5IBWA

Complex of mlcc bound to the tandem iq motif of myoc
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
76
structure length
76
Chain Sequence
SHMNHINTKAQVIEAFKVFDRDGNGYVTVDYLRKVLNELGDMMPADEIEEMIYEADPQNSGYVQYETFVGMLFLWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Single-lobe Myosin Light Chain C in Complex with the Light Chain-binding Domains of Myosin-1C Provides Insights into Divergent IQ Motif Recognition.
pubmed doi rcsb
molecule keywords Calcium-binding EF-hand domain-containing protein
molecule tags Motor protein
source organism Dictyostelium discoideum
total genus 23
structure length 76
sequence length 76
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 5ibwA00
3FS7A 2WCBA 3BYAA 2CTNA 3KPXA 2ZFDA 2JZIA 3SIAA 3EKHA 5HYDA 2O5GA 3I5GC 1LXFC 1KWOC 3EVRA 1NCXA 2JTZA 4MRXA 1OQPA 2L50A 2MHHA 2JT8A 4N1FA 5AFPA 4GGFA 2HQ8A 1RFJA 1SYMA 2L5XB 1WDCB 2GV5A 2LUXA 1OE9B 5HLOA 3RM1A 1ALVA 2LVKA 3KF9A 1DTLA 3SIBA 2FJUB 1KK8B 5DKQA 2MBXA 1EG4A 4WQ3A 2M3WA 1SCVA 1K95A 2JPTA 1TNXA 1ZFSA 1W7JB 3HCMA 3FWCA 3PALA 3PATA 5D7FA 2ISDA 4ZCVA 1TNQA 1PSBA 1N2DA 1YUSA 1YTZC 3VRQA 4XJKA 3DVEA 2MJWB 1TCOB 1ZACA 1GGZA 1QATA 2WCEA 4NDDA 2JXCA 4I5JA 1DGUA 1RWYA 4GNKB 2G2BA 2F33A 4IL1A 1M63B 4JQ0D 3NSLA 1DVIA 1BG1A 2PSRA 2Y4QA 1NCZA 4I5LB 1R2UA 1YX8A 1GQMA 2LAPA 1EG3A 4I5KA 1MXLC 2AUCA 2CNPA 1RJVA 1B8CA 1ZUZA 1OZOA 1QVIY 2WCFA 2NCOA 4YGCB 2F8PA 2JTTA 1L7ZA 1MHOA 3TUYB 4CFQA 2EGDA 1M46A 2EC6B 4FQOA 1EXRA 3CS1A 1B9AA 2NXQA 1UWOA 1U5IA 2WOSA 5ER4X 2H61C 2L4HA 4YI9A 4P5OE 1A03A 2BL0B 1YR5A 1MWNA 2OTGB 4D1EA 1NIWA 1QX5B 1M39A 1BR4B 4M2PA 4CFRA 2M97A 3WHUB 2OS8C 2BE4A 3GK1A 1QASA 3AAJA 3CR4X 5KU1A 3A8RA 1SCMC 2KFHA 4MLWA 3DF0B 2FOTA 4N5XA 1AVSA 4JPZB 3TDIA 1Q80A 4C0KA 1M31A 1VRKA 4YI8A 4NDCA 4MZJA 4DRWA 1DJGA 3EK8A 2CT9A 1A29A 4WQ2A 5G08A 1OMVA 1PVAA 3BOWB 4OCIA 1FBVA 1XFYO 2ZNDA 2G9BA 4OKHA 4PALA 1BR1B 3AKBA 1IQ5A 1UHIA 5F6TA 1FI6A 4R1EA 5CSNA 4DCKA 1N0YA 1ALWA 1J1DA 3BQ3A 3EK7A 1K8UA 3VRRA 1JC2A 3OB2B 5CPVA 1EH2A 3PN7B 1CLBA 4BY5A 4PCWA 1PALA 2LMVA 1NYAA 1LVCD 3DVKA 2MAZA 3KHEA 3JVTC 1WY9A 2JNFA 1UHHA 2GGZA 1F8HA 5HKZA 3TUYC 4GFTA 1OZSA 1AHRA 1MXEA 2EC6C 2Q4UA 1IJ5A 3EK4A 3BXKA 4FTGA 1KSMA 2LHLA 1MQ1A 2K0JA 4AOMA 1QX2A 1BOCA 3O4YA 5K89A 1KFUS 2BKIB 2AMIA 1S6JA 1CFPA 1J7QA 1IGVA 1S6CA 1BMOA 4XYNA 1BJFA 2M7LA 3RLZA 5GQQC 1SY9A 3I5HB 2I2RE 3BUWB 4NDBA 2LMUA 1CM4A 1CB1A 1W7IB 1K90D 4HSZA 1KFUL 2I94A 2PMYA 1SK6D 1SR6C 1DJWA 3M0WA 1DJXA 1FPWA 1U5IB 3FWBA 2MA2A 1UUSA 1KK7Y 2BCAA 1B4CA 1H4BA 2Y1MA 1CLMA 1Y1AA 1G33A 2A4JA 2M1UA 4PE1A 2JT0A 1GGWA 1NPQA 1DJIA 1NX2A 1B47A 1YRTB 2JU0A 3BUNB 1KQMC 3A4UB 2CBLA 3I5FB 2PVBA 1K9UA 1G4YR 2K7BA 2LHIA 2OPOA 4GUKA 5DKRA 5PALA 3NSKA 3VRNA 1FI5A 4AQIA 1Y6WA 3IQOA 3DD4A 3OB1B 4TNCA 1BLQA 2LVVA 1HQVA 3HX4A 3LLEA 2LMTA 1PULA 1C7VA 4MRYA 1CMFA 3FIAA 2Q91A 4OVNF 4M2OA 2K7CA 1J7RA 1A2XA 1NUBA 1CNPA 3JTDC 1CDNA 4UPGA 1DF0A 3TS5B 2VRGA 1YX7A 2L4IA 4ZCUA 1X02A 2M29A 4A4CA 3BUOB 1Y0VH 3PM8A 4PHMA 2JRFA 2NLNA 2JC2A 2NCPA 1YURA 1XVJA 1C7WA 2LLUA 2BCXA 3CR5X 4HREE 1DJZA 1JWDA 1K2HA 3SJSA 5CSFA 3OP0A 1EL4A 4ETOA 4NQGA 2Y1NA 3SG4A 1LA3A 1SL8A 3CZTX 2BECA 2LUCA 2NZ0A 3WHTB 4QJ5B 5AEQA 1IG5A 1UHKA 3SG3A 1XYDA 2KI6D 3CWGA 1F70A 3D0YA 5ER5A 4CLNA 2L98A 2F3ZA 1FF1A 4PE4A 2KI4B 2ZRSA 2KYFA 1YUTA 1QS7A 1YRUB 2HF5A 4BY4A 4F0ZB 2HQWA 5KSZA 1BU3A 3GK2A 3SG5A 1M45A 2LV7A 4I5NB 1IJ6A 2AAOA 2KI6C 2Y5IA 1SBJA 1N65A 3DVMA 2JWWA 5AANA 3TDZA 1WDCC 3O78A 1S1EA 3IQQA 5TNCA 1WLMA 1SNLA 1R6PA 3NSOA 4PE7A 1B7TZ 1KK8C 5AERA 4MEWA 2M8UA 2K2FA 1CMGA 1KFXS 2H61A 3SG2A 3VROA 3LL8B 3VRPA 3SG7A 1LA0A 1MUXA 3O6BA 1DGVA 4ICBA 5D69A 5CSJA 3TS5C 3QRXA 1CDMA 1F4QA 3I5IB 3MSEB 1AJ4A 2K8MB 3E3RA 3TZ1A 2JNXA 1AK8A 4ORBB 1JSAA 1LKJA 1B8LA 2KQYA 2MLFC 2E30A 1CTRA 1EJ3A 2COLB 2LANA 1QX7A 1RROA 1YVLA 2PALA 1WRKA 3H4SE 1TNPA 1SW8A 1SPYA 3I5GB 1KWOB 1K9PA 2LP3A 3ICBA 3KEVA 1TIZA 2RGIA 1NP8A 1NX0A 1K96A 2LM5A 1FW4A 2JQ6A 4DS7A 4C0LA 1K94A 3GOFA 4XJKB 4YGBB 2M49B 3AKAA 2KYCA 2KAXA 5FYXA 2K7DA 1GJYA 2BE6A 1PK0D 1AUIB 1F4OA 5AXIA 1V1GA 2CCMA 3CGAA 2H2KA 5I2QA 1ODBA 2BL0C 1V1FA 2ZNEA 5HKYA 2OTGC 1JUOA 2KOTA 1B8RA 2KGBC 4E68A 1XFVO 1PRWA 1QXPA 1IRJA 1SMGA 1XA5A 1DJYA 1PVBA 3PSRA 1L2OB 4C0JA 2LNKA 1DJHA 4MBEA 1CDLA 3F45A 2PRUA 4MN0A 1F54A 1S5GZ 3PLFB 1WRLA 2LVIA 2I18A 3D0YB 5JOLA 2O60A 3K21A 2KBIA 2SCPA 4CIDA 2K7OA 5I2LA 2M0RA 4PHNA 2JT3A 2L51A 1IKUA 2KAYA 3ZNIA 1XFZO 3BUXB 1SRAA 1TCFA 2ZKMX 3PFVA 1QV1A 3OX6A 3IF7A 2TN4A 5J3XA 2BKHB 2LVJA 3LK1A 3PN7C 2L0PA 4DUQA 3CR2A 2FCDA 5DKNA 4N1GA 1RK9A 3EKJA 2JXLA 1H8BA 4U8DA 4PE0A 4HRGA 1A4PA 1JF2A 1S5GY 2SASA 2HPSA 3BUMB 1LINA 3BOWA 1NCYA 2OS8B 2KSPA 1OSAA 2EHBA 1ZOTB 1KCYA 1QIWA 1SCMB 2KQ6A 2KHNA 1QVIZ 1XFUO 1S26D 4AQJA 1TNWA 1QJTA 4PDZA 3KO0A 1J1EA 1S6IA 4A4BA 2WC8A 4GAOA 1QV0A 4GBAA 3LCPC 3SG6A 1MR8A 1OMDA 1TOPA 2KDHA 1BT6A 1CFDA 1L2OC 1Y1UA 3I5HC 2PASA 2MRDA 1XFXO 2KNEA 1YVHA 2ZN9A 4PHJA 1XFWO 1PSRA 3NSIA 2CXJA 4P2YB 1SL9A 1J7PA 1E8AA 2F3YA 3O2PA 4YRUA 2KFGA 1BODA 3CLNA 4YBHB 2KFFA 2QPTA 3D10A 2QACA 3CTNA 1F71A 5JJGA 4QJ3B 3AAKA 1C07A 2MLEC 4Q04A 1UHNA 1NX3A 2LC5A 4MZLA 1A75A 2LP2A 3EVVA 3I5FC 3JVTB 3OX5A 4L9MA 5IBWA 4MZKA 4ORCB 2GGMA 2DOQA 1BF5A 2K2AA 1XO5A 4PHKA 1Y1XA 3GK4X 1G8IA 1TRFA 2LLSA 1IH0A 1SKTA 1AJ5A 1NX1A 1QTXA 2D8NA 1K9KA 1YUUA 2M1KB 2HETA 5B8IB 1CFCA 1KFXL 1AP4A 4MVFA 2E6WA 2LE9B 2F2OA 5I8NA 1SR6B 1DT7B 4YGEB 1D1OA 4WRIA 1J55A 1ZMZA 1KQVA 3VGOA 1QLSA 1QLKA 2F2PA 2LCPA 1NWDA 2WORA 1SL7A 2V53A 1CDPA 1K93D 1WLZA 3EVUA 1NSHA 4ORAB 5HLVA 5HKWA 3NXAA 1B7TY 1KQMB 5CSIA 1CM1A 1DF0B 1TN4A 1JBAA 4YGDB 4MSPA 4OR9B 2I7AA 4JWQA 1OOJA 2LLTA 2KI4C 1QIVA 4QJ4B 5BPJA 1OMRA 1JFJA 1S36A 2FCEA 4YGAA 4CPVA 4HRHA 1JFKA 4OV2A 1F55A 2JULA 2IS9A 1KK7Z 2K61A 3ZWHA 2WNDA 2ZN8A 1CKKA 4GPLB 2M9GA 1HT9A 2B1UA 1XK4C 3C1VA 1CFFA 3JTDB 2M7NA 2BBNA 2JOJA 2L2EA 1B1GA 2ZRTA 1RECA 3WNXB 1IWQA 2BCBA 2R2IA 4DIRA 1CLLA 3TDUA 3OHMB 5KTYA 4USLA 3DVJA 1IQ3A 4M2QA 1KSOA 1S3PA 4GGNA 2KGRA 1A75B 1MF8B 4GGFC 2KBMA 5I2OA 1DMOA 1RTP1 1JF0A 1UURA 2KAVA 1WRZA 1TTXA 1UHJA 1UP5A 2BBMA 2P6BB 3WXAA 1J7OA 1XK4A 3I5IC 3DF0A 3LK0A
