5IT9b

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
82
structure length
82
Chain Sequence
MVLVQDLLHPTAASEARKHKLKTLVQSPRSHFLDVKCPGCLNITTVFSHAQTAVTCESCSTVLCTPTGGKAKLSEGTSFRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
molecule keywords Ribosomal protein uS2
total genus 4
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
b PF01667 Ribosomal_S27e Ribosomal protein S27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.25.640 Mainly Beta Single Sheet N-terminal domain of TfIIb N-terminal domain of TfIIb 5it9b00
3J7A4 3JAMb 5LL6f 3J81b 5IT9b 5A2Qb 3J80b 5FLXb
chains in the Genus database with same CATH superfamily
2P3YA 3CCSZ 3CCJZ 1JJ2Y 3VTNA 2LEXA 4NBDA 3G6EZ 1TWHI 1VQ6Z 2JS4A 3NDIA 1M1K2 2DE7A 3BG0B 4QTTA 2G2KA 1WCMI 1I50I 1PFTA 1VQKZ 4HGZA 1YJN1 2K5RA 1VQP1 2LIYA 4A3LI 3OW2Z 1KRLA 1VQPZ 4NH1C 4A3KI 4DGLA 2AKLA 4NOZA 3MZLB 3CC2Z 3CCUZ 3G71Z 2KPIA 4RV9A 5D1OA 4E2YA 3G711 4BBRI 2VPWA 3VMGA 3GTOI 1YI2Z 3NDJA 2E9HA 1VQ91 1VQ8Z 4BBSI 3KIHA 2QRDB 4MH4A 3CCRZ 1Y8CA 4A3JI 2PK7A 1WJ2A 3GTMI 1K9M1 3PO3S 2OZKA 3CCR1 4NB9A 5A2Qf 2M48A 2JIRA 2QLVB 3I4MI 1NJI1 4Y7NI 3CD61 2F4MA 4NBAA 1YITZ 1QVFY 2JA5I 2H85A 3GKQA 1Y1VS 4DK1A 3J7A4 1ZH1A 3F3PC 3S15I 3NFZA 1QVGY 3G4S1 4MRIA 3K7AI 5IT9b 2KI7B 1KC81 3CCMZ 2QKDA 4MD9A 3CPWZ 5T6BA 4NBBA 4RVFA 1Q7Y1 1JWHC 2W04A 3CCM1 3GTMS 3PO3I 2NVYI 1QF8A 1X0TA 1YJNZ 3J80b 5AN9F 1KQSZ 4A3MI 4E2XA 3CPWY 1Q861 4A3II 3G6E1 3HOWI 2P28A 3I55Z 3CC71 2JNYA 1VQL1 3H0GI 2HF1A 5D1OB 3D9XA 3CCL1 2JIMA 4A3GI 3I551 3I4NI 3CC7Z 1RQFA 1N2FA 1AA6A 2RT9A 1K9M2 2JUBA 5IT9f 2E7ZA 1NP6A 1K731 1FDIA 1S7MA 2QRCB 5D1PA 5C44I 2OTJ1 3HOXI 1VQN1 2R7ZI 4EWCA 3EEDA 1TWFI 4MD7A 4A3DI 1VQNZ 1NUIA 1S72Z 2E2II 4E2ZA 4E32A 1VQ4Z 2JIOA 3D2LA 3FQMA 2PM9A 1Y1WI 1YJW1 1Q7Y2 5C4JI 4NFRA 1SFOI 1YHQZ 2I3CA 4A3FI 1KC82 2QA4Z 3CC4Z 2EGTA 1YHQ1 2QREB 1NJI2 1K732 2VF1A 3CCEZ 3GTKI 1Q822 3QWUA 3HOUI 2OOXB 4NBFA 1QVGZ 3EERA 