5IWQA

Crystal structure of aspartate aminotransferase (aspat) from corynebacterium glutamicum atcc 13032
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
424
structure length
424
Chain Sequence
b'VSLQDFDAERIGLFHEDIKRKFDELKSKNLKLDLTRGKPSSEQLDFADELLALPGKGDFKAADGTDVRNYGGLDGIVDIRQIWADLLGVPVEQVLAGDASSLNIMFDVISWSYIFGNNDSVQPWSKEETVKWICPVPGYDRHFSITERFGFEMISVPMNEDGPDMDAVEELVKNPQVKGMWVVPVFSNPTGFTVTEDVAKRLSAMETAAPDFRVVWDNAYAVHTLTDEFPEVIDIVGLGEAAGNPNRFWAFTSTSKITLAGAGVSFFLTSAENRKWYTGHAGIRGIGPNKVNQLAHARYFGDAEGVRAVMRKHAASLAPKFNKVLEILDSRLAEYGVAQWTVPAGGYFISLDVVPGTASRVAELAKEAGIALTGAGSSYPLRQDPENKNLRLAPSLPPVEELEVAMDGVATCVLLAAAEHYANL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title Structural Insights into a Novel Class of Aspartate Aminotransferase from Corynebacterium glutamicum.
pubmed doi rcsb
source organism Corynebacterium glutamicum (strain atcc 13032 / dsm 20300 / jcm 1318 / lmg 3730
molecule tags Transferase
total genus 153
structure length 424
sequence length 424
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2016-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12897 Aminotran_MocR Alanine-glyoxylate amino-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 5iwqA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 5iwqA01
1DGDA 1I43A 3CQ6A 1BS0A 1BW0A 2AATA 3EI5A 2Z20A 1GD9A 3ZRQA 2W7JA 2BI3A 2YKYA 4GSAA 4RAEA 4W91A 1DJ9A 2F8JA 4JF0A 5M49A 1W23A 3PPLA 4F5KA 4BA5A 2BIGA 1M4NA 1S09A 3OP7A 2AY5A 3K40A 4ATQA 4GE4A 1M0QA 2HUIA 1AIBA 1B9HA 2QMAA 3CQ4A 4WYDA 1J32A 1WYTA 1AHFA 2DR1A 4IXZA 5I92A 2CJHA 1EG5A 1AY5A 1GC3A 4UHMA 1AHXA 1GC4A 1YJYA 3COGA 4WYGA 4LNLA 1W7LA 3AENB 2O0RA 1ARHA 1ASMA 2XH1A 5EUNA 1JS3A 3FZ7A 1LC8A 3H7FA 4HF8A 3B8XA 2QLRA 1Z3ZA 3FDBA 3NYTA 1C7OA 4J8LA 3AEOA 1ASDA 4E3RA 3T32A 2ZY5A 2VLHA 3LG0A 2AY7A 1TATA 1QITA 2ZC0A 2CH2A 3K7YA 3LY1A 3TFTA 1DJEA 2EZ1A 4R5FA 3WKRA 4IYOA 4H51A 4A0FA 4UQVA 3P1TA 4Y0HA 1G4VA 4GRXA 1D7VA 4RITA 1WYTB 2VMSA 3JW9A 4GDYA 1JF9A 3EI6A 4XQ2A 4WB0A 2ZSLA 2CSTA 2E7IA 2W7LA 3RQ1A 4IXOA 2D5YA 3GSBA 1ASEA 2VIBA 3PAAA 1OXPA 2FNUA 4OC9A 3LVJA 1H0CA 4R5ZA 3BWOA 4TV7A 1M32A 4MSOA 4F5JA 1GEWA 3CAIA 4F5LA 4W5KA 3Q8NA 1AAWA 1QJ3A 1X28A 3BCAA 2VMRA 3A9ZA 1G7WA 3KGWA 2W7MA 2AY9A 1WYUB 1XEYA 3HVYA 2Z9VA 2D63A 3N0LA 3PIUA 2WK9A 3TFUA 4OYTA 2D64A 1Z7DA 1X29A 4Q75A 1SZUA 1ARTA 2Z1ZA 4ZM4A 4EB7A 3DZZA 4W1VA 3BS8A 1BJWA 3E2YA 3JWAA 4ZDOA 3EZSA 2C81A 4A00A 2JGTA 1BQDA 3VP6A 2G6WA 2VLFA 4RM1A 1C4KA 4NOGA 2QB3A 2DKJA 3EIAA 2PB2A 1IX8A 1N31A 1TOJA 3MADA 3G8MA 1M0OA 4XJLA 4CBSA 2ZYJA 4IX8A 2HOZA 5EIGB 1AHEA 2OQXA 5EAAA 2D65A 2BWPA 3HLMA 3LVMA 1H1CA 1AKBA 3G7QA 3GZDC 1LK9A 1LS3A 5AX8A 2FYFA 2ZSMA 4B9BA 3MEBA 3ZRRA 5DB5A 4U1TA 2JJGA 5G0AA 3WY7A 1C9CA 3DR7A 1M0PA 3DC1A 4FL0A 4GE9A 4OBUA 1P3WA 1LKCA 1RVUA 1DTYA 1TOEA 3UAKA 2AEVA 1TOGA 2JJFA 1GCKA 3FSLA 3LVKA 2C0RA 3E9KA 3NTJA 4N0BA 1OHYA 2HUUA 3A9YA 2DOUA 4F4EA 3FVUA 5EFSA 2W8VA 4R8DA 1BJ4A 1V2DA 1MDOA 1WYVA 3PDXA 1YOOA 4K2BA 4TMRA 1EJIA 2OGEA 2VMQA 3L8AA 2OATA 4B98A 4RIZA 3WGBA 3UWCA 3FZ6A 8AATA 2CINA 3BB8A 1TASA 3DYDA 2YHKA 4KAMA 3AOVA 1I48A 1LC5A 4M2KA 3PJ0A 