5I62A

Crystal structure of the insertion loop deletion mutant of the rna-dependent rna polymerase of a human picorbirnavirus
Total Genus 189
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
189
sequence length
534
structure length
507
Chain Sequence
GQVAPNVWSKYFNIPNPGLRAYFSNVVSGQPEVYRTPFYKGMSLESICDEWYKKLVSIDTQWPTLMEFEDDLRKKVGPMSVMLPLKERMSDIDSYYDSISKDQVPFDTKAISAAKSEWKGVSRLRLRSEVNTVAVMKKSTNSGSPYFSKRKAVVSKTIPCDVYMDGRYCVMRQNGREWSGAAVLGWRGQEGGPKPTDVKQRVVWMFPFAVNIRELQVYQPLILTFQRLGLVPAWVSMEAVDRRITKMFDTKGPRDVVVCTDFSKFDQHFNPTCQSVAKELLADLLTGQEAVDWLERVFPIKYAIPLAYNWGEIRYGIHGMGSGSGGTNADETLVHRVLQHEAAISHHTTLNPNSQCLGDDGVLTYPGISAEDVMQSYSRHGLDMNLEKQYVSKQDCTYLRRWHHTDYRVDGMCVGVYSTMRALGRLAMQERYYDPDVWGEKMVTLRYLSIIENVKYHPLKEEFLDFCIKGDKTRLGLGIPGFLDNIAGEAQKGIENWWVVQALKSRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Initiation of RNA Polymerization and Polymerase Encapsidation by a Small dsRNA Virus.
pubmed doi rcsb
molecule tags Viral protein, replication
source organism Human picobirnavirus (strain human/thailand/hy005102/-)
molecule keywords Potential RNA-dependent RNA polymerase
total genus 189
structure length 507
sequence length 534
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2016-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...