chains in the Genus database with same CATH superfamily
3FS7A 2WCBA 5EL2A 3BYAA 2WCJA 2CTNA 3KPXA 2ZFDA 2JZIA 3SIAA 3EKHA 5FI2A 5HYDA 2O5GA 3I5GC 4PT1A 1LXFC 1KWOC 3EVRA 1NCXA 2JTZA 4MRXA 4OZDA 1OQPA 2L50A 2MHHA 3EG5B 2JT8A 4N1FA 5AFPA 4GGFA 2HQ8A 1RFJA 1SYMA 2L5XB 1WDCB 3CDNA 2GV5A 2LUXA 1OE9B 5HLOA 3RM1A 1ALVA 2LVKA 3KF9A 1DTLA 3SIBA 1TUJA 2FJUB 1KK8B 2WC6A 5DKQA 2MBXA 1EG4A 4WQ3A 2M3WA 4F7FA 1SCVA 3R1PA 3RZSA 1K95A 2JPTA 1TNXA 1ZFSA 1W7JB 3BFBA 3HCMA 3FWCA 3PALA 3PATA 5D7FA 2ISDA 4ZCVA 1TNQA 1PSBA 1P28A 3N7HA 1N2DA 3SS5A 1YUSA 1YTZC 3VRQA 4XJKA 3DVEA 2MJWB 1TCOB 1ZACA 1GGZA 1QATA 2WCEA 4NDDA 2JXCA 4I5JA 1DGUA 1RWYA 3OGNA 4GNKB 3B88A 2G2BA 2F33A 4IL1A 1M63B 4JQ0D 3NSLA 1DVIA 1BG1A 2PSRA 2Y4QA 1NCZA 4I5LB 1R2UA 1YX8A 1GQMA 2LAPA 1EG3A 4I5KA 1MXLC 2AUCA 2CNPA 5HL1A 1RJVA 1B8CA 1ZUZA 1OZOA 1QVIY 2WCFA 2NCOA 4YGCB 2F8PA 2JTTA 1L7ZA 3DZTA 1MHOA 3TUYB 3CZ1A 4CFQA 2EGDA 1M46A 1Z2CB 2EC6B 4FQOA 1EXRA 3CS1A 1B9AA 2NXQA 1UWOA 1U5IA 2WOSA 1DEKA 1OOGA 5ER4X 2H61C 2L4HA 4YI9A 4P5OE 1A03A 2BL0B 1YR5A 1MWNA 2OTGB 4D1EA 1NIWA 3L4LA 1QX5B 1M39A 1BR4B 4M2PA 1OOHA 4CFRA 2M97A 3WHUB 2OS8C 2BE4A 3GK1A 1QASA 3AAJA 3CR4X 5KU1A 3A8RA 1SCMC 2KFHA 4MLWA 3DF0B 2FOTA 4N5XA 3CYZA 1AVSA 4JPZB 3TDIA 1Q80A 4C0KA 1M31A 1VRKA 4YI8A 4NDCA 2YGUA 4MZJA 4DRWA 1DJGA 3EK8A 2CT9A 1A29A 4WQ2A 5G08A 1OMVA 1PVAA 3BOWB 4OCIA 1FBVA 1XFYO 2ZNDA 2G9BA 4OKHA 4PALA 1BR1B 3AKBA 1IQ5A 1UHIA 5F6TA 1FI6A 4R1EA 5CSNA 4DCKA 1N0YA 3FE9A 1ALWA 1J1DA 3BQ3A 3EK7A 1K8UA 3VRRA 1JC2A 3OB2B 5CPVA 1EH2A 3PN7B 1CLBA 4BY5A 3BJHA 4PCWA 3CZ0A 1PALA 2LMVA 1NYAA 1LVCD 3DVKA 2MAZA 3KHEA 3JVTC 3L4AA 1WY9A 2JNFA 1UHHA 2GGZA 1F8HA 5HKZA 3TUYC 3NHTA 4GFTA 1OZSA 1AHRA 1C3ZA 1MXEA 2EC6C 2Q4UA 1IJ5A 3B87A 3EK4A 3BXKA 4FTGA 1Z4HA 1KSMA 2LHLA 3QMEA 1MQ1A 2K0JA 4AOMA 1QX2A 1BOCA 3O4YA 5K89A 1KFUS 2BKIB 2AMIA 1S6JA 1CFPA 1J7QA 3PM2A 1IGVA 1S6CA 1BMOA 1OW4A 1BJFA 4XYNA 2M7LA 3RLZA 5GQQC 1SY9A 3I5HB 2I2RE 2QEOA 3BUWB 4NDBA 2BAPA 2LMUA 1CM4A 1CB1A 1W7IB 1K90D 4HSZA 1KFUL 2I94A 2PMYA 1SK6D 1SR6C 1DJWA 3M0WA 1DJXA 1FPWA 3R72A 1U5IB 3FWBA 2MA2A 1UUSA 1KK7Y 2BCAA 1B4CA 1H4BA 2Y1MA 1CLMA 1Y1AA 3BFAA 1G33A 2A4JA 2WC5A 3S0FA 2M1UA 2WCLA 4PE1A 2JT0A 1GGWA 4JD9A 1NPQA 1DJIA 1NX2A 1B47A 3PJIA 2PQLA 1YRTB 2JU0A 3Q8IA 3BUNB 1KQMC 3A4UB 5D3OA 2CBLA 3I5FB 2PYQA 2PVBA 1K9UA 1G4YR 2K7BA 2LHIA 2OPOA 4GUKA 5DKRA 5PALA 3NSKA 3VRNA 1FI5A 4AQIA 4FQTA 1Y6WA 3IQOA 3DD4A 3OB1B 4TNCA 1DC1A 2LVVA 1HQVA 2WCMA 3HX4A 1BLQA 3LLEA 2LMTA 1PULA 1C7VA 4MRYA 1CMFA 3FIAA 3UO9A 2Q91A 4OVNF 4M2OA 2K7CA 1J7RA 1A2XA 1NUBA 1CNPA 3JTDC 1CDNA 4UPGA 1DF0A 3TS5B 2VRGA 1YX7A 2L4IA 4ZCUA 1X02A 2M29A 4A4CA 3BUOB 1Y0VH 3PM8A 2L5YA 4PHMA 2FJYA 2JRFA 2NLNA 2JC2A 2NCPA 1YURA 1XVJA 1C7WA 2LLUA 1T14A 2BCXA 3CR5X 1W9ZA 3CABA 1DJZA 4HREE 1JWDA 1K2HA 3SJSA 5CSFA 3OP0A 3FE8A 1EL4A 4ETOA 1TWOA 4NQGA 2Y1NA 3SG4A 1LA3A 1SL8A 3CZTX 2BECA 2LUCA 2NZ0A 3WHTB 4QJ5B 5AEQA 1IG5A 1UHKA 3SG3A 1XYDA 2KI6D 3CWGA 1F70A 3D0YA 5ER5A 4CLNA 2L98A 2F3ZA 3VB1A 1FF1A 4PE4A 2KI4B 2ZRSA 2KYFA 3B7AA 1YUTA 1QS7A 1YRUB 2HF5A 3BFHA 4BY4A 4F0ZB 2HQWA 5KSZA 1BU3A 3GK2A 3SG5A 1M45A 2LV7A 4I5NB 1IJ6A 2AAOA 2KI6C 2Y5IA 1SBJA 1N65A 3DVMA 2JWWA 5AANA 3TDZA 1WDCC 3O78A 1S1EA 3IQQA 5TNCA 1WLMA 1SNLA 1R6PA 3NSOA 4PE7A 1B7TZ 1KK8C 5AERA 4MEWA 2M8UA 5DICA 2K2FA 1CMGA 1KFXS 2H61A 3SG2A 3VROA 3LL8B 3VRPA 3SG7A 1LA0A 1MUXA 3O6BA 1DGVA 4ICBA 5D69A 2KLDA 5CSJA 3TS5C 2P71A 3QRXA 1CDMA 3FE6A 1F4QA 3I5IB 3MSEB 1AJ4A 2K8MB 3E3RA 3TZ1A 2JPOA 2JNXA 2QEBA 3K1EA 3S0GA 1AK8A 4ORBB 1JSAA 1LKJA 1B8LA 2KQYA 2MLFC 2E30A 1CTRA 1EJ3A 2COLB 2LANA 1QX7A 1RROA 1YVLA 2PALA 1WRKA 1OOIX 1TNPA 1SW8A 1SPYA 3H4SE 1KWOB 1K9PA 2LP3A 3I5GB 3ICBA 3KEVA 1TIZA 3L47A 2RGIA 1NP8A 1NX0A 1K96A 2LM5A 1FW4A 2JQ6A 4DS7A 4C0LA 1K94A 3GOFA 4XJKB 4YGBB 1GM0A 2P70A 2GTEA 2M49B 3AKAA 2KYCA 2KAXA 1TUZA 4INXA 5FYXA 2K7DA 1GJYA 2BE6A 1PK0D 1AUIB 1F4OA 5AXIA 1V1GA 2CCMA 3CGAA 2H2KA 5I2QA 1IIOA 1ODBA 2BL0C 1V1FA 2ZNEA 5HKYA 2OTGC 1JUOA 2ERBA 2KOTA 1B8RA 2KGBC 2QEHA 3CZ2A 3S0DA 1XFVO 4E68A 1PRWA 1QXPA 1IRJA 1SMGA 1XA5A 1DJYA 4IJ7A 1PVBA 3PSRA 1L2OB 3S0BA 2LNKA 1DJHA 4C0JA 4MBEA 1CDLA 3F45A 2PRUA 4MN0A 1F54A 1S5GZ 3PLFB 1WRLA 2LVIA 2I18A 3D0YB 5JOLA 2O60A 3K21A 3OBVA 2KBIA 2SCPA 4CIDA 2K7OA 3S0AA 1SSEB 3R1OA 5I2LA 2M0RA 4PHNA 2JT3A 2L51A 1IKUA 2KAYA 3ZNIA 1XFZO 3BUXB 1SRAA 1TCFA 2ZKMX 3PFVA 1QV1A 3OX6A 3IF7A 2WCHA 2TN4A 3D76A 2BKHB 5J3XA 2LVJA 3LK1A 3B6XA 3PN7C 2L0PA 4DUQA 3CR2A 2FCDA 5DKNA 4N1GA 1RK9A 3EKJA 2JXLA 1H8BA 4U8DA 4PE0A 4HRGA 1A4PA 1JF2A 1S5GY 2SASA 3B86A 2HPSA 3BUMB 1LINA 2BNXA 3BOWA 1NCYA 2OS8B 3DY9A 2KSPA 1OSAA 2EHBA 1ZOTB 1KCYA 1QIWA 1SCMB 1QWVA 2KHNA 2KQ6A 1QVIZ 1XFUO 1S26D 4AQJA 1TNWA 1QJTA 3DYEA 2KLEA 4PDZA 1ORGA 3KO0A 1J1EA 1S6IA 4A4BA 2WC8A 4GAOA 1QV0A 