1V2EA 5D95A 3GR9A 4O6ZA 2R5CB 2W8TA 1JG8A 2FQ6A 3NU8A 1D2FA 2DGLA 2GMUA 1PG8A 5E3KA 3JWBA 2AY1A 2FM1A 2GSAA 2HORA 3K28A 4IW7A 5J8QA 5M46A 3JZLA 1O69A 3R9AA 3ZRPA 3FFRA 1W7MA 4TN4A 2WK7A 3NU7A 1ASCA 4ADDA 1DFOA 2ORDA 4JE5D 4AZKA 4P3MA 3FDDA 1AKCA 2WK8A 4R2NA 2YKXA 3MC6A 2PB0A 3OKSA 2VMZA 1UU1A 4QGRA 3VK3A 3NNKA 4P7YA 2ZY3A 1YJSA 2W7FA 3AEJC 3ATHA 2D7ZA 3E2ZA 2CH1A 3JTXA 1ZC9A 3I5TA 1BJOA 4A6TA 2HP1A 4WYAA 3VOMA 4XJPA 2BI2A 1GDEA 1FC4A 3AEPA 3PA9A 1QZ9A 5DJ1A 1B5PA 2CTZA 3GWPA 4WP0A 1ZODA 3FTBA 4ZDPA 1D7SA 2TPLA 3D6KA 3AV7A 2HOXA 3EZ1A 3HDOA 4ZM3A 1AJSA 2EPJA 3NUBA 4AH3A 5HHYA 1B4XA 3RBFA 2VGZA 1MDXA 5DJ9A 3GZCA 4BQ0A 1SZKA 2VIAA 1ARGA 4EU1A 1KL1A 1IUGA 1MAQA 1ASFA 5JAYA 2VMOA 3W1IA 2CY8A 5E4ZA 3HBXA 4BHDA 2WKAA 3HQTA 2YKUA 2V0YA 3EIBA 3N5MA 4RJYA 1VP4A 3BWNA 2VGSA 1IAYA 3IF2A 7AATA 3A8UX 3G0TA 3HT4A 2NMPA 1LW4A 1I41A 3QGUA 1AJSB 3QPGA 1T3IA 4OMAA 1M7YA 2DKBA 4PVFA 1BQAA 2YRIA 2D61A 4AZJA 4F5MA 4IY7A 5G2PA 4A72A 4AO4A 3LVLB 2AY4A 1TPLA 4JF1A 4ITGA 1ARIA 4ADEA 9AATA 2VMWA 4RKCA 2W8JA 2VMYA 1AAMA 2VGVA 3FVSA 3I16A 4E3QA 2Z1YA 1ELUA 1PMMA 1YAAA 1MAPA 4IYOB 4MKJA 3QBOA 1OHVA 3TQXA 1CQ8A 3ISLA 4EB5A 2GQNA 4N0WA 4WB0B 4MQRA 1EQBA 3BV0A 1QJ5A 3PDBA 3FQ8A 3NYUA 2EZ2A 3PGYA 4F5HA 2ZP7A 1DJUA 3NUIA 3ZZKA 1AY4A 4CXQA 2X3LA 2BI9A 3II0A 1AHYA 1CS1A 4KXKA 3FFHA 1OHWA 1ORDA 3FQAA 1YNUA 1AJRA 1YJZA 2W8UA 1TOIA 3H14A 3LV2A 2ZY2A 2HOYA 2VI8A 1SFFA 2YOBA 2R2NA 2X8UA 1BJNA 3BCXA 3PD6A 1UU0A 2X5FA 5FT8A 5FT5A 4OBVA 4CXRA 2VMNA 3KKIA 4MY5A 3VK4A 3EUCA 4MQPA 2BYJA 1GC0A 1ASGA 3NYSA 4HVKA 1WSTA 2VYCA 2CB1A 2HUFA 3AOWA 3GBXA 1PMOA 4Q31A 3RUYA 2YCPA 3PDBB 2YRRA 3E2FA 3MAUA 5F9SA 1N8PA 5BJ3A 4GE7A 5LH9A 2E54A 3HMUA 4PFFA 4AO9A 1ASLA 1U08A 5IWQA 1IX6A 2Z9WA 4J5UA 4M2JA 4UHOA 4A0GA 2BWOA 4E77A 3RBLA 2R0TA 3MKJA 4PFNA 2CANA 2VI9A 3F0HA 1VJOA 2OKJA 5HDMA 1BT4A 1J04A 4BMKA 4WYFA 2AY8A 4OT8A 1AHGA 4Y0IA 3W1HA 4MGRA 4EFFA 5HXXA 4A6RA 1W3UA 3AEMA 3B46A 4ADBA 3ASAA 2VMUA 1AX4A 1FG3A 2YCNA 4ZASA 3TATA 1CQ7A 2BYLA 1QIRA 3TCMA 1TARA 3UE8A 2CJGA 3F6TA 1QISA 3LWSA 1DKAA 3QI6A 1WKHA 1CZCA 2CJDA 2JISA 3W1JA 3DRDA 2BIEA 1V2FA 2GMSA 4ADCA 5FT4A 1GBNA 1CJ0A 1FG7A 1TOKA 3FZ8A 4WXBA 4JEXA 1DGEA 1MDZA 1QGNA 3DXVA 1WYVB 4W1WA 4BA4A 4DGTA 3ACZA 3CBFA 1ASBA 3NDNA 1CZEA 4ISYA 4XEWA 5BJ4A 1ZOBA 5EAVA 1X2AA 4MKKA 4KYOA 4L0OA 3KGXA 4ITXA 2C44A 1AICA 1B9IA 4LW4A 4A6UA 2VMXA 3ASBA 2VGUA 1WKGA 4FFCA 3MC6C 1O61A 5E5IA 3NX3A 4MQQA 3BN1A 3AENA 2YKVA 5TF5A 3WCNA 1E5EA 1B5OA 5LHAA 5DX5A 4WXGA 1RVYA 3MAFA 2FNIA 4ZAHA 2OGAA 1B8GA 4WD2A 4WBTA 4F5GA 4XAUA 1AY8A 3ELPA 3N75A 4I8AA 3QN6A 2BI5A 1RV3A 4JE5A 1KMKA 1O62A 2EH6A 1X0MA 1AMSA 1YIYA 1IX7A 3E2ZB 2VMTA 1GEYA 1N2TA 2ZUKA 1BJOB 2EO5A 4JEVA 4LNMA 3DU4A 4W8IA 1C7GA 1GC2A 1S06A 1O4SA 4WLJA 3I4JA 3AELA 4RKDA 1S07A 2BHXA 2YCTA 1PFFA 2AY2A 2W7GA 4UHNA 4A0HA 1IAXA 2V1PA 2W7IA 3QM2A 2VMVA 1UU2A 2EGYA 3A2BA 3R4TA 2VGTA 3MAFB 4RJ0A 2ZJGA 1S08A 3RI6A 2AY6A 2VGWA 1G4XA 5G4JA 5K8BA 3HL2A 4U2HA 2HZPA 1CL2A 3B1DA 3BWNC 1OATA 1MLZA 2D7YA 1G7XA 2E7JA 1WYUA 1E5FA 4DBCA 5G09A 4CVQA 2W8WA 2O1BA 1SPAA 5M4DA 1S0AA 2XBNA 2W7DA 4WYEA 2BKWA 3FQ7A 4ZLVA 3EI8A 4AOAA 1IBJA 2VMPA 