2V8IA 3CMEZ 3I07A 3PO2I 4RS4A 2VPYA 2R6MA 3FQQA 1RNIA 3CME1 3M3YI 3Q87A 1Q821 3CCS1 3CCJ1 1M901 2NAPA 5FLXb 2QR1B 2QEX1 3T4NB 1ML8A 5C4XI 3S2DI 3RZOI 1YIT1 3P5JB 3VMIA 5IP9I 1USPB 1VLAA 2WB1A 2Y0SA 3GTPI 4NBCA 3S16I 3HOYI 3G4SZ 4TNUA 4Y52I 5A2Qb 2Q51A 1VQ51 1DL6A 1ZB9A 3MONA 4MD8A 2LFUA 2R93I 4BXXI 1QXFA 1VQMZ 2ZAEB 3IR7A 1YJ9Z 2R92I 1N8R1 1VQK1 3KIFA 3CCV1 1WIIA 2J6AA 1YJ91 3CCQZ 3OW2Y 3F3FC 1N8R2 1S721 1VQO1 3CCVZ 1VQ41 3CCQ1 3M4OI 1YIJ1 1VQLZ 3GTLI 4E30A 5FLXf 1X3ZA 2VPXA 4MONA 3GTJI 1YJWZ 3CCLZ 4A3EI 1YI21 1Q862 1L1OC 2AYDA 3CC21 2JIQA 3CCU1 1Q811 2JA7I 1RO0A 2V8KA 3CXCY 1X3WA 2RPRA 3S17I 3RZDI 2VUGA 4MXUA 2M6NA 2O4HA 4XX2A 3NH5A 4CL1A 2JIPA 3I561 2HU9A 2YU9I 4A93I 1QVFZ 1WZNA 2DE6A 2JMOA 2V3VA 5LL6f 1WW9A 3VB9A 2DE5A 1LQLA 2QEXZ 5T67A 3CC41 2QA41 3ESWA 1TFIA 3IF8A 3HOVI 3IFUA 3CD6Z 1FDOA 2B63I 1I3QI 3HKZA 3CQZI 4BY7I 1VQ5Z 5T64A 4RVDA 2IZ4A 1VQ71 5C3EI 1M1K1 2E2HI 1VQ7Z 1Z02A 3S1QI 2V8JA 1USPA 4S1TA 3CXCZ 2GTIA 5IP7I 4A3BI 1JJ2Z 4RVGA 3GTGI 3JAMf 1Z03A 2GTHA 2NVQI 3S1NI 1RO4A 2RBLA 1M902 2Q4ZA 4AYBA 1YUAA 1VQOZ 4HGYA 3JAMb 1Y1VI 3J80f 1Z01A 3CMA1 1TWGI 1VQ61 2BJOA 4NB8A 4NBGA 4E2WA 3J81b 2K3RA 3CMAZ 2O53A 3D6WA 1KQSY 1ZB8A 3LUSA 2WAQA 3GCFA 1VQM1 5CM2M 2W03A 2NVXI 2IV2X 3S14I 3S1MI 1W2BY 4QTUA 3NH8A 1SIWA 4NBEA 3FKII 1P9NA 1YUKA 2E2JI 3VMHA 3I56Z 1KD11 2JR6A 2OTL1 2OTJZ 3J81f 3TDHB 1Q812 3H3VJ 5FLMI 1K8A2 1YIJZ 1RO2A 1QYPA 2RIQA 2OTLZ 2V45A 2VUMI 1RLYA 4HH4A 1K8A1 3TE5B 3BG1B 4BY1I 4A3CI 2VPZA 1KD12 3MZKB 2PMZA 1W2BZ 1TWAI 1VQ9Z 1VQ81 3U50C 3HOZI 2YADA 3NH4A 2F4OA 2JA8I 2GU2A 4NBHA 3S2HI 4E31A 1K83I 2IZ3A 1R9TI 3CCE1 1I6HI 2JA6I 3GTQI 4X6AI 2RHBA 1TWCI 3IX0A 1Q16A 4RVHA 4E33A 4DQYB 3S1RI 2NVTI 2OOYB
chains in the Genus database with same CATH topology
