA 5GS0H 5EMJB 3S5YA 3BKML 1BX2B 3MLYH 3KR3H 3KMDA 1ZS2A 1PF3A 4UYPA 4FNSA 3M07A 1K8IA 1AFVH 5IKCA 5D7KD 1G0XA 1PY4A 2H32H 4K3JH 1UENA 4NC1E 1GS7A 3B7RL 3CSFA 4LRIC 2J1XA 2IUQA 3N0PB 4J4PC 2NY3D 1KN2L 2O30A 2HSIA 3CPUA 4HCRH 5C1MB 4LSTL 2ZUUA 1I53A 3FTZA 3DX1A 2ZKHH 3AY2A 5HI4D 3OJDB 1GTNA 2VC2L 5TGBB 2JNZA 3QZLA 1R19A 4XPFH 3IJ8A 1ZCRA 4JO1H 4P23A 2EINB 4G11A 4BQ9A 4LIQE 5TD4A 2ZUXA 1LWHA 3RZCC 4C47A 3QQ4A 3DMMC 2X4PA 2K9UA 4EAEA 4P23D 4KI5C 1VEPA 2JKNA 4FZ8L 3CMOL 4PB0H 3QDJB 4M29A 1AO7E 5TE4L 4J7RA 4TPRH 2DQDL 3L3IA 3EYOA 2DB8A 3EFOB 3FO2A 1ESOA 3F7VA 1P4BH 2YWZA 1H5BB 2B59A 4BRJA 1DQDH 4R26L 3A6CH 5BNXD 2WCPA 5J6GA 3GJFH 2YPVA 4BCBA 2WYTA 1L3NA 4PLKC 3UTSE 2A74A 1UM5H 1YQVH 4XNQA 2QQLH 4JCMA 4A2FA 4E41E 4PU2A 2R56L 1E28A 5HPOA 1D5BB 1UB5B 4YHOH 3RL2B 4YBHA 2OK6A 1YY9C 1F4HA 1OSPH 3NIFA 3SQRA 4GKSA 4MD4A 4DVRL 3QCVH 2LQRA 1AS6A 3LKSB 1HAWA 3TTSA 4DGUA 4ERSL 5JZ7C 4UNUA 3OSVA 2FCBA 1YQ2A 1E4XH 3EDKA 4K55A 4WO4D 1BHGA 5J3HD 2C3VA 3DK2A 4U1GC 3SO3C 4D3CL 3OKLA 2XCMC 1E4HA 2UZIL 4F20A 1A6VL 3E1F1 1TO4A 3NFSH 4POUB 4M6NH 5E7FA 1EEUA 3QH3A 4H8UA 3NCMA 4G43B 4Y8DC 4Q2ZB 3VI4B 1OGTB 3C5ZB 4MNHB 4GEJA 1TTFA 4PS3A 4X6DB 1NCBL 1XF4A 8CGTA 4BIKA 2AJYH 2CO7A 1A7BA 3RKDC 4UT9A 3PIQB 5TH2A 2Z65C 4YDLB 4HKXA 5DZJA 5KSBF 2H3XA 5MEPB 2ISDA 2CDEA 3HMXH 5HYSA 4IRJD 2YA2A 5GRJH 5GS0C 5T33H 3KLQA 2Y69B 4X6CA 4LIQL 1Z7JA 2XY1A 1IAKA 5IESL 2ZYHA 3RFHA 3GBNL 1NMBL 4JJHA 3L3GB 2CD0A 1J5HA 2LLGA 2BIMA 5EOCH 3MACH 4JAMB 1DUZB 2EDRA 4OI9A 1R3IH 3WXVH 1FVDB 4K9JA 2BW4A 2VSCA 2YLHA 3EJZC 2N1KA 1TETL 4MNQB 4NOBA 3HC2A 4G6JH 2AXWA 3ZDYE 2W9EH 4FQLL 1U8LA 3NIDB 2XQ0A 5IBLD 1OD9A 