3NRAA 1KMJA 4XJMA 1ELQA 2O7CA 2QA3A 3EI7A 3WZFA 2BIAA 4K2IA 1KKJA 1I29A 3MBBA 1IVRA 3E77A 1YIZA 1KL2A 2Z9UA 3B1CA 5EIGA 5C6UA 3IHJA 5FT6A 3ELEA 3DR4A 1BKGA 3QHXA 5EUDA 1AMQA 2JJEA 4CBRA 2W7EA 2CFBA 3A9XA 4JEZA 2HP2A 4W1XA 2AY3A 3E6GA 1D7RA 1ASNA 4JEYA 3CQ5A 4UOYA 4ZDLA 4IXSA 5G2QA 1ASAA 1V72A 4LC3A 2Z61A 3FVXA 2BWNA 2PO3A 1C7NA 2DGKA 3GZDA 3L44A 4GEBA 1KKPA 3BCBA 4F5FA 1AMAA 1OXOA 2OKKA 1LC7A 1AMRA 1LW5A 2Z67A 2RFVA 3JU7A 3F9TA 3EI9A 4XK1A 1MGVA 2X5DA 4JEWA 3WLXA 1CQ6A 1AIAA 3RCHA 1AKAA 3FCRA 4LNJA 4RLGA 3WCOA 4Q6RA 1C0NA 4M2MA 1UKJA 2FN6A 3PD6B 4Q76A 1SF2A 3FRKA 2JJHA 2JG2A 1RV4A 3FD0A 2Q7WA 2W7HA 3M5UA 2R5CA 3USFA 4F5IA 4OCAA 1W7NA 4WXFA 2DGMA 2QB2A 1D7UA 1JS6A 2QBTA 4ZSYA 4ZWMA 3WKSA 3B1EA 4OTLA 1CL1A 2ZY4A 5D5SA 3AEMC 4ZSWA 1MLYA 4A0RA 3GETA 3WX9A 4WYCA 4E1OA 3WGCA 2R5EA 3ECDA 3RCHB 4EMYA 5M4BA 1M6SA 1XI9A 1M0NA 1Y4IA 3KE3A 2BI1A 4PIWA 2W7KA 3VK2A 1ARSA 1IJIA 3BC8A 5G4IA 3AATA 4WLHA 1SVVA 2Z9XA 5EQCA 4K2MA 4ZWVA 5EUEA 4XJOA 4DQ6A 4LW2A 4ATPA 4Y0DA 2GB3A 3GJUA 3DODA 5F8VA 3VAXA 2D66A 3FKDA 2E7UA 1SZSA 3DXWA 1GEXA 3P6KA 1VEFA 2AEUA 2C7TA 3ZZJA 1ECXA 3AEJA
chains in the Genus database with same CATH superfamily
1DGDA 1I43A 3CQ6A 1BS0A 1BW0A 2AATA 3EI5A 2Z20A 1GD9A 3ZRQA 2W7JA 2BI3A 2YKYA 4GSAA 4RAEA 4W91A 1DJ9A 2F8JA 4JF0A 5M49A 1W23A 3PPLA 4F5KA 4BA5A 2BIGA 1M4NA 1S09A 3OP7A 2AY5A 3K40A 4ATQA 4GE4A 1M0QA 2HUIA 1AIBA 1B9HA 2QMAA 3CQ4A 1KAFA 4WYDA 1J32A 1WYTA 1AHFA 2DR1A 4IXZA 5I92A 2CJHA 1EG5A 1AY5A 1GC3A 4UHMA 1AHXA 1GC4A 1YJYA 3COGA 4WYGA 4LNLA 1W7LA 3AENB 2O0RA 1ARHA 1ASMA 2XH1A 5EUNA 1JS3A 3FZ7A 1LC8A 3H7FA 4HF8A 3B8XA 2QLRA 1Z3ZA 3FDBA 3NYTA 1C7OA 4J8LA 3AEOA 1ASDA 4E3RA 3T32A 2ZY5A 2VLHA 2A1VA 3LG0A 2AY7A 1TATA 1QITA 2ZC0A 2CH2A 3K7YA 3LY1A 3TFTA 5KTBA 1DJEA 2EZ1A 4R5FA 3WKRA 4IYOA 4H51A 4A0FA 4UQVA 3P1TA 4Y0HA 1G4VA 4GRXA 1D7VA 3N7NA 4RITA 1WYTB 2VMSA 3JW9A 4GDYA 1JF9A 3EI6A 4XQ2A 4WB0A 2ZSLA 2CSTA 2E7IA 2W7LA 3RQ1A 4IXOA 2D5YA 3GSBA 1ASEA 2VIBA 3PAAA 1OXPA 2FNUA 4OC9A 3LVJA 1H0CA 4R5ZA 3BWOA 4TV7A 1M32A 4MSOA 4F5JA 1GEWA 3CAIA 4F5LA 4W5KA 3Q8NA 1AAWA 1QJ3A 1X28A 3BCAA 2VMRA 3A9ZA 1G7WA 3KGWA 2W7MA 2AY9A 1WYUB 1XEYA 3HVYA 2Z9VA 2D63A 3N0LA 3PIUA 2WK9A 3TFUA 4OYTA 2D64A 1Z7DA 1X29A 4Q75A 1SZUA 1ARTA 2Z1ZA 4ZM4A 4EB7A 3DZZA 4W1VA 3BS8A 1BJWA 3E2YA 3JWAA 4ZDOA 3EZSA 2C81A 4A00A 2JGTA 1BQDA 3VP6A 2G6WA 2VLFA 4RM1A 1C4KA 4NOGA 2QB3A 2DKJA 3EIAA 2PB2A 1IX8A 1N31A 1TOJA 3MADA 3G8MA 1M0OA 4XJLA 4CBSA 2ZYJA 4IX8A 2HOZA 5EIGB 1AHEA 2OQXA 5EAAA 2D65A 2BWPA 3HLMA 3LVMA 1H1CA 1AKBA 3G7QA 3GZDC 1LK9A 1LS3A 5AX8A 2FYFA 2ZSMA 4B9BA 3MEBA 3ZRRA 5DB5A 4U1TA 2JJGA 5G0AA 3WY7A 1C9CA 3DR7A 1M0PA 3DC1A 4FL0A 4GE9A 4OBUA 1P3WA 1LKCA 1RVUA 1DTYA 1TOEA 3UAKA 2AEVA 1TOGA 2JJFA 1GCKA 3FSLA 3LVKA 2C0RA 3E9KA 3NTJA 4N0BA 1OHYA 2HUUA 3A9YA 2DOUA 4F4EA 3FVUA 5EFSA 2W8VA 4R8DA 1BJ4A 1V2DA 1MDOA 1WYVA 3PDXA 1YOOA 4K2BA 4TMRA 1EJIA 2OGEA 2VMQA 3L8AA 2OATA 4B98A 4RIZA 3WGBA 3UWCA 3FZ6A 8AATA 2CINA 3BB8A 1TASA 3DYDA 2YHKA 4KAMA 3AOVA 1I48A 1LC5A 4M2KA 3PJ0A 1V2EA 5D95A 3GR9A 4O6ZA 2R5CB 2W8TA 1JG8A 2FQ6A 3NU8A 1D2FA 2DGLA 2GMUA 1PG8A 5E3KA 3JWBA 2AY1A 2FM1A 2GSAA 