4GBAA 3LCPC 3SG6A 1MR8A 1OMDA 1TOPA 2KDHA 1BT6A 1CFDA 1L2OC 1Y1UA 3I5HC 2PASA 5FI7A 2MRDA 1XFXO 2KNEA 1YVHA 2ZN9A 4PHJA 1XFWO 1PSRA 3NSIA 2CXJA 4P2YB 1SL9A 3R1VA 1E8AA 2F3YA 3O2PA 1J7PA 4YRUA 2KFGA 2KPHA 3IVTA 1BODA 3CLNA 4YBHB 2KFFA 2QPTA 3D10A 2QACA 3CTNA 3V2LA 1F71A 5JJGA 4QJ3B 3AAKA 1C07A 2MLEC 4Q04A 1UHNA 1NX3A 2LC5A 4INWA 4MZLA 1A75A 2LP2A 3EVVA 3I5FC 3JVTB 3O4XA 3OX5A 4L9MA 5IBWA 4MZKA 4ORCB 2GGMA 2DOQA 1BF5A 2K2AA 3D75A 1XO5A 4PHKA 1Y1XA 3GK4X 2QDIA 1G8IA 3DXLA 1TRFA 2LLSA 2H8VA 3NHIA 1IH0A 1SKTA 3SS3A 1AJ5A 1NX1A 1QTXA 2D8NA 1K9KA 1YUUA 5FI6A 1DELA 2M1KB 2HETA 5B8IB 1CFCA 1KFXL 1AP4A 4MVFA 2E6WA 2LE9B 2F2OA 5I8NA 1SR6B 1DT7B 4YGEB 1C3YA 1D1OA 4WRIA 1J55A 1ZMZA 1KQVA 3VGOA 1QLSA 4JKTA 1QLKA 3D73A 2F2PA 2LCPA 1NWDA 2WORA 1SL7A 2V53A 1CDPA 1K93D 1WLZA 3EVUA 1NSHA 4ORAB 5HLVA 5HKWA 3NXAA 1B7TY 1KQMB 5CSIA 1CM1A 1DF0B 1LS8A 1TN4A 1JBAA 4YGDB 4MSPA 4OR9B 2I7AA 4JWQA 3SS4A 3D77A 1OOJA 1XFRA 2LLTA 2KI4C 1QIVA 4QJ4B 5BPJA 1OOFA 1OMRA 1JFJA 1S36A 2FCEA 4YGAA 4CPVA 1DQEA 4HRHA 1JFKA 4OV2A 1F55A 2JULA 2IS9A 3NGVA 1KK7Z 2K61A 3ZWHA 2WNDA 2ZN8A 1CKKA 4GPLB 2M9GA 1HT9A 2B1UA 2WCKA 1XK4C 3C1VA 1CFFA 3JTDB 2M7NA 2BBNA 2JOJA 2L2EA 1B1GA 2ZRTA 1RECA 3D78A 3WNXB 1IWQA 2BCBA 2R2IA 4DIRA 4KYNA 3S0EA 3UNWA 1CLLA 3TDUA 3OHMB 5KTYA 4USLA 3DVJA 1IQ3A 4M2QA 1KSOA 1S3PA 4GGNA 2KGRA 1A75B 1MF8B 4GGFC 2KBMA 5I2OA 1DMOA 1RTP1 1JF0A 1UURA 3D74A 2K60A 2KAVA 5I94A 2QEVA 1WRZA 1TTXA 1UHJA 1UP5A 2BBMA 2P6BB 2L2CA 3WXAA 1J7OA 1XK4A 3I5IC 3DF0A 3LK0A
chains in the Genus database with same CATH topology
3FS7A 2WCBA 3BYAA 2CTNA 3KPXA 2ZFDA 2JZIA 3SIAA 3EKHA 5HYDA 2O5GA 3I5GC 1LXFC 1KWOC 3EVRA 1NCXA 2JTZA 4MRXA 1OQPA 2L50A 2MHHA 2JT8A 4N1FA 5AFPA 4GGFA 2HQ8A 1RFJA 1SYMA 2L5XB 1WDCB 2GV5A 2LUXA 1OE9B 5HLOA 3RM1A 1ALVA 2LVKA 3KF9A 1DTLA 3SIBA 2FJUB 1KK8B 5DKQA 2MBXA 1EG4A 4WQ3A 2M3WA 1SCVA 1K95A 2JPTA 1TNXA 1ZFSA 1W7JB 3HCMA 3FWCA 3PALA 3PATA 5D7FA 2ISDA 4ZCVA 1TNQA 1PSBA 1N2DA 1YUSA 1YTZC 3VRQA 4XJKA 3DVEA 2MJWB 1TCOB 1ZACA 1GGZA 1QATA 2WCEA 4NDDA 2JXCA 4I5JA 1DGUA 1RWYA 4GNKB 2G2BA 2F33A 4IL1A 1M63B 4JQ0D 3NSLA 1DVIA 1BG1A 2PSRA 2Y4QA 1NCZA 4I5LB 1R2UA 1YX8A 1GQMA 2LAPA 1EG3A 4I5KA 1MXLC 2AUCA 2CNPA 1RJVA 1B8CA 1ZUZA 1OZOA 1QVIY 2WCFA 2NCOA 4YGCB 2F8PA 2JTTA 1L7ZA 1MHOA 3TUYB 4CFQA 2EGDA 1M46A 2EC6B 4FQOA 1EXRA 3CS1A 1B9AA 2NXQA 1UWOA 1U5IA 2WOSA 5ER4X 2H61C 2L4HA 4YI9A 4P5OE 1A03A 2BL0B 1YR5A 1MWNA 2OTGB 4D1EA 1NIWA 1QX5B 1M39A 1BR4B 4M2PA 4CFRA 2M97A 3WHUB 2OS8C 2BE4A 3GK1A 1QASA 3AAJA 3CR4X 5KU1A 3A8RA 1SCMC 2KFHA 4MLWA 3DF0B 2FOTA 4N5XA 1AVSA 4JPZB 3TDIA 1Q80A 4C0KA 1M31A 1VRKA 4YI8A 4NDCA 4MZJA 4DRWA 1DJGA 3EK8A 2CT9A 1A29A 4WQ2A 5G08A 1OMVA 1PVAA 3BOWB 4OCIA 1FBVA 1XFYO 2ZNDA 2G9BA 4OKHA 4PALA 1BR1B 3AKBA 1IQ5A 1UHIA 5F6TA 1FI6A 4R1EA 5CSNA 4DCKA 1N0YA 1ALWA 1J1DA 3BQ3A 3EK7A 1K8UA 3VRRA 1JC2A 3OB2B 5CPVA 1EH2A 3PN7B 1CLBA 4BY5A 4PCWA 1PALA 2LMVA 1NYAA 1LVCD 3DVKA 2MAZA 3KHEA 3JVTC 1WY9A 2JNFA 1UHHA 2GGZA 1F8HA 5HKZA 3TUYC 4GFTA 1OZSA 1AHRA 1MXEA 2EC6C 2Q4UA 1IJ5A 3EK4A 3BXKA 4FTGA 1KSMA 2LHLA 1MQ1A 2K0JA 4AOMA 1QX2A 1BOCA 3O4YA 5K89A 1KFUS 2BKIB 2AMIA 1S6JA 1CFPA 1J7QA 1IGVA 1S6CA 1BMOA 4XYNA 1BJFA 2M7LA 3RLZA 5GQQC 1SY9A 3I5HB 2I2RE 3BUWB 4NDBA 2LMUA 1CM4A 1CB1A 1W7IB 1K90D 4HSZA 1KFUL 2I94A 2PMYA 1SK6D 1SR6C 1DJWA 3M0WA 1DJXA 1FPWA 1U5IB 3FWBA 2MA2A 1UUSA 1KK7Y 2BCAA 1B4CA 1H4BA 2Y1MA 1CLMA 1Y1AA 1G33A 2A4JA 2M1UA 4PE1A 2JT0A 1GGWA 1NPQA 1DJIA 1NX2A 1B47A 1YRTB 2JU0A 3BUNB 1KQMC 3A4UB 2CBLA 3I5FB 2PVBA 1K9UA 1G4YR 2K7BA 2LHIA 2OPOA 4GUKA 5DKRA 5PALA 3NSKA 3VRNA 1FI5A 4AQIA 1Y6WA 3IQOA 3DD4A 3OB1B 4TNCA 1BLQA 2LVVA 1HQVA 3HX4A 3LLEA 2LMTA 1PULA 1C7VA 4MRYA 1CMFA 3FIAA 2Q91A 4OVNF 4M2OA 2K7CA 1J7RA 1A2XA 1NUBA 1CNPA 3JTDC 1CDNA 4UPGA 1DF0A 3TS5B 2VRGA 1YX7A 2L4IA 4ZCUA 1X02A 2M29A 4A4CA 3BUOB 1Y0VH 3PM8A 4PHMA 2JRFA 2NLNA 2JC2A 2NCPA 1YURA 1XVJA 1C7WA 2LLUA 2BCXA 3CR5X 4HREE 1DJZA 1JWDA 1K2HA 3SJSA 5CSFA 3OP0A 1EL4A 4ETOA 4NQGA 2Y1NA 3SG4A 1LA3A 1SL8A 3CZTX 2BECA 2LUCA 2NZ0A 3WHTB 4QJ5B 5AEQA 1IG5A 1UHKA 3SG3A 1XYDA 2KI6D 3CWGA 1F70A 3D0YA 5ER5A 4CLNA 2L98A 2F3ZA 1FF1A 4PE4A 2KI4B 2ZRSA 2KYFA 1YUTA 1QS7A 1YRUB 2HF5A 4BY4A 4F0ZB 2HQWA 5KSZA 1BU3A 3GK2A 3SG5A 1M45A 2LV7A 4I5NB 1IJ6A 2AAOA 2KI6C 2Y5IA 1SBJA 1N65A 3DVMA 2JWWA 5AANA 3TDZA 1WDCC 3O78A 1S1EA 3IQQA 5TNCA 1WLMA 1SNLA 1R6PA 3NSOA 4PE7A 1B7TZ 1KK8C 5AERA 4MEWA 2M8UA 2K2FA 1CMGA 1KFXS 2H61A 3SG2A 3VROA 3LL8B 3VRPA 3SG7A 1LA0A 1MUXA 3O6BA 1DGVA 4ICBA 5D69A 5CSJA 3TS5C 3QRXA 1CDMA 1F4QA 3I5IB 3MSEB 1AJ4A 2K8MB 3E3RA 3TZ1A 2JNXA 1AK8A 4ORBB 1JSAA 1LKJA 1B8LA 2KQYA 2MLFC 2E30A 1CTRA 1EJ3A 2COLB 2LANA 1QX7A 1RROA 1YVLA 2PALA 1WRKA 3H4SE 1TNPA 1SW8A 1SPYA 3I5GB 1KWOB 1K9PA 2LP3A 3ICBA 3KEVA 1TIZA 2RGIA 1NP8A 1NX0A 1K96A 2LM5A 1FW4A 2JQ6A 4DS7A 4C0LA 1K94A 3GOFA 4XJKB 4YGBB 2M49B 3AKAA 2KYCA 2KAXA 5FYXA 2K7DA 1GJYA 2BE6A 1PK0D 1AUIB 1F4OA 5AXIA 1V1GA 2CCMA 3CGAA 2H2KA 5I2QA 1ODBA 2BL0C 1V1FA 2ZNEA 5HKYA 2OTGC 1JUOA 2KOTA 1B8RA 2KGBC 4E68A 1XFVO 1PRWA 1QXPA 1IRJA 1SMGA 1XA5A 1DJYA 1PVBA 3PSRA 1L2OB 4C0JA 2LNKA 1DJHA 4MBEA 1CDLA 3F45A 2PRUA 4MN0A 1F54A 1S5GZ 3PLFB 1WRLA 2LVIA 2I18A 3D0YB 5JOLA 2O60A 3K21A 2KBIA 2SCPA 4CIDA 2K7OA 5I2LA 2M0RA 4PHNA 2JT3A 2L51A 1IKUA 2KAYA 3ZNIA 1XFZO 3BUXB 1SRAA 1TCFA 2ZKMX 3PFVA 1QV1A 3OX6A 3IF7A 2TN4A 5J3XA 2BKHB 2LVJA 3LK1A 3PN7C 2L0PA 4DUQA 3CR2A 2FCDA 5DKNA 4N1GA 1RK9A 3EKJA 2JXLA 1H8BA 4U8DA 4PE0A 4HRGA 