1ZA6B 2X1OA 1LK2B 4Y4KA 3TYFB 4X42A 4PJ9B 1KG0A 3L3JA 3MBEB 1Q9KB 5C3LD 1ZE3H 2G9KA 4Q6IA 4X7SH 4KKZA 2Z1KA 4ODUB 3WFZA 3D07A 3F7PC 2BS71 4Y4KD 4LPYA 3EWEA 2VRAA 4JM2A 1RJZA 1EANA 2IOIA 1DL7L 3CXFA 1M53A 3FHAA 2OVPB 4JEGB 4QRJA 1FYTE 2H6PB 4P4RA 1QLRA 4PAZA 3VA2C 3TNNB 3LMJH 2BDNL 3GPEA 4GM3A 1NCDL 1ASOA 4JM2D 4YHKH 3AB0B 4PRIE 3L4ZA 4N8CL 3ARBC 3P0YL 4PMFA 2WLMA 3OQRA 3UJIH 3JZGA 3CFEB 4IKNA 4FLRA 1QLFA 2IALA 5BUGA 2CH8A 4YSAA 5CYKB 1T04A 3S88L 4UOW0 4I4WA 7PCYA 2MEJB 1FV1A 1L9SA 4FXGA 2RTTA 2BLFA 4XNBA 2F8OA 3VFSA 1S5IH 2FH6A 4XXCA 2HLAA 2ZKYA 4P2OA 2ZNXA 5EUOB 3UEQA 3QUMH 3OKKB 4Y9BA 4PLJC 4Z78B 1PZUB 3WTVA 1E9PA 2JXMA 1MCBA 4U1LA 4W9CC 1AZUA 1NAML 3WEXA 1FIEA 4JFEA 3I9PA 4X5XB 1XWVA 2CNZA 1J18A 4NQCB 4ZMWA 2FYVA 3OMIB 1IJNA 4FKEA 3WJLA 4X7TB 1U8MA 2DQHL 5AQ0A 2G4EA 1E3FA 5AOJA 3UXFA 3IDMB 1DJXA 1X4ZA 1JN6A 1YECH 1I9IL 3DK0A 1TYQC 3BWAA 3IDJA 2IDQA 4G9DA 4NHCL 2EIKB 3ZXAC 4R3SB 3P2BA 1E5CA 1WC7B 1T1ZA 1UACL 2QGBA 3D3VA 3WS3A 3FTSA 5ACZA 3ETBJ 1MFEH 4NO3B 3UYPA 5BO1H 3Q0HA 4CILA 3U4YA 3KDPB 3D3VD 5EIQA 5F6IC 2Y7QA 4U3SB 4J12A 3T08A 5DHDA 3QC6X 3VWJB 3QEQD 4JHZA 1JPTH 3LY6A 3X11B 4LCIH 2VOTA 2XFXB 2PPAA 1BPLB 3DX3A 2F18A 3EFFA 1BAGA 3JTBA 1JZIA 1UWXH 4Q89A 2FWOA 1GW0A 3GTTA 1HJCA 1MF2L 2OMZA 4I9XA 3IJHB 4PJBE 1IO4C 5DLMH 5EOQH 1HKLL 4HA1A 3U4EB 3MVDK 4K7PX 2HVKB 5E1QA 2K8QA 1C12B 2NR6C 3SDAA 4JFXB 5E1AB 3SGEH 4Z7UA 2EDQA 3ATDA 4HT1H 5L4MA 1E6JH 4QAMA 3ZR5A 1BYOA 3SDAD 5CP7A 3VFUB 1U58A 1YEFH 3H3PL 4R8WL 2YEZA 5DDHB 4G6AD 2Z0BA 5DMYA 3LNGA 4CSTA 4PRBB 1BEXA 4X6FB 2ALWA 2LV4A 1HWGB 3RBGA 2PM7B 3GSRA 5DLLA 3B1TA 2D31A 1HDMB 2JQAA 4QRUA 5T1KB 5B8CB 5DUML 