2HORA 3K28A 4IW7A 5J8QA 5M46A 3JZLA 1O69A 3R9AA 3ZRPA 3FFRA 1W7MA 4TN4A 2WK7A 3NU7A 1ASCA 4ADDA 1DFOA 2ORDA 4JE5D 4AZKA 4P3MA 3FDDA 1AKCA 2WK8A 4R2NA 2YKXA 3MC6A 2PB0A 3OKSA 2VMZA 1UU1A 4QGRA 3VK3A 3NNKA 4P7YA 2ZY3A 1YJSA 2W7FA 3AEJC 3ATHA 2D7ZA 3E2ZA 2CH1A 3JTXA 1ZC9A 3I5TA 1BJOA 4A6TA 2HP1A 4WYAA 3VOMA 4XJPA 4H63Q 2BI2A 1GDEA 1FC4A 3AEPA 3PA9A 1QZ9A 5DJ1A 1B5PA 2CTZA 3GWPA 4WP0A 1ZODA 3FTBA 4ZDPA 1D7SA 2TPLA 3D6KA 3AV7A 2HOXA 3EZ1A 3HDOA 4ZM3A 1AJSA 2EPJA 3NUBA 4AH3A 5HHYA 1B4XA 3RBFA 2VGZA 1MDXA 5DJ9A 3GZCA 4BQ0A 2QSRA 1SZKA 2VIAA 1ARGA 3N4SA 4EU1A 1KL1A 1IUGA 1MAQA 1ASFA 5JAYA 2VMOA 3W1IA 4K05A 2CY8A 5E4ZA 3HBXA 4BHDA 2WKAA 3HQTA 2YKUA 2V0YA 3EIBA 3N5MA 4RJYA 1VP4A 3BWNA 2VGSA 1IAYA 3IF2A 7AATA 3A8UX 3G0TA 3HT4A 2NMPA 1LW4A 1I41A 3QGUA 1AJSB 3QPGA 1T3IA 4OMAA 1M7YA 2DKBA 4PVFA 1BQAA 2YRIA 2D61A 4AZJA 4F5MA 4IY7A 5G2PA 4A72A 4AO4A 3LVLB 2AY4A 1TPLA 4JF1A 4ITGA 1ARIA 4ADEA 9AATA 2VMWA 4RKCA 2W8JA 2VMYA 1AAMA 2VGVA 3FVSA 3I16A 4E3QA 2Z1YA 1ELUA 1PMMA 1YAAA 1MAPA 4IYOB 4MKJA 3QBOA 1OHVA 3TQXA 1CQ8A 3ISLA 4EB5A 2GQNA 4N0WA 4WB0B 4MQRA 1EQBA 3BV0A 1QJ5A 3PDBA 3FQ8A 3NYUA 2EZ2A 3PGYA 4F5HA 2ZP7A 1DJUA 3NUIA 3ZZKA 1AY4A 4CXQA 2X3LA 2BI9A 3II0A 1AHYA 1CS1A 3N4XA 4KXKA 3FFHA 1OHWA 1ORDA 3FQAA 1YNUA 1AJRA 1YJZA 2W8UA 1TOIA 3H14A 3LV2A 2ZY2A 2HOYA 2VI8A 1SFFA 2YOBA 2R2NA 2X8UA 1BJNA 3BCXA 3PD6A 1UU0A 2X5FA 5FT8A 5FT5A 4OBVA 4CXRA 2VMNA 3KKIA 4MY5A 3VK4A 3EUCA 4MQPA 2BYJA 1GC0A 1ASGA 3NYSA 4HVKA 1WSTA 2VYCA 2CB1A 2HUFA 3AOWA 3GBXA 1PMOA 4Q31A 3RUYA 2YCPA 3PDBB 2YRRA 3E2FA 3MAUA 5F9SA 1N8PA 5BJ3A 4GE7A 5LH9A 2E54A 3HMUA 4PFFA 4AO9A 1ASLA 1U08A 5IWQA 1IX6A 2Z9WA 4J5UA 4M2JA 4UHOA 4A0GA 2BWOA 4E77A 3RBLA 2R0TA 3MKJA 4PFNA 2CANA 2VI9A 3F0HA 1VJOA 2OKJA 5HDMA 1BT4A 1J04A 4BMKA 4WYFA 2AY8A 4OT8A 1AHGA 4Y0IA 3W1HA 4MGRA 4EFFA 5HXXA 4A6RA 1W3UA 3AEMA 3B46A 4ADBA 3ASAA 2VMUA 1AX4A 1FG3A 2YCNA 4ZASA 3TATA 1CQ7A 2BYLA 1QIRA 3TCMA 1TARA 3UE8A 2CJGA 3F6TA 1QISA 3LWSA 1DKAA 3QI6A 1WKHA 1CZCA 2CJDA 2JISA 3W1JA 3DRDA 2BIEA 1V2FA 2GMSA 4ADCA 5FT4A 1GBNA 1CJ0A 1FG7A 1TOKA 3FZ8A 4WXBA 2EYQA 4JEXA 1DGEA 1MDZA 1QGNA 3DXVA 1WYVB 4W1WA 4BA4A 4DGTA 3ACZA 3CBFA 1ASBA 3NDNA 1CZEA 4ISYA 4XEWA 5BJ4A 1ZOBA 5EAVA 1X2AA 4MKKA 4KYOA 4L0OA 3KGXA 4ITXA 2C44A 1AICA 1B9IA 4LW4A 4A6UA 2VMXA 3ASBA 2VGUA 1WKGA 4FFCA 3MC6C 1O61A 5E5IA 3NX3A 4MQQA 3BN1A 3AENA 2YKVA 5TF5A 3WCNA 1E5EA 1B5OA 5LHAA 5DX5A 4WXGA 1RVYA 3MAFA 2FNIA 4ZAHA 2OGAA 1B8GA 4WD2A 4WBTA 4F5GA 4XAUA 1AY8A 3ELPA 3N75A 4I8AA 3QN6A 2BI5A 1RV3A 4JE5A 1KMKA 1O62A 2EH6A 1X0MA 1AMSA 1YIYA 1IX7A 3E2ZB 2VMTA 1GEYA 1N2TA 2ZUKA 1BJOB 2EO5A 4JEVA 4LNMA 3DU4A 4W8IA 1C7GA 1GC2A 1S06A 1O4SA 4WLJA 3I4JA 3AELA 4RKDA 1S07A 2BHXA 2YCTA 1PFFA 2AY2A 2W7GA 4UHNA 4A0HA 1IAXA 2V1PA 2W7IA 3QM2A 2VMVA 1UU2A 2EGYA 3A2BA 3R4TA 2VGTA 3MAFB 4RJ0A 2ZJGA 1S08A 3RI6A 2AY6A 2VGWA 1G4XA 5G4JA 5K8BA 3HL2A 3H9XA 4U2HA 2HZPA 1CL2A 3B1DA 3BWNC 1OATA 1MLZA 2D7YA 2FKIA 1G7XA 2E7JA 1WYUA 1E5FA 4DBCA 5G09A 4CVQA 2W8WA 2O1BA 1SPAA 5M4DA 1S0AA 2XBNA 2WB6A 2W7DA 4WYEA 2BKWA 3FQ7A 4ZLVA 3EI8A 4AOAA 1IBJA 2VMPA 3NRAA 1KMJA 4XJMA 1ELQA 2O7CA 2QA3A 3EI7A 3WZFA 2BIAA 