1A4PA 1JF2A 1S5GY 2SASA 2HPSA 3BUMB 1LINA 3BOWA 1NCYA 2OS8B 2KSPA 1OSAA 2EHBA 1ZOTB 1KCYA 1QIWA 1SCMB 2KQ6A 2KHNA 1QVIZ 1XFUO 1S26D 4AQJA 1TNWA 1QJTA 4PDZA 3KO0A 1J1EA 1S6IA 4A4BA 2WC8A 4GAOA 1QV0A 4GBAA 3LCPC 3SG6A 1MR8A 1OMDA 1TOPA 2KDHA 1BT6A 1CFDA 1L2OC 1Y1UA 3I5HC 2PASA 2MRDA 1XFXO 2KNEA 1YVHA 2ZN9A 4PHJA 1XFWO 1PSRA 3NSIA 2CXJA 4P2YB 1SL9A 1J7PA 1E8AA 2F3YA 3O2PA 4YRUA 2KFGA 1BODA 3CLNA 4YBHB 2KFFA 2QPTA 3D10A 2QACA 3CTNA 1F71A 5JJGA 4QJ3B 3AAKA 1C07A 2MLEC 4Q04A 1UHNA 1NX3A 2LC5A 4MZLA 1A75A 2LP2A 3EVVA 3I5FC 3JVTB 3OX5A 4L9MA 5IBWA 4MZKA 4ORCB 2GGMA 2DOQA 1BF5A 2K2AA 1XO5A 4PHKA 1Y1XA 3GK4X 1G8IA 1TRFA 2LLSA 1IH0A 1SKTA 1AJ5A 1NX1A 1QTXA 2D8NA 1K9KA 1YUUA 2M1KB 2HETA 5B8IB 1CFCA 1KFXL 1AP4A 4MVFA 2E6WA 2LE9B 2F2OA 5I8NA 1SR6B 1DT7B 4YGEB 1D1OA 4WRIA 1J55A 1ZMZA 1KQVA 3VGOA 1QLSA 1QLKA 2F2PA 2LCPA 1NWDA 2WORA 1SL7A 2V53A 1CDPA 1K93D 1WLZA 3EVUA 1NSHA 4ORAB 5HLVA 5HKWA 3NXAA 1B7TY 1KQMB 5CSIA 1CM1A 1DF0B 1TN4A 1JBAA 4YGDB 4MSPA 4OR9B 2I7AA 4JWQA 1OOJA 2LLTA 2KI4C 1QIVA 4QJ4B 5BPJA 1OMRA 1JFJA 1S36A 2FCEA 4YGAA 4CPVA 4HRHA 1JFKA 4OV2A 1F55A 2JULA 2IS9A 1KK7Z 2K61A 3ZWHA 2WNDA 2ZN8A 1CKKA 4GPLB 2M9GA 1HT9A 2B1UA 1XK4C 3C1VA 1CFFA 3JTDB 2M7NA 2BBNA 2JOJA 2L2EA 1B1GA 2ZRTA 1RECA 3WNXB 1IWQA 2BCBA 2R2IA 4DIRA 1CLLA 3TDUA 3OHMB 5KTYA 4USLA 3DVJA 1IQ3A 4M2QA 1KSOA 1S3PA 4GGNA 2KGRA 1A75B 1MF8B 4GGFC 2KBMA 5I2OA 1DMOA 1RTP1 1JF0A 1UURA 2KAVA 1WRZA 1TTXA 1UHJA 1UP5A 2BBMA 2P6BB 3WXAA 1J7OA 1XK4A 3I5IC 3DF0A 3LK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FS7 A;  2WCB A;  3BYA A;  2CTN A;  3KPX A;  2ZFD A;  2JZI A;  3SIA A;  3EKH A;  5HYD A;  2O5G A;  3I5G C;  1LXF C;  1KWO C;  3EVR A;  1NCX A;  2JTZ A;  4MRX A;  1OQP A;  2L50 A;  2MHH A;  2JT8 A;  4N1F A;  5AFP A;  4GGF A;  2HQ8 A;  1RFJ A;  1SYM A;  2L5X B;  1WDC B;  2GV5 A;  2LUX A;  1OE9 B;  5HLO A;  3RM1 A;  1ALV A;  2LVK A;  3KF9 A;  1DTL A;  3SIB A;  2FJU B;  1KK8 B;  5DKQ A;  2MBX A;  1EG4 A;  4WQ3 A;  2M3W A;  1SCV A;  1K95 A;  2JPT A;  1TNX A;  1ZFS A;  1W7J B;  3HCM A;  3FWC A;  3PAL A;  3PAT A;  5D7F A;  2ISD A;  4ZCV A;  1TNQ A;  1PSB A;  1N2D A;  1YUS A;  1YTZ C;  3VRQ A;  4XJK A;  3DVE A;  2MJW B;  1TCO B;  1ZAC A;  1GGZ A;  1QAT A;  2WCE A;  4NDD A;  2JXC A;  4I5J A;  1DGU A;  1RWY A;  4GNK B;  2G2B A;  2F33 A;  4IL1 A;  1M63 B;  4JQ0 D;  3NSL A;  1DVI A;  1BG1 A;  2PSR A;  2Y4Q A;  1NCZ A;  4I5L B;  1R2U A;  1YX8 A;  1GQM A;  2LAP A;  1EG3 A;  4I5K A;  1MXL C;  2AUC A;  2CNP A;  1RJV A;  1B8C A;  1ZUZ A;  1OZO A;  1QVI Y;  2WCF A;  2NCO A;  4YGC B;  2F8P A;  2JTT A;  1L7Z A;  1MHO A;  3TUY B;  4CFQ A;  2EGD A;  1M46 A;  2EC6 B;  4FQO A;  1EXR A;  3CS1 A;  1B9A A;  2NXQ A;  1UWO A;  1U5I A;  2WOS A;  5ER4 X;  2H61 C;  2L4H A;  4YI9 A;  4P5O E;  1A03 A;  2BL0 B;  1YR5 A;  1MWN A;  2OTG B;  4D1E A;  1NIW A;  1QX5 B;  1M39 A;  1BR4 B;  4M2P A;  4CFR A;  2M97 A;  3WHU B;  2OS8 C;  2BE4 A;  3GK1 A;  1QAS A;  3AAJ A;  3CR4 X;  5KU1 A;  3A8R A;  1SCM C;  2KFH A;  4MLW A;  3DF0 B;  2FOT A;  4N5X A;  1AVS A;  4JPZ B;  3TDI A;  1Q80 A;  4C0K A;  1M31 A;  1VRK A;  4YI8 A;  4NDC A;  4MZJ A;  4DRW A;  1DJG A;  3EK8 A;  2CT9 A;  1A29 A;  4WQ2 A;  5G08 A;  1OMV A;  1PVA A;  3BOW B;  4OCI A;  1FBV A;  1XFY O;  2ZND A;  2G9B A;  4OKH A;  4PAL A;  1BR1 B;  3AKB A;  1IQ5 A;  1UHI A;  5F6T A;  1FI6 A;  4R1E A;  5CSN A;  4DCK A;  1N0Y A;  1ALW A;  1J1D A;  3BQ3 A;  3EK7 A;  1K8U A;  3VRR A;  1JC2 A;  3OB2 B;  5CPV A;  1EH2 A;  3PN7 B;  1CLB A;  4BY5 A;  4PCW A;  1PAL A;  2LMV A;  1NYA A;  1LVC D;  3DVK A;  2MAZ A;  3KHE A;  3JVT C;  1WY9 A;  2JNF A;  1UHH A;  2GGZ A;  1F8H A;  5HKZ A;  3TUY C;  4GFT A;  1OZS A;  1AHR A;  1MXE A;  2EC6 C;  2Q4U A;  1IJ5 A;  3EK4 A;  3BXK A;  4FTG A;  1KSM A;  2LHL A;  1MQ1 A;  2K0J A;  4AOM A;  1QX2 A;  1BOC A;  3O4Y A;  5K89 A;  1KFU S;  2BKI B;  2AMI A;  1S6J A;  1CFP A;  1J7Q A;  1IGV A;  1S6C A;  1BMO A;  4XYN A;  1BJF A;  2M7L A;  3RLZ A;  5GQQ C;  1SY9 A;  3I5H B;  2I2R E;  3BUW B;  4NDB A;  2LMU A;  1CM4 A;  1CB1 A;  1W7I B;  1K90 D;  4HSZ A;  1KFU L;  2I94 A;  2PMY A;  1SK6 D;  1SR6 C;  1DJW A;  3M0W A;  1DJX A;  1FPW A;  1U5I B;  3FWB A;  2MA2 A;  1UUS A;  1KK7 Y;  2BCA A;  1B4C A;  1H4B A;  2Y1M A;  1CLM A;  1Y1A A;  1G33 A;  2A4J A;  2M1U A;  4PE1 A;  2JT0 A;  1GGW A;  1NPQ A;  1DJI A;  1NX2 A;  1B47 A;  1YRT B;  2JU0 A;  3BUN B;  1KQM C;  3A4U B;  2CBL A;  3I5F B;  2PVB A;  1K9U A;  1G4Y R;  2K7B A;  2LHI A;  2OPO A;  4GUK A;  5DKR A;  5PAL A;  3NSK A;  3VRN A;  1FI5 A;  4AQI A;  1Y6W A;  3IQO A;  3DD4 A;  3OB1 B;  4TNC A;  1BLQ A;  2LVV A;  1HQV A;  3HX4 A;  3LLE A;  2LMT A;  1PUL A;  1C7V A;  4MRY A;  1CMF A;  3FIA A;  2Q91 A;  4OVN F;  4M2O A;  2K7C A;  1J7R A;  1A2X A;  1NUB A;  1CNP A;  3JTD C;  1CDN A;  4UPG A;  1DF0 A;  3TS5 B;  2VRG A;  1YX7 A;  2L4I A;  4ZCU A;  1X02 A;  2M29 A;  4A4C A;  3BUO B;  1Y0V H;  3PM8 A;  4PHM A;  2JRF A;  2NLN A;  2JC2 A;  2NCP A;  1YUR A;  1XVJ A;  1C7W A;  2LLU A;  2BCX A;  3CR5 X;  4HRE E;  1DJZ A;  1JWD A;  1K2H A;  3SJS A;  5CSF A;  3OP0 A;  1EL4 A;  4ETO A;  4NQG A;  2Y1N A;  3SG4 A;  1LA3 A;  1SL8 A;  3CZT X;  2BEC A;  2LUC A;  2NZ0 A;  3WHT B;  4QJ5 B;  5AEQ A;  1IG5 A;  1UHK A;  3SG3 A;  1XYD A;  2KI6 D;  3CWG A;  1F70 A;  3D0Y A;  5ER5 A;  4CLN A;  2L98 A;  2F3Z A;  1FF1 A;  4PE4 A;  2KI4 B;  2ZRS A;  2KYF A;  1YUT A;  1QS7 