2XOTA 4JG0H 2X40A 1VEOA 4JPQA 5C70A 2YQBA 4Z7QB 5C0DB 3DDFA 3H42L 1F90H 3HBPA 3QRLA 3PXTD 4KVPA 4OFVA 2F5AH 3IXTA 4RRPM 5FK9B 1I8AA 2R9HC 4NO5A 1JPFA 1KCVH 4XOAA 5CCHE 2XV6B 1ZTXL 3SDYH 1JPEA 3JV6B 3OHXB 2JTYA 4WTXA 1C08A 3P9MA 4Y2OB 5IHWA 1WFOA 4OZUA 1F4YL 2H5UA 1DP0A 4A68A 1MJ8L 2R1WB 4FG6D 3LX9A 3DO3A 2VUYA 2J1WA 5EZLB 3TBWA 4AN1A 5IMKB 2HWZH 3STLA 1RPQA 3D2TA 3T04D 3FYEB 4IKIA 4WAFA 3TTYA 4HP5A 3HA0A 4APXA 4ZN4A 1MNUH 4DZBA 2EEAA 2CXGA 4DZ8A 5INDB 4L5FH 5DJ8A 4WO0A 1F1AA 2WQXA 1ZA3A 4H88L 5GGUB 3VWKC 1TQWA 4LSVL 5BV7H 3NDZE 1KTJA 1NFDE 1DLHA 2EDFA 2K0RA 3BVUA 1KELL 1QSFB 3B4NA 3F01A 4A1RA 1AGEB 5A2JH 3CQQA 3SDDC 4KDWA 4GSDL 2C9UA 5J6SA 4GMBA 3MDJA 3UZEA 3FRUA 5IVXE 3CH1A 4OBRA 1NWOA 5IROD 2PBIB 1D2OA 1XGTA 4LCCB 1AGDB 4BEIA 5CEXB 4B6ZA 4QHNA 4Y89A 2Y5QA 2BSTA 3OJ2C 3DVGA 3VG9C 4O2EB 2WLHA 1NKOA 2P49B 2HUHA 4L2YA 2C3WA 4ENEC 5EBMB 2IDSA 1JV2B 1J8RA 4HZLA 3MODL 4JREB 2PXYB 4OAWA 4YIQB 4O51B 2I24N 2VLME 2ATPA 3H6AA 4I5BA 3ZWLB 4LHJB 4M43L 5C0ND 5ICXB 4DOHB 2CMRH 3TEXA 4EF3A 2HX7A 4X80L 2XE4A 2ADFL 3B2VH 3D6GA 5HGAA 3SKOA 5AVWB 3RA7H 3F04A 1G6VK 3FQWA 1L7TH 1OK8A 4KPHH 4IGBB 3L5IA 1I8MB 4AH2A 3B9VA 3HUJB 4L9DA 1T5XA 1GYUA 2CR0A 1NEXB 1ZT7A 5DJYB 4WENB 4HIJB 1U8QB 3STBA 4UINL 1T4WA 1QHOA 2NNAA 4KROC 4S10A 4U7SA 4XVJH 5I0DA 5FO9A 2E7LA 4OCWH 4OCNC 5GRXG 3LZLA 1A14L 1E2VA 3R0MA 3S34L 3DIFB 1U30A 4GKZA 4YUEH 2XL3A 5F7YC 1MWAH 4XCEB 3QIUC 1MHEA 4M5ZH 1KIPA 2A9BA 1DBKL 3KHOA 5GSVB 4Q9QL 5D55A 3EH4B 5J1SC 1VB9A 4OJFL 3QWOA 4F7MA 2GIYA 4M7LT 3FCBA 4K0OA 3ZDYF 4XN2A 2MRYA 2QDWA 4Y9GA 2EXYD 5IGQA 1PNCA 2OLDA 2BIPA 2K70A 4RDBA 3UFIA 1OANA 4NPKA 2A6KB 3EG9B 1KB5B 