4K2IA 1KKJA 1I29A 3MBBA 1IVRA 3E77A 1YIZA 1KL2A 2Z9UA 3B1CA 5EIGA 5C6UA 3IHJA 5FT6A 3ELEA 3DR4A 1BKGA 3QHXA 5EUDA 1AMQA 2JJEA 4CBRA 2W7EA 2CFBA 3A9XA 4JEZA 2HP2A 4W1XA 2AY3A 3E6GA 1D7RA 1ASNA 4JEYA 3CQ5A 4UOYA 4ZDLA 2KFPA 4IXSA 5G2QA 1ASAA 1V72A 4LC3A 2Z61A 3FVXA 2BWNA 2PO3A 1C7NA 2DGKA 3GZDA 3L44A 4GEBA 1KKPA 3BCBA 4F5FA 3N4RA 1AMAA 1OXOA 2OKKA 1LC7A 1AMRA 1LW5A 2Z67A 2RFVA 3JU7A 3F9TA 3EI9A 4XK1A 1MGVA 2X5DA 4JEWA 3WLXA 1CQ6A 1AIAA 3RCHA 1AKAA 3FCRA 4LNJA 4RLGA 3WCOA 4Q6RA 1C0NA 4M2MA 1UKJA 2FN6A 3PD6B 4Q76A 1SF2A 3FRKA 2JJHA 2JG2A 1RV4A 3FD0A 2Q7WA 2W7HA 3M5UA 2R5CA 3USFA 4F5IA 4OCAA 1W7NA 4WXFA 2G7JA 2DGMA 2QB2A 1D7UA 1JS6A 2QBTA 4ZSYA 4ZWMA 3WKSA 3B1EA 4OTLA 1CL1A 2ZY4A 5D5SA 3AEMC 4ZSWA 1MLYA 4A0RA 3GETA 3WX9A 4WYCA 4E1OA 3WGCA 2R5EA 3ECDA 3RCHB 4EMYA 5M4BA 1M6SA 1XI9A 1M0NA 1Y4IA 3KE3A 2BI1A 4PIWA 2W7KA 3VK2A 1ARSA 1IJIA 3BC8A 5G4IA 3AATA 4WLHA 1SVVA 2Z9XA 5EQCA 4K2MA 4ZWVA 5EUEA 4XJOA 4DQ6A 4LW2A 4ATPA 4Y0DA 2GB3A 3GJUA 3DODA 5F8VA 3VAXA 2D66A 3FKDA 2E7UA 1SZSA 3DXWA 1GEXA 3P6KA 1VEFA 2AEUA 2C7TA 3ZZJA 1ECXA 3AEJA
chains in the Genus database with same CATH topology
1DGDA 1I43A 3CQ6A 1BS0A 1BW0A 2AATA 3EI5A 2Z20A 1GD9A 3ZRQA 2W7JA 2BI3A 2YKYA 4GSAA 4RAEA 4W91A 1DJ9A 2F8JA 4JF0A 5M49A 1W23A 3PPLA 4F5KA 4BA5A 2BIGA 1M4NA 1S09A 3OP7A 2AY5A 3K40A 4ATQA 4GE4A 1M0QA 2HUIA 1AIBA 1B9HA 2QMAA 3CQ4A 4WYDA 1J32A 1WYTA 1AHFA 2DR1A 4IXZA 5I92A 2CJHA 1EG5A 1AY5A 1GC3A 4UHMA 1AHXA 1GC4A 1YJYA 3COGA 4WYGA 4LNLA 1W7LA 3AENB 2O0RA 1ARHA 1ASMA 2XH1A 5EUNA 1JS3A 3FZ7A 1LC8A 3H7FA 4HF8A 3B8XA 2QLRA 1Z3ZA 3FDBA 3NYTA 1C7OA 4J8LA 3AEOA 1ASDA 4E3RA 3T32A 2ZY5A 2VLHA 2A1VA 3LG0A 2AY7A 1TATA 1QITA 2ZC0A 2CH2A 3K7YA 3LY1A 3TFTA 5KTBA 1DJEA 2EZ1A 4R5FA 3WKRA 4IYOA 4H51A 4A0FA 4UQVA 3P1TA 4Y0HA 1G4VA 4GRXA 1D7VA 3N7NA 4RITA 1WYTB 2VMSA 3JW9A 4GDYA 1JF9A 3EI6A 4XQ2A 4WB0A 2ZSLA 2CSTA 2E7IA 2W7LA 3RQ1A 4IXOA 2D5YA 3GSBA 1ASEA 2VIBA 3PAAA 1OXPA 2FNUA 4OC9A 3LVJA 1H0CA 4R5ZA 3BWOA 4TV7A 1M32A 4MSOA 4F5JA 1GEWA 3CAIA 4F5LA 4W5KA 3Q8NA 1AAWA 1QJ3A 1X28A 3BCAA 2VMRA 3A9ZA 1G7WA 3KGWA 2W7MA 2AY9A 1WYUB 1XEYA 3HVYA 2Z9VA 2D63A 3N0LA 3PIUA 2WK9A 3TFUA 4OYTA 2D64A 1Z7DA 1X29A 4Q75A 1SZUA 1ARTA 2Z1ZA 4ZM4A 4EB7A 3DZZA 4W1VA 3BS8A 1BJWA 3E2YA 3JWAA 4ZDOA 3EZSA 2C81A 4A00A 2JGTA 1BQDA 3VP6A 2G6WA 2VLFA 4RM1A 1C4KA 4NOGA 2QB3A 2DKJA 3EIAA 2PB2A 1IX8A 1N31A 1TOJA 3MADA 3G8MA 1M0OA 4XJLA 4CBSA 2ZYJA 4IX8A 2HOZA 5EIGB 1AHEA 2OQXA 5EAAA 2D65A 2BWPA 3HLMA 3LVMA 1H1CA 1AKBA 3G7QA 3GZDC 1LK9A 1LS3A 5AX8A 2FYFA 2ZSMA 4B9BA 3MEBA 3ZRRA 5DB5A 4U1TA 2JJGA 5G0AA 3WY7A 1C9CA 3DR7A 1M0PA 3DC1A 4FL0A 4GE9A 4OBUA 1P3WA 1LKCA 1RVUA 1DTYA 1TOEA 3UAKA 2AEVA 1TOGA 2JJFA 1GCKA 3FSLA 3LVKA 2C0RA 3E9KA 3NTJA 4N0BA 1OHYA 2HUUA 3A9YA 2DOUA 4F4EA 3FVUA 5EFSA 2W8VA 4R8DA 1BJ4A 1V2DA 1MDOA 1WYVA 3PDXA 1YOOA 4K2BA 4TMRA 1EJIA 2OGEA 2VMQA 3L8AA 2OATA 4B98A 4RIZA 3WGBA 3UWCA 3FZ6A 8AATA 2CINA 3BB8A 1TASA 3DYDA 2YHKA 4KAMA 3AOVA 1I48A 1LC5A 4M2KA 3PJ0A 1V2EA 5D95A 3GR9A 4O6ZA 2R5CB 2W8TA 1JG8A 2FQ6A 3NU8A 1D2FA 2DGLA 2GMUA 1PG8A 5E3KA 3JWBA 2AY1A 2FM1A 2GSAA 2HORA 3K28A 4IW7A 5J8QA 5M46A 3JZLA 1O69A 3R9AA 