A;  1YRU B;  2HF5 A;  4BY4 A;  4F0Z B;  2HQW A;  5KSZ A;  1BU3 A;  3GK2 A;  3SG5 A;  1M45 A;  2LV7 A;  4I5N B;  1IJ6 A;  2AAO A;  2KI6 C;  2Y5I A;  1SBJ A;  1N65 A;  3DVM A;  2JWW A;  5AAN A;  3TDZ A;  1WDC C;  3O78 A;  1S1E A;  3IQQ A;  5TNC A;  1WLM A;  1SNL A;  1R6P A;  3NSO A;  4PE7 A;  1B7T Z;  1KK8 C;  5AER A;  4MEW A;  2M8U A;  2K2F A;  1CMG A;  1KFX S;  2H61 A;  3SG2 A;  3VRO A;  3LL8 B;  3VRP A;  3SG7 A;  1LA0 A;  1MUX A;  3O6B A;  1DGV A;  4ICB A;  5D69 A;  5CSJ A;  3TS5 C;  3QRX A;  1CDM A;  1F4Q A;  3I5I B;  3MSE B;  1AJ4 A;  2K8M B;  3E3R A;  3TZ1 A;  2JNX A;  1AK8 A;  4ORB B;  1JSA A;  1LKJ A;  1B8L A;  2KQY A;  2MLF C;  2E30 A;  1CTR A;  1EJ3 A;  2COL B;  2LAN A;  1QX7 A;  1RRO A;  1YVL A;  2PAL A;  1WRK A;  3H4S E;  1TNP A;  1SW8 A;  1SPY A;  3I5G B;  1KWO B;  1K9P A;  2LP3 A;  3ICB A;  3KEV A;  1TIZ A;  2RGI A;  1NP8 A;  1NX0 A;  1K96 A;  2LM5 A;  1FW4 A;  2JQ6 A;  4DS7 A;  4C0L A;  1K94 A;  3GOF A;  4XJK B;  4YGB B;  2M49 B;  3AKA A;  2KYC A;  2KAX A;  5FYX A;  2K7D A;  1GJY A;  2BE6 A;  1PK0 D;  1AUI B;  1F4O A;  5AXI A;  1V1G A;  2CCM A;  3CGA A;  2H2K A;  5I2Q A;  1ODB A;  2BL0 C;  1V1F A;  2ZNE A;  5HKY A;  2OTG C;  1JUO A;  2KOT A;  1B8R A;  2KGB C;  4E68 A;  1XFV O;  1PRW A;  1QXP A;  1IRJ A;  1SMG A;  1XA5 A;  1DJY A;  1PVB A;  3PSR A;  1L2O B;  4C0J A;  2LNK A;  1DJH A;  4MBE A;  1CDL A;  3F45 A;  2PRU A;  4MN0 A;  1F54 A;  1S5G Z;  3PLF B;  1WRL A;  2LVI A;  2I18 A;  3D0Y B;  5JOL A;  2O60 A;  3K21 A;  2KBI A;  2SCP A;  4CID A;  2K7O A;  5I2L A;  2M0R A;  4PHN A;  2JT3 A;  2L51 A;  1IKU A;  2KAY A;  3ZNI A;  1XFZ O;  3BUX B;  1SRA A;  1TCF A;  2ZKM X;  3PFV A;  1QV1 A;  3OX6 A;  3IF7 A;  2TN4 A;  5J3X A;  2BKH B;  2LVJ A;  3LK1 A;  3PN7 C;  2L0P A;  4DUQ A;  3CR2 A;  2FCD A;  5DKN A;  4N1G A;  1RK9 A;  3EKJ A;  2JXL A;  1H8B A;  4U8D A;  4PE0 A;  4HRG A;  1A4P A;  1JF2 A;  1S5G Y;  2SAS A;  2HPS A;  3BUM B;  1LIN A;  3BOW A;  1NCY A;  2OS8 B;  2KSP A;  1OSA A;  2EHB A;  1ZOT B;  1KCY A;  1QIW A;  1SCM B;  2KQ6 A;  2KHN A;  1QVI Z;  1XFU O;  1S26 D;  4AQJ A;  1TNW A;  1QJT A;  4PDZ A;  3KO0 A;  1J1E A;  1S6I A;  4A4B A;  2WC8 A;  4GAO A;  1QV0 A;  4GBA A;  3LCP C;  3SG6 A;  1MR8 A;  1OMD A;  1TOP A;  2KDH A;  1BT6 A;  1CFD A;  1L2O C;  1Y1U A;  3I5H C;  2PAS A;  2MRD A;  1XFX O;  2KNE A;  1YVH A;  2ZN9 A;  4PHJ A;  1XFW O;  1PSR A;  3NSI A;  2CXJ A;  4P2Y B;  1SL9 A;  1J7P A;  1E8A A;  2F3Y A;  3O2P A;  4YRU A;  2KFG A;  1BOD A;  3CLN A;  4YBH B;  2KFF A;  2QPT A;  3D10 A;  2QAC A;  3CTN A;  1F71 A;  5JJG A;  4QJ3 B;  3AAK A;  1C07 A;  2MLE C;  4Q04 A;  1UHN A;  1NX3 A;  2LC5 A;  4MZL A;  1A75 A;  2LP2 A;  3EVV A;  3I5F C;  3JVT B;  3OX5 A;  4L9M A;  5IBW A;  4MZK A;  4ORC B;  2GGM A;  2DOQ A;  1BF5 A;  2K2A A;  1XO5 A;  4PHK A;  1Y1X A;  3GK4 X;  1G8I A;  1TRF A;  2LLS A;  1IH0 A;  1SKT A;  1AJ5 A;  1NX1 A;  1QTX A;  2D8N A;  1K9K A;  1YUU A;  2M1K B;  2HET A;  5B8I B;  1CFC A;  1KFX L;  1AP4 A;  4MVF A;  2E6W A;  2LE9 B;  2F2O A;  5I8N A;  1SR6 B;  1DT7 B;  4YGE B;  1D1O A;  4WRI A;  1J55 A;  1ZMZ A;  1KQV A;  3VGO A;  1QLS A;  1QLK A;  2F2P A;  2LCP A;  1NWD A;  2WOR A;  1SL7 A;  2V53 A;  1CDP A;  1K93 D;  1WLZ A;  3EVU A;  1NSH A;  4ORA B;  5HLV A;  5HKW A;  3NXA A;  1B7T Y;  1KQM B;  5CSI A;  1CM1 A;  1DF0 B;  1TN4 A;  1JBA A;  4YGD B;  4MSP A;  4OR9 B;  2I7A A;  4JWQ A;  1OOJ A;  2LLT A;  2KI4 C;  1QIV A;  4QJ4 B;  5BPJ A;  1OMR A;  1JFJ A;  1S36 A;  2FCE A;  4YGA A;  4CPV A;  4HRH A;  1JFK A;  4OV2 A;  1F55 A;  2JUL A;  2IS9 A;  1KK7 Z;  2K61 A;  3ZWH A;  2WND A;  2ZN8 A;  1CKK A;  4GPL B;  2M9G A;  1HT9 A;  2B1U A;  1XK4 C;  3C1V A;  1CFF A;  3JTD B;  2M7N A;  2BBN A;  2JOJ A;  2L2E A;  1B1G A;  2ZRT A;  1REC A;  3WNX B;  1IWQ A;  2BCB A;  2R2I A;  4DIR A;  1CLL A;  3TDU A;  3OHM B;  5KTY A;  4USL A;  3DVJ A;  1IQ3 A;  4M2Q A;  1KSO A;  1S3P A;  4GGN A;  2KGR A;  1A75 B;  1MF8 B;  4GGF C;  2KBM A;  5I2O A;  1DMO A;  1RTP 1;  1JF0 A;  1UUR A;  2KAV A;  1WRZ A;  1TTX A;  1UHJ A;  1UP5 A;  2BBM A;  2P6B B;  3WXA A;  1J7O A;  1XK4 A;  3I5I C;  3DF0 A;  3LK0 A; 
#chains in the Genus database with same CATH topology
 3FS7 A;  2WCB A;  5EL2 A;  3BYA A;  2WCJ A;  2CTN A;  3KPX A;  2ZFD A;  2JZI A;  3SIA A;  3EKH A;  5FI2 A;  5HYD A;  2O5G A;  3I5G C;  4PT1 A;  1LXF C;  1KWO C;  3EVR A;  1NCX A;  2JTZ A;  4MRX A;  4OZD A;  1OQP A;  2L50 A;  2MHH A;  3EG5 B;  2JT8 A;  4N1F A;  5AFP A;  4GGF A;  2HQ8 A;  1RFJ A;  1SYM A;  2L5X B;  1WDC B;  3CDN A;  2GV5 A;  2LUX A;  1OE9 B;  5HLO A;  3RM1 A;  1ALV A;  2LVK A;  3KF9 A;  1DTL A;  3SIB A;  1TUJ A;  2FJU B;  1KK8 B;  2WC6 A;  5DKQ A;  2MBX A;  1EG4 A;  4WQ3 A;  2M3W A;  4F7F A;  1SCV A;  3R1P A;  3RZS A;  1K95 A;  2JPT A;  1TNX A;  1ZFS A;  1W7J B;  3BFB A;  3HCM A;  3FWC A;  3PAL A;  3PAT A;  5D7F A;  2ISD A;  4ZCV A;  1TNQ A;  1PSB A;  1P28 A;  3N7H A;  1N2D A;  3SS5 A;  1YUS A;  1YTZ C;  3VRQ A;  4XJK A;  3DVE A;  2MJW B;  1TCO B;  1ZAC A;  1GGZ A;  1QAT A;  2WCE A;  4NDD A;  2JXC A;  4I5J A;  1DGU A;  1RWY A;  3OGN A;  4GNK B;  3B88 A;  2G2B A;  2F33 A;  4IL1 A;  1M63 B;  4JQ0 D;  3NSL A;  1DVI A;  1BG1 A;  2PSR A;  2Y4Q A;  1NCZ A;  4I5L B;  1R2U A;  1YX8 A;  1GQM A;  2LAP A;  1EG3 A;  4I5K A;  1MXL C;  2AUC A;  2CNP A;  5HL1 A;  1RJV A;  1B8C A;  1ZUZ A;  1OZO A;  1QVI Y;  2WCF A;  2NCO A;  