2DWSA 4FGMA 2XIBA 2YUZA 2B1HL 3QCTH 1W0VB 4U3XA 1QKZH 1QTYT 4PJHF 3FTXA 5HD8C 5IJBC 1BGXH 4UIMB 1HXYB 3VFGH 1F18A 4J3OF 1KY7A 3ECBA 3H54A 5DQDH 1PZCA 1CXLA 2G2RA 2UY6B 2RA1A 3D08A 1P69B 1BPOA 2J21A 4JO4H 1CDYA 4PRHD 4TVSa 1X9UA 1BQUA 4RQQA 4FAVD 3FOLA 4K7FB 4JFZH 4R7DA 4GO9A 4MMZA 4XP6H 2CE6A 1JD9A 2FATL 2OYLA 3M1BA 5GJSL 1C1EL 1YN6B 2HZHA 1HTYA 4EDWL 4FX5A 1U92B 4LSUL 4NNYB 5E8EA 5C9KA 5IK3A 4K71B 3LN5A 4XCCL 5KYXA 5EZJB 1S7QA 3QUHA 2R15A 2B77A 4XZ4A 5DFVD 3T2NL 2NOYA 5DJAB 1YA5A 4Z7NF 5C0JA 2WUCH 3AS2A 1VCAA 5CCKH 3K91A 3KCPA 3GB7B 3VD1A 1A65A 4YXLH 3MN8A 1H15A 1NCIA 1Q47A 1D6VL 3IBEA 5CIPB 4U6HB 5I1DA 2XSKA 2NRDA 4FB1D 2CUMA 2EDWA 2WBWB 4WUUB 4BV1A 5HP5A 4HS6A 4QXTA 3LVEA 3RVXC 4OZHA 4LHUA 4HUVB 5F0MB 2LLNA 5HHVH 5JA8B 5J1AA 3PL6C 3GRGA 5H2BB 4JHAL 5KEZA 1OZTG 2P5WE 3QIBB 4XOBA 2ZKMX 2LAGB 3V5WB 4XAWL 2ZAIA 1NC4B 4I0PD 4WI7A 2E74C 2H47C 3CFJB 3U9WA 2C1OB 2YKLL 4GIAA 2UXGA 3SKMB 2UZPA 4BZYA 1MHCA 1UADC 2J43A 1MPAH 2JJSA 5L2KB 1BEYL 4QL1A 3SQBB 3T3PE 3OX8A 1DSWA 3U79A 2YXFA 4OM1H 3I2CL 2AI0H 5B1CA 1I3RB 2VN6A 2YGOA 1AXTL 1TTGA 2ED6A 3GREA 3TJPA 1E0OB 3QDGD 4NKDB 3NP3A 4EI5B 3D87B 1EAPB 4M7ZB 3SPVA 3E2HC 3AABA 1MVUB 3TCLB 3V0WH 3ZKND 4GGCA 4HC1A 5FUZL 4N20A 5C0IA 5CBAB 5LDUA 1OTTD 3MRBA 3CXHJ 1R5IB 2R0WH 2CO6B 4F7CB 1P7QB 2A83B 3CK0H 3CZSA 4C4UA 3D2UA 5I15L 1Z3GL 3II1A 4K2UH 5I8CB 4FP8H 1HCVA 4G7SB 4PJEB 1EXGA 4FLQA 2X7LA 2I9LB 2VXSH 1WBXB 3B3IA 4ONGL 4Q8BA 5F1IA 2R2EA 1IC4L 3PU7A 1S7SA 1CGTA 1HHKA 2EYTA 3VFPB 4N0CC 4JS7A 3OKOB 4B95C 5GGVY 3RUGE 2XIIA 2MKLC 1YAIA 3D09A 4M7LL 4A6YL 4NDMA 1BFTA 3TVMC 1N0LA 4ZOAA 3TIDA 2EVGA 4Y2DC 5T3ZE 4MA7H 5I5IA 