2P3YA 3CCSZ 3CCJZ 1JJ2Y 3VTNA 4NBDA 3G6EZ 1TWHI 1VQ6Z 2JS4A 3NDIA 1M1K2 2DE7A 3BG0B 4QTTA 2G2KA 1WCMI 1I50I 1PFTA 1VQKZ 4HGZA 1YJN1 2K5RA 1VQP1 2LIYA 4A3LI 3OW2Z 1KRLA 1VQPZ 4NH1C 4A3KI 4DGLA 2AKLA 4NOZA 3MZLB 3CC2Z 3CCUZ 3G71Z 2KPIA 4RV9A 5D1OA 4E2YA 3G711 4BBRI 3VMGA 3GTOI 1YI2Z 3NDJA 2E9HA 1VQ91 1VQ8Z 4BBSI 3KIHA 2QRDB 4MH4A 3CCRZ 4A3JI 2PK7A 3GTMI 1K9M1 3PO3S 2OZKA 3CCR1 4NB9A 5A2Qf 2M48A 2QLVB 3I4MI 1NJI1 4Y7NI 3CD61 2F4MA 4NBAA 1YITZ 1QVFY 2JA5I 2H85A 3GKQA 1Y1VS 4DK1A 3J7A4 1ZH1A 3F3PC 3S15I 3NFZA 1QVGY 3G4S1 4MRIA 3K7AI 5IT9b 2KI7B 1KC81 3CCMZ 2QKDA 4MD9A 3CPWZ 5T6BA 4NBBA 4RVFA 1Q7Y1 1JWHC 2W04A 3CCM1 3GTMS 3PO3I 2NVYI 1QF8A 1X0TA 1YJNZ 3J80b 5AN9F 1KQSZ 4A3MI 4E2XA 3CPWY 1Q861 4A3II 3G6E1 3HOWI 2P28A 3I55Z 3CC71 2JNYA 1VQL1 3H0GI 2HF1A 5D1OB 3D9XA 3CCL1 4A3GI 3I551 3I4NI 3CC7Z 1RQFA 1N2FA 2RT9A 1K9M2 2JUBA 5IT9f 1NP6A 1K731 1S7MA 2QRCB 5D1PA 5C44I 2OTJ1 3HOXI 1VQN1 2R7ZI 4EWCA 3EEDA 1TWFI 4MD7A 4A3DI 1VQNZ 1NUIA 1S72Z 2E2II 4E2ZA 4E32A 1VQ4Z 3FQMA 2PM9A 1Y1WI 1YJW1 1Q7Y2 5C4JI 4NFRA 1SFOI 1YHQZ 2I3CA 4A3FI 1KC82 2QA4Z 3CC4Z 2EGTA 1YHQ1 2QREB 1NJI2 1K732 2VF1A 3CCEZ 3GTKI 1Q822 3QWUA 3HOUI 2OOXB 4NBFA 1QVGZ 3EERA 2V8IA 3CMEZ 3I07A 3PO2I 4RS4A 2R6MA 3FQQA 1RNIA 3CME1 3M3YI 3Q87A 1Q821 3CCS1 3CCJ1 1M901 5FLXb 2QR1B 2QEX1 3T4NB 1ML8A 5C4XI 3S2DI 3RZOI 1YIT1 3P5JB 3VMIA 5IP9I 1USPB 1VLAA 2WB1A 2Y0SA 3GTPI 4NBCA 3S16I 3HOYI 3G4SZ 4TNUA 4Y52I 5A2Qb 2Q51A 1VQ51 1DL6A 1ZB9A 3MONA 4MD8A 2LFUA 2R93I 4BXXI 1VQMZ 2ZAEB 1YJ9Z 2R92I 1N8R1 1VQK1 3KIFA 3CCV1 1WIIA 2J6AA 1YJ91 3CCQZ 3OW2Y 3F3FC 1N8R2 1S721 1VQO1 3CCVZ 1VQ41 3CCQ1 3M4OI 1YIJ1 1VQLZ 3GTLI 4E30A 5FLXf 1X3ZA 4MONA 3GTJI 1YJWZ 3CCLZ 4A3EI 1YI21 1Q862 1L1OC 3CC21 3CCU1 1Q811 2JA7I 1RO0A 2V8KA 3CXCY 1X3WA 2RPRA 3S17I 3RZDI 2VUGA 4MXUA 2M6NA 2O4HA 4XX2A 3NH5A 4CL1A 3I561 2HU9A 2YU9I 4A93I 1QVFZ 2DE6A 2JMOA 5LL6f 1WW9A 3VB9A 2DE5A 1LQLA 2QEXZ 5T67A 3CC41 2QA41 3ESWA 1TFIA 3IF8A 3HOVI 3IFUA 3CD6Z 2B63I 1I3QI 3HKZA 3CQZI 4BY7I 1VQ5Z 5T64A 4RVDA 2IZ4A 1VQ71 5C3EI 1M1K1 2E2HI 1VQ7Z 1Z02A 3S1QI 2V8JA 1USPA 4S1TA 3CXCZ 2GTIA 