4YGC B;  2F8P A;  2JTT A;  1L7Z A;  3DZT A;  1MHO A;  3TUY B;  3CZ1 A;  4CFQ A;  2EGD A;  1M46 A;  1Z2C B;  2EC6 B;  4FQO A;  1EXR A;  3CS1 A;  1B9A A;  2NXQ A;  1UWO A;  1U5I A;  2WOS A;  1DEK A;  1OOG A;  5ER4 X;  2H61 C;  2L4H A;  4YI9 A;  4P5O E;  1A03 A;  2BL0 B;  1YR5 A;  1MWN A;  2OTG B;  4D1E A;  1NIW A;  3L4L A;  1QX5 B;  1M39 A;  1BR4 B;  4M2P A;  1OOH A;  4CFR A;  2M97 A;  3WHU B;  2OS8 C;  2BE4 A;  3GK1 A;  1QAS A;  3AAJ A;  3CR4 X;  5KU1 A;  3A8R A;  1SCM C;  2KFH A;  4MLW A;  3DF0 B;  2FOT A;  4N5X A;  3CYZ A;  1AVS A;  4JPZ B;  3TDI A;  1Q80 A;  4C0K A;  1M31 A;  1VRK A;  4YI8 A;  4NDC A;  2YGU A;  4MZJ A;  4DRW A;  1DJG A;  3EK8 A;  2CT9 A;  1A29 A;  4WQ2 A;  5G08 A;  1OMV A;  1PVA A;  3BOW B;  4OCI A;  1FBV A;  1XFY O;  2ZND A;  2G9B A;  4OKH A;  4PAL A;  1BR1 B;  3AKB A;  1IQ5 A;  1UHI A;  5F6T A;  1FI6 A;  4R1E A;  5CSN A;  4DCK A;  1N0Y A;  3FE9 A;  1ALW A;  1J1D A;  3BQ3 A;  3EK7 A;  1K8U A;  3VRR A;  1JC2 A;  3OB2 B;  5CPV A;  1EH2 A;  3PN7 B;  1CLB A;  4BY5 A;  3BJH A;  4PCW A;  3CZ0 A;  1PAL A;  2LMV A;  1NYA A;  1LVC D;  3DVK A;  2MAZ A;  3KHE A;  3JVT C;  3L4A A;  1WY9 A;  2JNF A;  1UHH A;  2GGZ A;  1F8H A;  5HKZ A;  3TUY C;  3NHT A;  4GFT A;  1OZS A;  1AHR A;  1C3Z A;  1MXE A;  2EC6 C;  2Q4U A;  1IJ5 A;  3B87 A;  3EK4 A;  3BXK A;  4FTG A;  1Z4H A;  1KSM A;  2LHL A;  3QME A;  1MQ1 A;  2K0J A;  4AOM A;  1QX2 A;  1BOC A;  3O4Y A;  5K89 A;  1KFU S;  2BKI B;  2AMI A;  1S6J A;  1CFP A;  1J7Q A;  3PM2 A;  1IGV A;  1S6C A;  1BMO A;  1OW4 A;  1BJF A;  4XYN A;  2M7L A;  3RLZ A;  5GQQ C;  1SY9 A;  3I5H B;  2I2R E;  2QEO A;  3BUW B;  4NDB A;  2BAP A;  2LMU A;  1CM4 A;  1CB1 A;  1W7I B;  1K90 D;  4HSZ A;  1KFU L;  2I94 A;  2PMY A;  1SK6 D;  1SR6 C;  1DJW A;  3M0W A;  1DJX A;  1FPW A;  3R72 A;  1U5I B;  3FWB A;  2MA2 A;  1UUS A;  1KK7 Y;  2BCA A;  1B4C A;  1H4B A;  2Y1M A;  1CLM A;  1Y1A A;  3BFA A;  1G33 A;  2A4J A;  2WC5 A;  3S0F A;  2M1U A;  2WCL A;  4PE1 A;  2JT0 A;  1GGW A;  4JD9 A;  1NPQ A;  1DJI A;  1NX2 A;  1B47 A;  3PJI A;  2PQL A;  1YRT B;  2JU0 A;  3Q8I A;  3BUN B;  1KQM C;  3A4U B;  5D3O A;  2CBL A;  3I5F B;  2PYQ A;  2PVB A;  1K9U A;  1G4Y R;  2K7B A;  2LHI A;  2OPO A;  4GUK A;  5DKR A;  5PAL A;  3NSK A;  3VRN A;  1FI5 A;  4AQI A;  4FQT A;  1Y6W A;  3IQO A;  3DD4 A;  3OB1 B;  4TNC A;  1DC1 A;  2LVV A;  1HQV A;  2WCM A;  3HX4 A;  1BLQ A;  3LLE A;  2LMT A;  1PUL A;  1C7V A;  4MRY A;  1CMF A;  3FIA A;  3UO9 A;  2Q91 A;  4OVN F;  4M2O A;  2K7C A;  1J7R A;  1A2X A;  1NUB A;  1CNP A;  3JTD C;  1CDN A;  4UPG A;  1DF0 A;  3TS5 B;  2VRG A;  1YX7 A;  2L4I A;  4ZCU A;  1X02 A;  2M29 A;  4A4C A;  3BUO B;  1Y0V H;  3PM8 A;  2L5Y A;  4PHM A;  2FJY A;  2JRF A;  2NLN A;  2JC2 A;  2NCP A;  1YUR A;  1XVJ A;  1C7W A;  2LLU A;  1T14 A;  2BCX A;  3CR5 X;  1W9Z A;  3CAB A;  1DJZ A;  4HRE E;  1JWD A;  1K2H A;  3SJS A;  5CSF A;  3OP0 A;  3FE8 A;  1EL4 A;  4ETO A;  1TWO A;  4NQG A;  2Y1N A;  3SG4 A;  1LA3 A;  1SL8 A;  3CZT X;  2BEC A;  2LUC A;  2NZ0 A;  3WHT B;  4QJ5 B;  5AEQ A;  1IG5 A;  1UHK A;  3SG3 A;  1XYD A;  2KI6 D;  3CWG A;  1F70 A;  3D0Y A;  5ER5 A;  4CLN A;  2L98 A;  2F3Z A;  3VB1 A;  1FF1 A;  4PE4 A;  2KI4 B;  2ZRS A;  2KYF A;  3B7A A;  1YUT A;  1QS7 A;  1YRU B;  2HF5 A;  3BFH A;  4BY4 A;  4F0Z B;  2HQW A;  5KSZ A;  1BU3 A;  3GK2 A;  3SG5 A;  1M45 A;  2LV7 A;  4I5N B;  1IJ6 A;  2AAO A;  2KI6 C;  2Y5I A;  1SBJ A;  1N65 A;  3DVM A;  2JWW A;  5AAN A;  3TDZ A;  1WDC C;  3O78 A;  1S1E A;  3IQQ A;  5TNC A;  1WLM A;  1SNL A;  1R6P A;  3NSO A;  4PE7 A;  1B7T Z;  1KK8 C;  5AER A;  4MEW A;  2M8U A;  5DIC A;  2K2F A;  1CMG A;  1KFX S;  2H61 A;  3SG2 A;  3VRO A;  3LL8 B;  3VRP A;  3SG7 A;  1LA0 A;  1MUX A;  3O6B A;  1DGV A;  4ICB A;  5D69 A;  2KLD A;  5CSJ A;  3TS5 C;  2P71 A;  3QRX A;  1CDM A;  3FE6 A;  1F4Q A;  3I5I B;  3MSE B;  1AJ4 A;  2K8M B;  3E3R A;  3TZ1 A;  2JPO A;  2JNX A;  2QEB A;  3K1E A;  3S0G A;  1AK8 A;  4ORB B;  1JSA A;  1LKJ A;  1B8L A;  2KQY A;  2MLF C;  2E30 A;  1CTR A;  1EJ3 A;  2COL B;  2LAN A;  1QX7 A;  1RRO A;  1YVL A;  2PAL A;  1WRK A;  1OOI X;  1TNP A;  1SW8 A;  1SPY A;  3H4S E;  1KWO B;  1K9P A;  2LP3 A;  3I5G B;  3ICB A;  3KEV A;  1TIZ A;  3L47 A;  2RGI A;  1NP8 A;  1NX0 A;  1K96 A;  2LM5 A;  1FW4 A;  2JQ6 A;  4DS7 A;  4C0L A;  1K94 A;  3GOF A;  4XJK B;  4YGB B;  1GM0 A;  2P70 A;  2GTE A;  2M49 B;  3AKA A;  2KYC A;  2KAX A;  1TUZ A;  4INX A;  5FYX A;  2K7D A;  1GJY A;  2BE6 A;  1PK0 D;  1AUI B;  1F4O A;  5AXI A;  1V1G A;  2CCM A;  3CGA A;  2H2K A;  5I2Q A;  1IIO A;  1ODB A;  2BL0 C;  1V1F A;  2ZNE A;  5HKY A;  2OTG C;  1JUO A;  2ERB A;  2KOT A;  1B8R A;  2KGB C;  2QEH A;  3CZ2 A;  3S0D A;  1XFV O;  4E68 A;  1PRW A;  1QXP A;  1IRJ A;  1SMG A;  1XA5 A;  1DJY A;  4IJ7 A;  1PVB A;  3PSR A;  1L2O B;  3S0B A;  2LNK A;  1DJH A;  4C0J A;  4MBE A;  1CDL A;  3F45 A;  2PRU A;  4MN0 A;  1F54 A;  1S5G Z;  3PLF B;  1WRL A;  2LVI A;  2I18 A;  3D0Y B;  5JOL A;  2O60 A;  3K21 A;  3OBV A;  2KBI A;  2SCP A;  4CID A;  2K7O A;  3S0A A;  1SSE B;  3R1O A;  5I2L A;  2M0R A;  4PHN A;  2JT3 A;  2L51 A;  1IKU A;  2KAY A;  3ZNI A;  1XFZ O;  3BUX B;  1SRA A;  1TCF A;  2ZKM X;  3PFV A;  1QV1 A;  3OX6 A;  3IF7 A;  2WCH A;  2TN4 A;  3D76 A;  2BKH B;  5J3X A;  2LVJ A;  3LK1 A;  3B6X A;  3PN7 C;  2L0P A;  4DUQ A;  3CR2 A;  2FCD A;  5DKN A;  4N1G A;  1RK9 A;  3EKJ A;  