3HJ0A 5BOPA 1H6EA 3TM6A 2WSKA 5CLYA 4RH4A 2J25A 4PTUB 1I3GL 4NQEA 3K7UA 3RWHA 3AVEA 4ALAC 1BMWA 3U6XS 1N6UA 1UXLA 4RE5A 5I1AB 4HJIA 1NCUA 1Y6MR 1UD5A 3BC9A 5JR1L 1U8IB 1UCBL 1CBJA 2QFPA 2KZBA 1M05A 1LEKA 3HI1B 3PJLA 3IGAA 4XN9A 3P11L 4M7JH 3HI5L 4HOXA 2CO4A 3WGUB 3MV8B 1DBMH 4ERZA 3SPCA 1TJHH 4GRWE 3MV9B 1KB3A 2KZ1B 3ISWA 4D8PA 2DQCH 2AQTA 2RR3A 1WA2X 3DBXA 2XXCB 4LSQH 1G7HB 3MZTA 4WI2A 4Q7DA 4FLSA 3ES6A 5EBGA 3C60D 1C5DA 3PP4L 4ODTH 1Y6KR 2PTVA 5IT2L 2D9CA 2ZPKL 5LNEA 3DWTA 1HE7A 2O5YL 3GSQB 1DVUA 4YHZL 4NHUA 1I3UA 2VDRL 4HG4J 3B5HA 5DD5L 3AQXA 4KK8C 1BX2A 3RGVD 1U95A 4HUWB 4HX1B 3WDHA 5M5UA 1TVHB 1LMKA 4ZJ9A 2FHFA 2IH3B 4NRYB 4YHIB 2XVBA 1CF8H 5IB2B 5ESVB 2X9YA 4L1MA 1KCRL 4UAHA 1M7DA 3FGBA 1JFQH 1YEGH 2B3RA 4PVLA 3C2SA 4D7BA 1LMIA 4J23A 3EI1A 5HHPB 4J3OC 4U3HA 2R69L 3QUXA 1X5IA 2PR4L 1ACCA 3TT3H 4NPJA 4QXVA 1BXXA 2IPUK 3OJDA 4FTVB 3GMQB 4QPEA 1C5BL 4G5ZL 1J1PL 4W9JC 4J0WA 3O45B 2YRPA 5D71L 5FB8B 2DI7A 4JFPB 2DDQH 3TONA 4X5WB 2VR3A 1JNHB 3GMPB 1XDTT 5B1KA 5IHLB 2BVPA 2H2SD 3LVTA 5FM5O 4AITA 5JYLA 5ALBH 2I5YH 2KLRA 3EFOA 5HQGA 1FWXA 1CL7L 3QDJD 5F7NC 1VZHA 5ILTH 3I8EA 1B4TA 3VGBA 1HXMB 1JJUA 1CK0L 1K5NA 2FEDC 4LESA 1QLEB 4S1QH 1ACYL 3I50H 2AAAA 3FQTB 3QJUB 1DN2A 1PYWB 1NBQA 1D5BA 1UB5A 2LVEA 3RL2A 2Y2YA 5HI5C 2XL2A 3JV5A 4Q9BA 2H1PL 5I5JA 4WWPA 2A9CA 3DUSB 4KVCL 2DI9A 1IIIA 1A4JB 1WIPA 4GQBB 2AJ3B 2HFEA 4BKSC 1NR0A 1CURA 1QEWB 4AVHA 3OTTA 4AI7A 4JVPA 4NXSA 3UYRH 3ULEC 4PGBB 1N70A 2R29L 5CZRA 5IBUG 3APCA 4DEPB 4G43A 4MKTA 4Q2ZA 3ZYJA 1FVCB 3VI4A 4MNHA 5DJDB 4Y4FC 1ZT4B 2PN5A 2NW3B 1IILE 3ATBA 4X6DA 2EEXA 1TCRB 3IF1B 1TIUA 1P6FA 1TVBB 1VPOH 3C5ZD 3PIQA