3ZRPA 3FFRA 1W7MA 4TN4A 2WK7A 3NU7A 1ASCA 4ADDA 1DFOA 2ORDA 4JE5D 4AZKA 4P3MA 3FDDA 1AKCA 2WK8A 4R2NA 2YKXA 3MC6A 2PB0A 3OKSA 2VMZA 1UU1A 4QGRA 3VK3A 3NNKA 4P7YA 2ZY3A 1YJSA 2W7FA 3AEJC 3ATHA 2D7ZA 3E2ZA 2CH1A 3JTXA 1ZC9A 3I5TA 1BJOA 4A6TA 2HP1A 4WYAA 3VOMA 4XJPA 4H63Q 2BI2A 1GDEA 1FC4A 3AEPA 3PA9A 1QZ9A 5DJ1A 1B5PA 2CTZA 3GWPA 4WP0A 1ZODA 3FTBA 4ZDPA 1D7SA 2TPLA 3D6KA 3AV7A 2HOXA 3EZ1A 3HDOA 4ZM3A 1AJSA 2EPJA 3NUBA 4AH3A 5HHYA 1B4XA 3RBFA 2VGZA 1MDXA 5DJ9A 3GZCA 4BQ0A 2QSRA 1SZKA 2VIAA 1ARGA 3N4SA 4EU1A 1KL1A 1IUGA 1MAQA 1ASFA 5JAYA 2VMOA 3W1IA 4K05A 2CY8A 5E4ZA 3HBXA 4BHDA 2WKAA 3HQTA 2YKUA 2V0YA 3EIBA 3N5MA 4RJYA 1VP4A 3BWNA 2VGSA 1IAYA 3IF2A 7AATA 3A8UX 3G0TA 3HT4A 2NMPA 1LW4A 1I41A 3QGUA 1AJSB 3QPGA 1T3IA 4OMAA 1M7YA 2DKBA 4PVFA 1BQAA 2YRIA 2D61A 4AZJA 4F5MA 4IY7A 5G2PA 4A72A 4AO4A 3LVLB 2AY4A 1TPLA 4JF1A 4ITGA 1ARIA 4ADEA 9AATA 2VMWA 4RKCA 2W8JA 2VMYA 1AAMA 2VGVA 3FVSA 3I16A 4E3QA 2Z1YA 1ELUA 1PMMA 1YAAA 1MAPA 4IYOB 4MKJA 3QBOA 1OHVA 3TQXA 1CQ8A 3ISLA 4EB5A 2GQNA 4N0WA 4WB0B 4MQRA 1EQBA 3BV0A 1QJ5A 3PDBA 3FQ8A 3NYUA 2EZ2A 3PGYA 4F5HA 2ZP7A 1DJUA 3NUIA 3ZZKA 1AY4A 4CXQA 2X3LA 2BI9A 3II0A 1AHYA 1CS1A 3N4XA 4KXKA 3FFHA 1OHWA 1ORDA 3FQAA 1YNUA 1AJRA 1YJZA 2W8UA 1TOIA 3H14A 3LV2A 2ZY2A 2HOYA 2VI8A 1SFFA 2YOBA 2R2NA 2X8UA 1BJNA 3BCXA 3PD6A 1UU0A 2X5FA 5FT8A 5FT5A 4OBVA 4CXRA 2VMNA 3KKIA 4MY5A 3VK4A 3EUCA 4MQPA 2BYJA 1GC0A 1ASGA 3NYSA 4HVKA 1WSTA 2VYCA 2CB1A 2HUFA 3AOWA 3GBXA 1PMOA 4Q31A 3RUYA 2YCPA 3PDBB 2YRRA 3E2FA 3MAUA 5F9SA 1N8PA 5BJ3A 4GE7A 5LH9A 2E54A 3HMUA 4PFFA 4AO9A 1ASLA 1U08A 5IWQA 1IX6A 2Z9WA 4J5UA 4M2JA 4UHOA 4A0GA 2BWOA 4E77A 3RBLA 2R0TA 3MKJA 4PFNA 2CANA 2VI9A 3F0HA 1VJOA 2OKJA 5HDMA 1BT4A 1J04A 4BMKA 4WYFA 2AY8A 4OT8A 1AHGA 4Y0IA 3W1HA 4MGRA 4EFFA 5HXXA 4A6RA 1W3UA 3AEMA 3B46A 4ADBA 3ASAA 2VMUA 1AX4A 1FG3A 2YCNA 4ZASA 3TATA 1CQ7A 2BYLA 1QIRA 3TCMA 1TARA 3UE8A 2CJGA 3F6TA 1QISA 3LWSA 1DKAA 3QI6A 1WKHA 1CZCA 2CJDA 2JISA 3W1JA 3DRDA 2BIEA 1V2FA 2GMSA 4ADCA 5FT4A 1GBNA 1CJ0A 1FG7A 1TOKA 3FZ8A 4WXBA 2EYQA 4JEXA 1DGEA 1MDZA 1QGNA 3DXVA 1WYVB 4W1WA 4BA4A 4DGTA 3ACZA 3CBFA 1ASBA 3NDNA 1CZEA 4ISYA 4XEWA 5BJ4A 1ZOBA 5EAVA 1X2AA 4MKKA 4KYOA 4L0OA 3KGXA 4ITXA 2C44A 1AICA 1B9IA 4LW4A 4A6UA 2VMXA 3ASBA 2VGUA 1WKGA 4FFCA 3MC6C 1O61A 5E5IA 3NX3A 4MQQA 3BN1A 3AENA 2YKVA 5TF5A 3WCNA 1E5EA 1B5OA 5LHAA 5DX5A 4WXGA 1RVYA 3MAFA 2FNIA 4ZAHA 2OGAA 1B8GA 4WD2A 4WBTA 4F5GA 4XAUA 1AY8A 3ELPA 3N75A 4I8AA 3QN6A 2BI5A 1RV3A 4JE5A 1KMKA 1O62A 2EH6A 1X0MA 1AMSA 1YIYA 1IX7A 3E2ZB 2VMTA 1GEYA 1N2TA 2ZUKA 1BJOB 2EO5A 4JEVA 4LNMA 3DU4A 4W8IA 1C7GA 1GC2A 1S06A 1O4SA 4WLJA 3I4JA 3AELA 4RKDA 1S07A 2BHXA 2YCTA 1PFFA 2AY2A 2W7GA 4UHNA 4A0HA 1IAXA 2V1PA 2W7IA 3QM2A 2VMVA 1UU2A 2EGYA 3A2BA 3R4TA 2VGTA 3MAFB 4RJ0A 2ZJGA 1S08A 3RI6A 2AY6A 2VGWA 1G4XA 5G4JA 5K8BA 3HL2A 3H9XA 4U2HA 2HZPA 1CL2A 3B1DA 3BWNC 1OATA 1MLZA 2D7YA 2FKIA 1G7XA 2E7JA 1WYUA 1E5FA 4DBCA 5G09A 4CVQA 2W8WA 2O1BA 1SPAA 5M4DA 1S0AA 2XBNA 2WB6A 2W7DA 4WYEA 2BKWA 3FQ7A 4ZLVA 3EI8A 4AOAA 1IBJA 2VMPA 3NRAA 1KMJA 4XJMA 1ELQA 2O7CA 2QA3A 3EI7A 3WZFA 2BIAA 4K2IA 1KKJA 1I29A 3MBBA 1IVRA 3E77A 1YIZA 1KL2A 