2JXL A;  1H8B A;  4U8D A;  4PE0 A;  4HRG A;  1A4P A;  1JF2 A;  1S5G Y;  2SAS A;  3B86 A;  2HPS A;  3BUM B;  1LIN A;  2BNX A;  3BOW A;  1NCY A;  2OS8 B;  3DY9 A;  2KSP A;  1OSA A;  2EHB A;  1ZOT B;  1KCY A;  1QIW A;  1SCM B;  1QWV A;  2KHN A;  2KQ6 A;  1QVI Z;  1XFU O;  1S26 D;  4AQJ A;  1TNW A;  1QJT A;  3DYE A;  2KLE A;  4PDZ A;  1ORG A;  3KO0 A;  1J1E A;  1S6I A;  4A4B A;  2WC8 A;  4GAO A;  1QV0 A;  4GBA A;  3LCP C;  3SG6 A;  1MR8 A;  1OMD A;  1TOP A;  2KDH A;  1BT6 A;  1CFD A;  1L2O C;  1Y1U A;  3I5H C;  2PAS A;  5FI7 A;  2MRD A;  1XFX O;  2KNE A;  1YVH A;  2ZN9 A;  4PHJ A;  1XFW O;  1PSR A;  3NSI A;  2CXJ A;  4P2Y B;  1SL9 A;  3R1V A;  1E8A A;  2F3Y A;  3O2P A;  1J7P A;  4YRU A;  2KFG A;  2KPH A;  3IVT A;  1BOD A;  3CLN A;  4YBH B;  2KFF A;  2QPT A;  3D10 A;  2QAC A;  3CTN A;  3V2L A;  1F71 A;  5JJG A;  4QJ3 B;  3AAK A;  1C07 A;  2MLE C;  4Q04 A;  1UHN A;  1NX3 A;  2LC5 A;  4INW A;  4MZL A;  1A75 A;  2LP2 A;  3EVV A;  3I5F C;  3JVT B;  3O4X A;  3OX5 A;  4L9M A;  5IBW A;  4MZK A;  4ORC B;  2GGM A;  2DOQ A;  1BF5 A;  2K2A A;  3D75 A;  1XO5 A;  4PHK A;  1Y1X A;  3GK4 X;  2QDI A;  1G8I A;  3DXL A;  1TRF A;  2LLS A;  2H8V A;  3NHI A;  1IH0 A;  1SKT A;  3SS3 A;  1AJ5 A;  1NX1 A;  1QTX A;  2D8N A;  1K9K A;  1YUU A;  5FI6 A;  1DEL A;  2M1K B;  2HET A;  5B8I B;  1CFC A;  1KFX L;  1AP4 A;  4MVF A;  2E6W A;  2LE9 B;  2F2O A;  5I8N A;  1SR6 B;  1DT7 B;  4YGE B;  1C3Y A;  1D1O A;  4WRI A;  1J55 A;  1ZMZ A;  1KQV A;  3VGO A;  1QLS A;  4JKT A;  1QLK A;  3D73 A;  2F2P A;  2LCP A;  1NWD A;  2WOR A;  1SL7 A;  2V53 A;  1CDP A;  1K93 D;  1WLZ A;  3EVU A;  1NSH A;  4ORA B;  5HLV A;  5HKW A;  3NXA A;  1B7T Y;  1KQM B;  5CSI A;  1CM1 A;  1DF0 B;  1LS8 A;  1TN4 A;  1JBA A;  4YGD B;  4MSP A;  4OR9 B;  2I7A A;  4JWQ A;  3SS4 A;  3D77 A;  1OOJ A;  1XFR A;  2LLT A;  2KI4 C;  1QIV A;  4QJ4 B;  5BPJ A;  1OOF A;  1OMR A;  1JFJ A;  1S36 A;  2FCE A;  4YGA A;  4CPV A;  1DQE A;  4HRH A;  1JFK A;  4OV2 A;  1F55 A;  2JUL A;  2IS9 A;  3NGV A;  1KK7 Z;  2K61 A;  3ZWH A;  2WND A;  2ZN8 A;  1CKK A;  4GPL B;  2M9G A;  1HT9 A;  2B1U A;  2WCK A;  1XK4 C;  3C1V A;  1CFF A;  3JTD B;  2M7N A;  2BBN A;  2JOJ A;  2L2E A;  1B1G A;  2ZRT A;  1REC A;  3D78 A;  3WNX B;  1IWQ A;  2BCB A;  2R2I A;  4DIR A;  4KYN A;  3S0E A;  3UNW A;  1CLL A;  3TDU A;  3OHM B;  5KTY A;  4USL A;  3DVJ A;  1IQ3 A;  4M2Q A;  1KSO A;  1S3P A;  4GGN A;  2KGR A;  1A75 B;  1MF8 B;  4GGF C;  2KBM A;  5I2O A;  1DMO A;  1RTP 1;  1JF0 A;  1UUR A;  3D74 A;  2K60 A;  2KAV A;  5I94 A;  2QEV A;  1WRZ A;  1TTX A;  1UHJ A;  1UP5 A;  2BBM A;  2P6B B;  2L2C A;  3WXA A;  1J7O A;  1XK4 A;  3I5I C;  3DF0 A;  3LK0 A; 
#chains in the Genus database with same CATH homology
 3FS7 A;  2WCB A;  3BYA A;  2CTN A;  3KPX A;  2ZFD A;  2JZI A;  3SIA A;  3EKH A;  5HYD A;  2O5G A;  3I5G C;  1LXF C;  1KWO C;  3EVR A;  1NCX A;  2JTZ A;  4MRX A;  1OQP A;  2L50 A;  2MHH A;  2JT8 A;  4N1F A;  5AFP A;  4GGF A;  2HQ8 A;  1RFJ A;  1SYM A;  2L5X B;  1WDC B;  2GV5 A;  2LUX A;  1OE9 B;  5HLO A;  3RM1 A;  1ALV A;  2LVK A;  3KF9 A;  1DTL A;  3SIB A;  2FJU B;  1KK8 B;  5DKQ A;  2MBX A;  1EG4 A;  4WQ3 A;  2M3W A;  1SCV A;  1K95 A;  2JPT A;  1TNX A;  1ZFS A;  1W7J B;  3HCM A;  3FWC A;  3PAL A;  3PAT A;  5D7F A;  2ISD A;  4ZCV A;  1TNQ A;  1PSB A;  1N2D A;  1YUS A;  1YTZ C;  3VRQ A;  4XJK A;  3DVE A;  2MJW B;  1TCO B;  1ZAC A;  1GGZ A;  1QAT A;  2WCE A;  4NDD A;  2JXC A;  4I5J A;  1DGU A;  1RWY A;  4GNK B;  2G2B A;  2F33 A;  4IL1 A;  1M63 B;  4JQ0 D;  3NSL A;  1DVI A;  1BG1 A;  2PSR A;  2Y4Q A;  1NCZ A;  4I5L B;  1R2U A;  1YX8 A;  1GQM A;  2LAP A;  1EG3 A;  4I5K A;  1MXL C;  2AUC A;  2CNP A;  1RJV A;  1B8C A;  1ZUZ A;  1OZO A;  1QVI Y;  2WCF A;  2NCO A;  4YGC B;  2F8P A;  2JTT A;  1L7Z A;  1MHO A;  3TUY B;  4CFQ A;  2EGD A;  1M46 A;  2EC6 B;  4FQO A;  1EXR A;  3CS1 A;  1B9A A;  2NXQ A;  1UWO A;  1U5I A;  2WOS A;  5ER4 X;  2H61 C;  2L4H A;  4YI9 A;  4P5O E;  1A03 A;  2BL0 B;  1YR5 A;  1MWN A;  2OTG B;  4D1E A;  1NIW A;  1QX5 B;  1M39 A;  1BR4 B;  4M2P A;  4CFR A;  2M97 A;  3WHU B;  2OS8 C;  2BE4 A;  3GK1 A;  1QAS A;  3AAJ A;  3CR4 X;  5KU1 A;  3A8R A;  1SCM C;  2KFH A;  4MLW A;  3DF0 B;  2FOT A;  4N5X A;  1AVS A;  4JPZ B;  3TDI A;  1Q80 A;  4C0K A;  1M31 A;  1VRK A;  4YI8 A;  4NDC A;  4MZJ A;  4DRW A;  1DJG A;  3EK8 A;  2CT9 A;  1A29 A;  4WQ2 A;  5G08 A;  1OMV A;  1PVA A;  3BOW B;  4OCI A;  1FBV A;  1XFY O;  2ZND A;  2G9B A;  4OKH A;  4PAL A;  1BR1 B;  3AKB A;  1IQ5 A;  1UHI A;  5F6T A;  1FI6 A;  4R1E A;  5CSN A;  4DCK A;  1N0Y A;  1ALW A;  1J1D A;  3BQ3 A;  3EK7 A;  1K8U A;  3VRR A;  1JC2 A;  3OB2 B;  5CPV A;  1EH2 A;  3PN7 B;  1CLB A;  4BY5 A;  4PCW A;  1PAL A;  2LMV A;  1NYA A;  1LVC D;  3DVK A;  2MAZ A;  3KHE A;  3JVT C;  1WY9 A;  2JNF A;  1UHH A;  2GGZ A;  1F8H A;  5HKZ A;  3TUY C;  4GFT A;  1OZS A;  1AHR A;  1MXE A;  2EC6 C;  2Q4U A;  1IJ5 A;  3EK4 A;  3BXK A;  4FTG A;  1KSM A;  2LHL A;  1MQ1 A;  2K0J A;  4AOM A;  1QX2 A;  1BOC A;  3O4Y A;  5K89 A;  1KFU S;  2BKI B;  2AMI A;  1S6J A;  1CFP A;  1J7Q A;  1IGV A;  1S6C A;  1BMO A;  4XYN A;  1BJF A;  2M7L A;  3RLZ A;  5GQQ C;  1SY9 A;  3I5H B;  2I2R E;  3BUW B;  4NDB A;  2LMU A;  1CM4 A;  1CB1 A;  1W7I B;  1K90 D;  4HSZ A;  1KFU L;  2I94 A;  2PMY A;  1SK6 D;  1SR6 C;  1DJW A;  3M0W A;  1DJX A;  1FPW A;  1U5I B;  3FWB A;  2MA2 A;  