5IP7I 4A3BI 1JJ2Z 4RVGA 3GTGI 3JAMf 1Z03A 2GTHA 2NVQI 3S1NI 1RO4A 2RBLA 1M902 2Q4ZA 4AYBA 1YUAA 1VQOZ 4HGYA 3JAMb 1Y1VI 3J80f 1Z01A 3CMA1 1TWGI 1VQ61 2BJOA 4NB8A 4NBGA 4E2WA 3J81b 2K3RA 3CMAZ 2O53A 3D6WA 1KQSY 1ZB8A 3LUSA 2WAQA 3GCFA 1VQM1 5CM2M 2W03A 2NVXI 3S14I 3S1MI 1W2BY 4QTUA 3NH8A 4NBEA 3FKII 1P9NA 1YUKA 2E2JI 3VMHA 3I56Z 1KD11 2JR6A 2OTL1 2OTJZ 3J81f 3TDHB 1Q812 3H3VJ 5FLMI 1K8A2 1YIJZ 1RO2A 1QYPA 2RIQA 2OTLZ 2VUMI 1RLYA 4HH4A 1K8A1 3TE5B 3BG1B 4BY1I 4A3CI 1KD12 3MZKB 2PMZA 1W2BZ 1TWAI 1VQ9Z 1VQ81 3U50C 3HOZI 2YADA 3NH4A 2F4OA 2JA8I 2GU2A 4NBHA 3S2HI 4E31A 1K83I 2IZ3A 1R9TI 3CCE1 1I6HI 2JA6I 3GTQI 4X6AI 2RHBA 1TWCI 3IX0A 4RVHA 4E33A 4DQYB 3S1RI 2NVTI 2OOYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7A 4;  3JAM b;  5LL6 f;  3J81 b;  5IT9 b;  5A2Q b;  3J80 b;  5FLX b; 
#chains in the Genus database with same CATH topology
 2P3Y A;  3CCS Z;  3CCJ Z;  1JJ2 Y;  3VTN A;  2LEX A;  4NBD A;  3G6E Z;  1TWH I;  1VQ6 Z;  2JS4 A;  3NDI A;  1M1K 2;  2DE7 A;  3BG0 B;  4QTT A;  2G2K A;  1WCM I;  1I50 I;  1PFT A;  1VQK Z;  4HGZ A;  1YJN 1;  2K5R A;  1VQP 1;  2LIY A;  4A3L I;  3OW2 Z;  1KRL A;  1VQP Z;  4NH1 C;  4A3K I;  4DGL A;  2AKL A;  4NOZ A;  3MZL B;  3CC2 Z;  3CCU Z;  3G71 Z;  2KPI A;  4RV9 A;  5D1O A;  4E2Y A;  3G71 1;  4BBR I;  2VPW A;  3VMG A;  3GTO I;  1YI2 Z;  3NDJ A;  2E9H A;  1VQ9 1;  1VQ8 Z;  4BBS I;  3KIH A;  2QRD B;  4MH4 A;  3CCR Z;  1Y8C A;  4A3J I;  2PK7 A;  1WJ2 A;  3GTM I;  1K9M 1;  3PO3 S;  2OZK A;  3CCR 1;  4NB9 A;  5A2Q f;  2M48 A;  2JIR A;  2QLV B;  3I4M I;  1NJI 1;  4Y7N I;  3CD6 1;  2F4M A;  4NBA A;  1YIT Z;  1QVF Y;  2JA5 I;  2H85 A;  3GKQ A;  1Y1V S;  4DK1 A;  3J7A 4;  1ZH1 A;  3F3P C;  3S15 I;  3NFZ A;  1QVG Y;  3G4S 1;  4MRI A;  3K7A I;  5IT9 b;  2KI7 B;  1KC8 1;  3CCM Z;  2QKD A;  4MD9 A;  3CPW Z;  5T6B A;  4NBB A;  4RVF A;  1Q7Y 1;  1JWH C;  2W04 A;  3CCM 1;  3GTM S;  3PO3 I;  2NVY I;  