2Z9UA 3B1CA 5EIGA 5C6UA 3IHJA 5FT6A 3ELEA 3DR4A 1BKGA 3QHXA 5EUDA 1AMQA 2JJEA 4CBRA 2W7EA 2CFBA 3A9XA 4JEZA 2HP2A 4W1XA 2AY3A 3E6GA 1D7RA 1ASNA 4JEYA 3CQ5A 4UOYA 4ZDLA 2KFPA 4IXSA 5G2QA 1ASAA 1V72A 4LC3A 2Z61A 3FVXA 2BWNA 2PO3A 1C7NA 2DGKA 3GZDA 3L44A 4GEBA 1KKPA 3BCBA 4F5FA 3N4RA 1AMAA 1OXOA 2OKKA 1LC7A 1AMRA 1LW5A 2Z67A 2RFVA 3JU7A 3F9TA 3EI9A 4XK1A 1MGVA 2X5DA 4JEWA 3WLXA 1CQ6A 1AIAA 3RCHA 1AKAA 3FCRA 4LNJA 4RLGA 3WCOA 4Q6RA 1C0NA 4M2MA 1UKJA 2FN6A 3PD6B 4Q76A 1SF2A 3FRKA 2JJHA 2JG2A 1RV4A 3FD0A 2Q7WA 2W7HA 3M5UA 2R5CA 3USFA 4F5IA 4OCAA 1W7NA 4WXFA 2G7JA 2DGMA 2QB2A 1D7UA 1JS6A 2QBTA 4ZSYA 4ZWMA 3WKSA 3B1EA 4OTLA 1CL1A 2ZY4A 5D5SA 3AEMC 4ZSWA 1MLYA 4A0RA 3GETA 3WX9A 4WYCA 4E1OA 3WGCA 2R5EA 3ECDA 3RCHB 4EMYA 5M4BA 1M6SA 1XI9A 1M0NA 1Y4IA 3KE3A 2BI1A 4PIWA 2W7KA 3VK2A 1ARSA 1IJIA 3BC8A 5G4IA 3AATA 4WLHA 1SVVA 2Z9XA 5EQCA 4K2MA 4ZWVA 5EUEA 4XJOA 4DQ6A 4LW2A 4ATPA 4Y0DA 2GB3A 3GJUA 3DODA 5F8VA 3VAXA 2D66A 3FKDA 2E7UA 1SZSA 3DXWA 1GEXA 3P6KA 1VEFA 2AEUA 2C7TA 3ZZJA 1ECXA 3AEJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DGD A;  1I43 A;  3CQ6 A;  1BS0 A;  1BW0 A;  2AAT A;  3EI5 A;  2Z20 A;  1GD9 A;  3ZRQ A;  2W7J A;  2BI3 A;  2YKY A;  4GSA A;  4RAE A;  4W91 A;  1DJ9 A;  2F8J A;  4JF0 A;  5M49 A;  1W23 A;  3PPL A;  4F5K A;  4BA5 A;  2BIG A;  1M4N A;  1S09 A;  3OP7 A;  2AY5 A;  3K40 A;  4ATQ A;  4GE4 A;  1M0Q A;  2HUI A;  1AIB A;  1B9H A;  2QMA A;  3CQ4 A;  4WYD A;  1J32 A;  1WYT A;  1AHF A;  2DR1 A;  4IXZ A;  5I92 A;  2CJH A;  1EG5 A;  1AY5 A;  1GC3 A;  4UHM A;  1AHX A;  1GC4 A;  1YJY A;  3COG A;  4WYG A;  4LNL A;  1W7L A;  3AEN B;  2O0R A;  1ARH A;  1ASM A;  2XH1 A;  5EUN A;  1JS3 A;  3FZ7 A;  1LC8 A;  3H7F A;  4HF8 A;  3B8X A;  2QLR A;  1Z3Z A;  3FDB A;  3NYT A;  1C7O A;  4J8L A;  3AEO A;  1ASD A;  4E3R A;  3T32 A;  2ZY5 A;  2VLH A;  3LG0 A;  2AY7 A;  1TAT A;  1QIT A;  2ZC0 A;  2CH2 A;  3K7Y A;  3LY1 A;  3TFT A;  1DJE A;  2EZ1 A;  4R5F A;  3WKR A;  4IYO A;  4H51 A;  4A0F A;  4UQV A;  3P1T A;  4Y0H A;  1G4V A;  4GRX A;  1D7V A;  4RIT A;  1WYT B;  2VMS A;  3JW9 A;  4GDY A;  1JF9 A;  3EI6 A;  4XQ2 A;  4WB0 A;  2ZSL A;  2CST A;  2E7I A;  2W7L A;  3RQ1 A;  4IXO A;  2D5Y A;  3GSB A;  1ASE A;  2VIB A;  3PAA A;  1OXP A;  2FNU A;  4OC9 A;  3LVJ A;  1H0C A;  4R5Z A;  3BWO A;  4TV7 A;  1M32 A;  4MSO A;  4F5J A;  1GEW A;  3CAI A;  4F5L A;  4W5K A;  3Q8N A;  1AAW A;  1QJ3 A;  1X28 A;  3BCA A;  2VMR A;  3A9Z A;  1G7W A;  3KGW A;  2W7M A;  2AY9 A;  1WYU B;  1XEY A;  3HVY A;  2Z9V A;  2D63 A;  3N0L A;  3PIU A;  2WK9 A;  3TFU A;  4OYT A;  2D64 A;  1Z7D A;  1X29 A;  4Q75 A;  1SZU A;  1ART A;  2Z1Z A;  4ZM4 A;  4EB7 A;  3DZZ A;  4W1V A;  3BS8 A;  1BJW A;  3E2Y A;  3JWA A;  4ZDO A;  3EZS A;  2C81 A;  4A00 A;  2JGT A;  1BQD A;  3VP6 A;  2G6W A;  2VLF A;  4RM1 A;  1C4K A;  4NOG A;  2QB3 A;  2DKJ A;  3EIA A;  2PB2 A;  1IX8 A;  1N31 A;  1TOJ A;  3MAD A;  3G8M A;  1M0O A;  4XJL A;  4CBS A;  2ZYJ A;  4IX8 A;  2HOZ A;  5EIG B;  1AHE A;  2OQX A;  5EAA A;  2D65 A;  2BWP A;  3HLM A;  3LVM A;  1H1C A;  1AKB A;  3G7Q A;  3GZD C;  1LK9 A;  1LS3 A;  5AX8 A;  2FYF