1UUS A;  1KK7 Y;  2BCA A;  1B4C A;  1H4B A;  2Y1M A;  1CLM A;  1Y1A A;  1G33 A;  2A4J A;  2M1U A;  4PE1 A;  2JT0 A;  1GGW A;  1NPQ A;  1DJI A;  1NX2 A;  1B47 A;  1YRT B;  2JU0 A;  3BUN B;  1KQM C;  3A4U B;  2CBL A;  3I5F B;  2PVB A;  1K9U A;  1G4Y R;  2K7B A;  2LHI A;  2OPO A;  4GUK A;  5DKR A;  5PAL A;  3NSK A;  3VRN A;  1FI5 A;  4AQI A;  1Y6W A;  3IQO A;  3DD4 A;  3OB1 B;  4TNC A;  1BLQ A;  2LVV A;  1HQV A;  3HX4 A;  3LLE A;  2LMT A;  1PUL A;  1C7V A;  4MRY A;  1CMF A;  3FIA A;  2Q91 A;  4OVN F;  4M2O A;  2K7C A;  1J7R A;  1A2X A;  1NUB A;  1CNP A;  3JTD C;  1CDN A;  4UPG A;  1DF0 A;  3TS5 B;  2VRG A;  1YX7 A;  2L4I A;  4ZCU A;  1X02 A;  2M29 A;  4A4C A;  3BUO B;  1Y0V H;  3PM8 A;  4PHM A;  2JRF A;  2NLN A;  2JC2 A;  2NCP A;  1YUR A;  1XVJ A;  1C7W A;  2LLU A;  2BCX A;  3CR5 X;  4HRE E;  1DJZ A;  1JWD A;  1K2H A;  3SJS A;  5CSF A;  3OP0 A;  1EL4 A;  4ETO A;  4NQG A;  2Y1N A;  3SG4 A;  1LA3 A;  1SL8 A;  3CZT X;  2BEC A;  2LUC A;  2NZ0 A;  3WHT B;  4QJ5 B;  5AEQ A;  1IG5 A;  1UHK A;  3SG3 A;  1XYD A;  2KI6 D;  3CWG A;  1F70 A;  3D0Y A;  5ER5 A;  4CLN A;  2L98 A;  2F3Z A;  1FF1 A;  4PE4 A;  2KI4 B;  2ZRS A;  2KYF A;  1YUT A;  1QS7 A;  1YRU B;  2HF5 A;  4BY4 A;  4F0Z B;  2HQW A;  5KSZ A;  1BU3 A;  3GK2 A;  3SG5 A;  1M45 A;  2LV7 A;  4I5N B;  1IJ6 A;  2AAO A;  2KI6 C;  2Y5I A;  1SBJ A;  1N65 A;  3DVM A;  2JWW A;  5AAN A;  3TDZ A;  1WDC C;  3O78 A;  1S1E A;  3IQQ A;  5TNC A;  1WLM A;  1SNL A;  1R6P A;  3NSO A;  4PE7 A;  1B7T Z;  1KK8 C;  5AER A;  4MEW A;  2M8U A;  2K2F A;  1CMG A;  1KFX S;  2H61 A;  3SG2 A;  3VRO A;  3LL8 B;  3VRP A;  3SG7 A;  1LA0 A;  1MUX A;  3O6B A;  1DGV A;  4ICB A;  5D69 A;  5CSJ A;  3TS5 C;  3QRX A;  1CDM A;  1F4Q A;  3I5I B;  3MSE B;  1AJ4 A;  2K8M B;  3E3R A;  3TZ1 A;  2JNX A;  1AK8 A;  4ORB B;  1JSA A;  1LKJ A;  1B8L A;  2KQY A;  2MLF C;  2E30 A;  1CTR A;  1EJ3 A;  2COL B;  2LAN A;  1QX7 A;  1RRO A;  1YVL A;  2PAL A;  1WRK A;  3H4S E;  1TNP A;  1SW8 A;  1SPY A;  3I5G B;  1KWO B;  1K9P A;  2LP3 A;  3ICB A;  3KEV A;  1TIZ A;  2RGI A;  1NP8 A;  1NX0 A;  1K96 A;  2LM5 A;  1FW4 A;  2JQ6 A;  4DS7 A;  4C0L A;  1K94 A;  3GOF A;  4XJK B;  4YGB B;  2M49 B;  3AKA A;  2KYC A;  2KAX A;  5FYX A;  2K7D A;  1GJY A;  2BE6 A;  1PK0 D;  1AUI B;  1F4O A;  5AXI A;  1V1G A;  2CCM A;  3CGA A;  2H2K A;  5I2Q A;  1ODB A;  2BL0 C;  1V1F A;  2ZNE A;  5HKY A;  2OTG C;  1JUO A;  2KOT A;  1B8R A;  2KGB C;  4E68 A;  1XFV O;  1PRW A;  1QXP A;  1IRJ A;  1SMG A;  1XA5 A;  1DJY A;  1PVB A;  3PSR A;  1L2O B;  4C0J A;  2LNK A;  1DJH A;  4MBE A;  1CDL A;  3F45 A;  2PRU A;  4MN0 A;  1F54 A;  1S5G Z;  3PLF B;  1WRL A;  2LVI A;  2I18 A;  3D0Y B;  5JOL A;  2O60 A;  3K21 A;  2KBI A;  2SCP A;  4CID A;  2K7O A;  5I2L A;  2M0R A;  4PHN A;  2JT3 A;  2L51 A;  1IKU A;  2KAY A;  3ZNI A;  1XFZ O;  3BUX B;  1SRA A;  1TCF A;  2ZKM X;  3PFV A;  1QV1 A;  3OX6 A;  3IF7 A;  2TN4 A;  5J3X A;  2BKH B;  2LVJ A;  3LK1 A;  3PN7 C;  2L0P A;  4DUQ A;  3CR2 A;  2FCD A;  5DKN A;  4N1G A;  1RK9 A;  3EKJ A;  2JXL A;  1H8B A;  4U8D A;  4PE0 A;  4HRG A;  1A4P A;  1JF2 A;  1S5G Y;  2SAS A;  2HPS A;  3BUM B;  1LIN A;  3BOW A;  1NCY A;  2OS8 B;  2KSP A;  1OSA A;  2EHB A;  1ZOT B;  1KCY A;  1QIW A;  1SCM B;  2KQ6 A;  2KHN A;  1QVI Z;  1XFU O;  1S26 D;  4AQJ A;  1TNW A;  1QJT A;  4PDZ A;  3KO0 A;  1J1E A;  1S6I A;  4A4B A;  2WC8 A;  4GAO A;  1QV0 A;  4GBA A;  3LCP C;  3SG6 A;  1MR8 A;  1OMD A;  1TOP A;  2KDH A;  1BT6 A;  1CFD A;  1L2O C;  1Y1U A;  3I5H C;  2PAS A;  2MRD A;  1XFX O;  2KNE A;  1YVH A;  2ZN9 A;  4PHJ A;  1XFW O;  1PSR A;  3NSI A;  2CXJ A;  4P2Y B;  1SL9 A;  1J7P A;  1E8A A;  2F3Y A;  3O2P A;  4YRU A;  2KFG A;  1BOD A;  3CLN A;  4YBH B;  2KFF A;  2QPT A;  3D10 A;  2QAC A;  3CTN A;  1F71 A;  5JJG A;  4QJ3 B;  3AAK A;  1C07 A;  2MLE C;  4Q04 A;  1UHN A;  1NX3 A;  2LC5 A;  4MZL A;  1A75 A;  2LP2 A;  3EVV A;  3I5F C;  3JVT B;  3OX5 A;  4L9M A;  5IBW A;  4MZK A;  4ORC B;  2GGM A;  2DOQ A;  1BF5 A;  2K2A A;  1XO5 A;  4PHK A;  1Y1X A;  3GK4 X;  1G8I A;  1TRF A;  2LLS A;  1IH0 A;  1SKT A;  1AJ5 A;  1NX1 A;  1QTX A;  2D8N A;  1K9K A;  1YUU A;  2M1K B;  2HET A;  5B8I B;  1CFC A;  1KFX L;  1AP4 A;  4MVF A;  2E6W A;  2LE9 B;  2F2O A;  5I8N A;  1SR6 B;  1DT7 B;  4YGE B;  1D1O A;  4WRI A;  1J55 A;  1ZMZ A;  1KQV A;  3VGO A;  1QLS A;  1QLK A;  2F2P A;  2LCP A;  1NWD A;  2WOR A;  1SL7 A;  2V53 A;  1CDP A;  1K93 D;  1WLZ A;  3EVU A;  1NSH A;  4ORA B;  5HLV A;  5HKW A;  3NXA A;  1B7T Y;  1KQM B;  5CSI A;  1CM1 A;  1DF0 B;  1TN4 A;  1JBA A;  4YGD B;  4MSP A;  4OR9 B;  2I7A A;  4JWQ A;  1OOJ A;  2LLT A;  2KI4 C;  1QIV A;  4QJ4 B;  5BPJ A;  1OMR A;  1JFJ A;  1S36 A;  2FCE A;  4YGA A;  4CPV A;  4HRH A;  1JFK A;  4OV2 A;  1F55 A;  2JUL A;  2IS9 A;  1KK7 Z;  2K61 A;  3ZWH A;  2WND A;  2ZN8 A;  1CKK A;  4GPL B;  2M9G A;  1HT9 A;  2B1U A;  1XK4 C;  3C1V A;  1CFF A;  3JTD B;  2M7N A;  2BBN A;  2JOJ A;  2L2E A;  1B1G A;  2ZRT A;  1REC A;  3WNX B;  1IWQ A;  2BCB A;  2R2I A;  4DIR A;  1CLL A;  3TDU A;  3OHM B;  5KTY A;  4USL A;  3DVJ A;  1IQ3 A;  4M2Q A;  1KSO A;  1S3P A;  4GGN A;  2KGR A;  1A75 B;  1MF8 B;  4GGF C;  2KBM A;  5I2O A;  1DMO A;  1RTP 1;  1JF0 A;  1UUR A;  2KAV A;  1WRZ A;  1TTX A;  1UHJ A;  1UP5 A;  2BBM A;  2P6B B;  3WXA A;  1J7O A;  1XK4 A;  3I5I C;  3DF0 A;  3LK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...