5IUNA

Crystal structure of the desk-desr complex in the phosphatase state
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
221
structure length
216
Chain Sequence
GIIKLRKEIERLEEKLEDANERIAELVKLEERQRIARDLHDTLGQKLSLIGLKSDLARKLIYKDPEQAARELKSVQQTARTSLNEVRKIVSSMKGIRLKDELINIKQILEAADIMFIYEEEKWPENISLLNENILSMCLKEAVTNVVKHSQAKTCRVDIQQLWKEVVITVSDDGTFKGSKGHGLLGMRERLEFANGSLHIDTENGTKLTMAIPNNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/gene regulation
molecule keywords Sensor histidine kinase DesK
publication title Regulation of signaling directionality revealed by 3D snapshots of a kinase:regulator complex in action.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 77
structure length 216
sequence length 221
chains with identical sequence B, E
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2016-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07730 HisKA_3 Histidine kinase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...