1QF8 A;  1X0T A;  1YJN Z;  3J80 b;  5AN9 F;  1KQS Z;  4A3M I;  4E2X A;  3CPW Y;  1Q86 1;  4A3I I;  3G6E 1;  3HOW I;  2P28 A;  3I55 Z;  3CC7 1;  2JNY A;  1VQL 1;  3H0G I;  2HF1 A;  5D1O B;  3D9X A;  3CCL 1;  2JIM A;  4A3G I;  3I55 1;  3I4N I;  3CC7 Z;  1RQF A;  1N2F A;  1AA6 A;  2RT9 A;  1K9M 2;  2JUB A;  5IT9 f;  2E7Z A;  1NP6 A;  1K73 1;  1FDI A;  1S7M A;  2QRC B;  5D1P A;  5C44 I;  2OTJ 1;  3HOX I;  1VQN 1;  2R7Z I;  4EWC A;  3EED A;  1TWF I;  4MD7 A;  4A3D I;  1VQN Z;  1NUI A;  1S72 Z;  2E2I I;  4E2Z A;  4E32 A;  1VQ4 Z;  2JIO A;  3D2L A;  3FQM A;  2PM9 A;  1Y1W I;  1YJW 1;  1Q7Y 2;  5C4J I;  4NFR A;  1SFO I;  1YHQ Z;  2I3C A;  4A3F I;  1KC8 2;  2QA4 Z;  3CC4 Z;  2EGT A;  1YHQ 1;  2QRE B;  1NJI 2;  1K73 2;  2VF1 A;  3CCE Z;  3GTK I;  1Q82 2;  3QWU A;  3HOU I;  2OOX B;  4NBF A;  1QVG Z;  3EER A;  2V8I A;  3CME Z;  3I07 A;  3PO2 I;  4RS4 A;  2VPY A;  2R6M A;  3FQQ A;  1RNI A;  3CME 1;  3M3Y I;  3Q87 A;  1Q82 1;  3CCS 1;  3CCJ 1;  1M90 1;  2NAP A;  5FLX b;  2QR1 B;  2QEX 1;  3T4N B;  1ML8 A;  5C4X I;  3S2D I;  3RZO I;  1YIT 1;  3P5J B;  3VMI A;  5IP9 I;  1USP B;  1VLA A;  2WB1 A;  2Y0S A;  3GTP I;  4NBC A;  3S16 I;  3HOY I;  3G4S Z;  4TNU A;  4Y52 I;  5A2Q b;  2Q51 A;  1VQ5 1;  1DL6 A;  1ZB9 A;  3MON A;  4MD8 A;  2LFU A;  2R93 I;  4BXX I;  1QXF A;  1VQM Z;  2ZAE B;  3IR7 A;  1YJ9 Z;  2R92 I;  1N8R 1;  1VQK 1;  3KIF A;  3CCV 1;  1WII A;  2J6A A;  1YJ9 1;  3CCQ Z;  3OW2 Y;  3F3F C;  1N8R 2;  1S72 1;  1VQO 1;  3CCV Z;  1VQ4 1;  3CCQ 1;  3M4O I;  1YIJ 1;  1VQL Z;  3GTL I;  4E30 A;  5FLX f;  1X3Z A;  2VPX A;  4MON A;  3GTJ I;  1YJW Z;  3CCL Z;  4A3E I;  1YI2 1;  1Q86 2;  1L1O C;  2AYD A;  3CC2 1;  2JIQ A;  3CCU 1;  1Q81 1;  2JA7 I;  1RO0 A;  2V8K A;  3CXC Y;  1X3W A;  2RPR A;  3S17 I;  3RZD I;  2VUG A;  4MXU A;  2M6N A;  2O4H A;  4XX2 A;  3NH5 A;  4CL1 A;  2JIP A;  3I56 1;  2HU9 A;  2YU9 I;  4A93 I;  1QVF Z;  1WZN A;  2DE6 A;  2JMO A;  2V3V A;  5LL6 f;  1WW9 A;  3VB9 A;  2DE5 A;  1LQL A;  2QEX Z;  5T67 A;  3CC4 1;  2QA4 1;  3ESW A;  1TFI A;  3IF8 A;  3HOV I;  3IFU A;  3CD6 Z;  1FDO A;  2B63 I;  1I3Q I;  3HKZ A;  3CQZ I;  4BY7 I;  1VQ5 Z;  5T64 A;  4RVD A;  2IZ4 A;  1VQ7 1;  5C3E I;  1M1K 1;  2E2H I;  1VQ7 Z;  1Z02 A;  3S1Q I;  2V8J A;  1USP A;  4S1T A;  3CXC Z;  2GTI A;  5IP7 I;  4A3B I;  1JJ2 Z;  4RVG A;  3GTG I;  3JAM f;  1Z03 A;  2GTH A;  2NVQ I;  3S1N I;  1RO4 A;  2RBL A;  1M90 2;  2Q4Z A;  4AYB A;  1YUA A;  1VQO Z;  4HGY A;  3JAM b;  1Y1V I;  3J80 f;  1Z01 A;  3CMA 1;  1TWG I;  1VQ6 1;  2BJO A;  4NB8 A;  4NBG A;  4E2W A;  3J81 b;  2K3R A;  3CMA Z;  2O53 A;  3D6W A;  1KQS Y;  1ZB8 A;  3LUS A;  2WAQ A;  3GCF A;  1VQM 1;  5CM2 M;  2W03 A;  2NVX I;  2IV2 X;  3S14 I;  3S1M I;  1W2B Y;  4QTU A;  3NH8 A;  1SIW A;  4NBE A;  3FKI I;  1P9N A;  1YUK A;  2E2J I;  3VMH A;  3I56 Z;  1KD1 1;  2JR6 A;  2OTL 1;  2OTJ Z;  3J81 f;  3TDH B;  1Q81 2;  3H3V J;  5FLM I;  1K8A 2;  1YIJ Z;  1RO2 A;  1QYP A;  2RIQ A;  2OTL Z;  2V45 A;  2VUM I;  1RLY A;  4HH4 A;  1K8A 1;  3TE5 B;  3BG1 B;  4BY1 I;  4A3C I;  2VPZ A;  1KD1 2;  3MZK B;  2PMZ A;  1W2B Z;  1TWA I;  1VQ9 Z;  1VQ8 1;  3U50 C;  3HOZ I;  2YAD A;  3NH4 A;  2F4O A;  2JA8 I;  2GU2 A;  4NBH A;  3S2H I;  4E31 A;  1K83 I;  2IZ3 A;  1R9T I;  3CCE 1;  1I6H I;  2JA6 I;  3GTQ I;  4X6A I;  2RHB A;  1TWC I;  3IX0 A;  1Q16 A;  4RVH A;  4E33 A;  4DQY B;  3S1R I;  2NVT I;  2OOY B; 
#chains in the Genus database with same CATH homology
 2P3Y A;  3CCS Z;  3CCJ Z;  1JJ2 Y;  3VTN A;  4NBD A;  3G6E Z;  1TWH I;  1VQ6 Z;  2JS4 A;  3NDI A;  1M1K 2;  2DE7 A;  3BG0 B;  4QTT A;  2G2K A;  1WCM I;  1I50 I;  1PFT A;  1VQK Z;  4HGZ A;  1YJN 1;  2K5R A;  1VQP 1;  2LIY A;  4A3L I;  3OW2 Z;  1KRL A;  1VQP Z;  4NH1 C;  4A3K I;  4DGL A;  2AKL A;  4NOZ A;  3MZL B;  3CC2 Z;  3CCU Z;  3G71 Z;  2KPI A;  4RV9 A;  5D1O A;  4E2Y A;  3G71 1;  4BBR I;  3VMG A;  3GTO I;  1YI2 Z;  3NDJ A;  2E9H A;  1VQ9 1;  1VQ8 Z;  4BBS I;  3KIH A;  2QRD B;  4MH4 A;  3CCR Z;  4A3J I;  2PK7 A;  3GTM I;  1K9M 1;  3PO3 S;  2OZK A;  3CCR 1;  4NB9 A;  5A2Q f;  2M48 A;  2QLV B;  3I4M I;  1NJI 1;  4Y7N I;  3CD6 1;  2F4M A;  4NBA A;  1YIT Z;  1QVF Y;  2JA5 I;  2H85 A;  3GKQ A;  1Y1V S;  4DK1 A;  3J7A 4;  1ZH1 A;  3F3P C;  3S15 I;  3NFZ A;  1QVG Y;  3G4S 1;  4MRI A;  3K7A I;  5IT9 b;  2KI7 B;  1KC8 1;  3CCM Z;  2QKD A;  4MD9 A;  3CPW Z;  5T6B A;  4NBB A;  4RVF A;  1Q7Y 1;  1JWH C;  2W04 A;  3CCM 1;  3GTM S;  3PO3 I;  2NVY I;  1QF8 A;  1X0T A;  1YJN Z;  3J80 b;  5AN9 F;  1KQS Z;  4A3M I;  4E2X A;  3CPW Y;  1Q86 1;  4A3I I;  3G6E 1;  3HOW I;  2P28 A;  3I55 Z;  3CC7 1;  2JNY A;  1VQL 1;  3H0G I;  2HF1 A;  5D1O B;  3D9X A;  3CCL 1;  4A3G I;  3I55 1;  3I4N I;  3CC7 Z;  1RQF A;  1N2F A;  2RT9 A;  1K9M 2;  2JUB A;  5IT9 f;  1NP6 A;  1K73 1;  1S7M A;  2QRC B;  5D1P A;  5C44 I;  2OTJ 1;  3HOX I;  1VQN 1;  2R7Z I;  4EWC A;  3EED A;  1TWF I;  4MD7 A;  4A3D I;  1VQN Z;  1NUI A;  1S72 Z;  2E2I I;  4E2Z A;  4E32 A;  1VQ4 Z;  3FQM A;  2PM9 A;  1Y1W I;  1YJW 1;  1Q7Y 2;  5C4J I;  4NFR A;  1SFO I;  1YHQ Z;  2I3C A;  4A3F I;  1KC8 2;  2QA4 Z;  3CC4 Z;  2EGT A;  1YHQ 1;  2QRE B;  1NJI 2;  1K73 2;  2VF1 A;  3CCE Z;  3GTK I;  1Q82 2;  3QWU A;  3HOU I;  2OOX B;  4NBF A;  1QVG Z;  3EER A;  2V8I A;  3CME Z;  3I07 A;  3PO2 I;  4RS4 A;  2R6M A;  3FQQ A;  1RNI A;  3CME 1;  3M3Y I;  3Q87 A;  1Q82 1;  3CCS 1;  3CCJ 1;  1M90 1;  5FLX b;  2QR1 B;  2QEX 1;  3T4N B;  1ML8 A;  5C4X I;  3S2D I;  3RZO I;  1YIT 1;  3P5J B;  3VMI A;  5IP9 I;  1USP B;  1VLA A;  2WB1 A;  2Y0S A;  3GTP I;  4NBC A;  3S16 I;  3HOY I;  3G4S Z;  4TNU A;  4Y52 I;  5A2Q b;  2Q51 A;  1VQ5 1;  1DL6 A;  1ZB9 A;  3MON A;  4MD8 A;  2LFU A;  2R93 I;  4BXX I;  1VQM Z;  2ZAE B;  1YJ9 Z;  2R92 I;  1N8R 1;  1VQK 1;  3KIF A;  3CCV 1;  1WII A;  2J6A A;  1YJ9 1;  3CCQ Z;  3OW2 Y;  3F3F C;  1N8R 2;  1S72 1;  1VQO 1;  3CCV Z;  1VQ4 1;  3CCQ 1;  3M4O I;  1YIJ 1;  1VQL Z;  3GTL I;  4E30 A;  5FLX f;  1X3Z A;  4MON A;  3GTJ I;  1YJW Z;  3CCL Z;  4A3E I;  1YI2 1;  1Q86 2;  1L1O C;  3CC2 1;  3CCU 1;  1Q81 1;  2JA7 I;  1RO0 A;  2V8K A;  3CXC Y;  1X3W A;  2RPR A;  3S17 I;  3RZD I;  2VUG A;  4MXU A;  2M6N A;  2O4H A;  4XX2 A;  3NH5 A;  4CL1 A;  3I56 1;  2HU9 A;  2YU9 I;  4A93 I;  1QVF Z;  2DE6 A;  2JMO A;  5LL6 f;  1WW9 A;  3VB9 A;  2DE5 A;  1LQL A;  2QEX Z;  5T67 A;  3CC4 1;  2QA4 1;  3ESW A;  1TFI A;  3IF8 A;  3HOV I;  3IFU A;  3CD6 Z;  2B63 I;  1I3Q I;  3HKZ A;  3CQZ I;  4BY7 I;  1VQ5 Z;  5T64 A;  4RVD A;  2IZ4 A;  1VQ7 1;  5C3E I;  1M1K 1;  2E2H I;  1VQ7 Z;  1Z02 A;  3S1Q I;  2V8J A;  1USP A;  4S1T A;  3CXC Z;  2GTI A;  5IP7 I;  4A3B I;  1JJ2 Z;  4RVG A;  3GTG I;  3JAM f;  1Z03 A;  2GTH A;  2NVQ I;  3S1N I;  1RO4 A;  2RBL A;  1M90 2;  2Q4Z A;  4AYB A;  1YUA A;  1VQO Z;  4HGY A;  3JAM b;  1Y1V I;  3J80 f;  1Z01 A;  3CMA 1;  1TWG I;  1VQ6 1;  2BJO A;  4NB8 A;  4NBG A;  4E2W A;  3J81 b;  2K3R A;  3CMA Z;  2O53 A;  3D6W A;  1KQS Y;  1ZB8 A;  3LUS A;  2WAQ A;  3GCF A;  1VQM 1;  5CM2 M;  2W03 A;  2NVX I;  3S14 I;  3S1M I;  1W2B Y;  4QTU A;  3NH8 A;  4NBE A;  3FKI I;  1P9N A;  1YUK A;  2E2J I;  3VMH A;  3I56 Z;  1KD1 1;  2JR6 A;  2OTL 1;  2OTJ Z;  3J81 f;  3TDH B;  1Q81 2;  3H3V J;  5FLM I;  1K8A 2;  1YIJ Z;  1RO2 A;  1QYP A;  2RIQ A;  2OTL Z;  2VUM I;  1RLY A;  4HH4 A;  1K8A 1;  3TE5 B;  3BG1 B;  4BY1 I;  4A3C I;  1KD1 2;  3MZK B;  2PMZ A;  1W2B Z;  1TWA I;  1VQ9 Z;  1VQ8 1;  3U50 C;  3HOZ I;  2YAD A;  3NH4 A;  2F4O A;  2JA8 I;  2GU2 A;  4NBH A;  3S2H I;  4E31 A;  1K83 I;  2IZ3 A;  1R9T I;  3CCE 1;  1I6H I;  2JA6 I;  3GTQ I;  4X6A I;  2RHB A;  1TWC I;  3IX0 A;  4RVH A;  4E33 A;  4DQY B;  3S1R I;  2NVT I;  2OOY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...