A;  2ZSM A;  4B9B A;  3MEB A;  3ZRR A;  5DB5 A;  4U1T A;  2JJG A;  5G0A A;  3WY7 A;  1C9C A;  3DR7 A;  1M0P A;  3DC1 A;  4FL0 A;  4GE9 A;  4OBU A;  1P3W A;  1LKC A;  1RVU A;  1DTY A;  1TOE A;  3UAK A;  2AEV A;  1TOG A;  2JJF A;  1GCK A;  3FSL A;  3LVK A;  2C0R A;  3E9K A;  3NTJ A;  4N0B A;  1OHY A;  2HUU A;  3A9Y A;  2DOU A;  4F4E A;  3FVU A;  5EFS A;  2W8V A;  4R8D A;  1BJ4 A;  1V2D A;  1MDO A;  1WYV A;  3PDX A;  1YOO A;  4K2B A;  4TMR A;  1EJI A;  2OGE A;  2VMQ A;  3L8A A;  2OAT A;  4B98 A;  4RIZ A;  3WGB A;  3UWC A;  3FZ6 A;  8AAT A;  2CIN A;  3BB8 A;  1TAS A;  3DYD A;  2YHK A;  4KAM A;  3AOV A;  1I48 A;  1LC5 A;  4M2K A;  3PJ0 A;  1V2E A;  5D95 A;  3GR9 A;  4O6Z A;  2R5C B;  2W8T A;  1JG8 A;  2FQ6 A;  3NU8 A;  1D2F A;  2DGL A;  2GMU A;  1PG8 A;  5E3K A;  3JWB A;  2AY1 A;  2FM1 A;  2GSA A;  2HOR A;  3K28 A;  4IW7 A;  5J8Q A;  5M46 A;  3JZL A;  1O69 A;  3R9A A;  3ZRP A;  3FFR A;  1W7M A;  4TN4 A;  2WK7 A;  3NU7 A;  1ASC A;  4ADD A;  1DFO A;  2ORD A;  4JE5 D;  4AZK A;  4P3M A;  3FDD A;  1AKC A;  2WK8 A;  4R2N A;  2YKX A;  3MC6 A;  2PB0 A;  3OKS A;  2VMZ A;  1UU1 A;  4QGR A;  3VK3 A;  3NNK A;  4P7Y A;  2ZY3 A;  1YJS A;  2W7F A;  3AEJ C;  3ATH A;  2D7Z A;  3E2Z A;  2CH1 A;  3JTX A;  1ZC9 A;  3I5T A;  1BJO A;  4A6T A;  2HP1 A;  4WYA A;  3VOM A;  4XJP A;  2BI2 A;  1GDE A;  1FC4 A;  3AEP A;  3PA9 A;  1QZ9 A;  5DJ1 A;  1B5P A;  2CTZ A;  3GWP A;  4WP0 A;  1ZOD A;  3FTB A;  4ZDP A;  1D7S A;  2TPL A;  3D6K A;  3AV7 A;  2HOX A;  3EZ1 A;  3HDO A;  4ZM3 A;  1AJS A;  2EPJ A;  3NUB A;  4AH3 A;  5HHY A;  1B4X A;  3RBF A;  2VGZ A;  1MDX A;  5DJ9 A;  3GZC A;  4BQ0 A;  1SZK A;  2VIA A;  1ARG A;  4EU1 A;  1KL1 A;  1IUG A;  1MAQ A;  1ASF A;  5JAY A;  2VMO A;  3W1I A;  2CY8 A;  5E4Z A;  3HBX A;  4BHD A;  2WKA A;  3HQT A;  2YKU A;  2V0Y A;  3EIB A;  3N5M A;  4RJY A;  1VP4 A;  3BWN A;  2VGS A;  1IAY A;  3IF2 A;  7AAT A;  3A8U X;  3G0T A;  3HT4 A;  2NMP A;  1LW4 A;  1I41 A;  3QGU A;  1AJS B;  3QPG A;  1T3I A;  4OMA A;  1M7Y A;  2DKB A;  4PVF A;  1BQA A;  2YRI A;  2D61 A;  4AZJ A;  4F5M A;  4IY7 A;  5G2P A;  4A72 A;  4AO4 A;  3LVL B;  2AY4 A;  1TPL A;  4JF1 A;  4ITG A;  1ARI A;  4ADE A;  9AAT A;  2VMW A;  4RKC A;  2W8J A;  2VMY A;  1AAM A;  2VGV A;  3FVS A;  3I16 A;  4E3Q A;  2Z1Y A;  1ELU A;  1PMM A;  1YAA A;  1MAP A;  4IYO B;  4MKJ A;  3QBO A;  1OHV A;  3TQX A;  1CQ8 A;  3ISL A;  4EB5 A;  2GQN A;  4N0W A;  4WB0 B;  4MQR A;  1EQB A;  3BV0 A;  1QJ5 A;  3PDB A;  3FQ8 A;  3NYU A;  2EZ2 A;  3PGY A;  4F5H A;  2ZP7 A;  1DJU A;  3NUI A;  3ZZK A;  1AY4 A;  4CXQ A;  2X3L A;  2BI9 A;  3II0 A;  1AHY A;  1CS1 A;  4KXK A;  3FFH A;  1OHW A;  1ORD A;  3FQA A;  1YNU A;  1AJR A;  1YJZ A;  2W8U A;  1TOI A;  3H14 A;  3LV2 A;  2ZY2 A;  2HOY A;  2VI8 A;  1SFF A;  2YOB A;  2R2N A;  2X8U A;  1BJN A;  3BCX A;  3PD6 A;  1UU0 A;  2X5F A;  5FT8 A;  5FT5 A;  4OBV A;  4CXR A;  2VMN A;  3KKI A;  4MY5 A;  3VK4 A;  3EUC A;  4MQP A;  2BYJ A;  1GC0 A;  1ASG A;  3NYS A;  4HVK A;  1WST A;  2VYC A;  2CB1 A;  2HUF A;  3AOW A;  3GBX A;  1PMO A;  4Q31 A;  3RUY A;  2YCP A;  3PDB B;  2YRR A;  3E2F A;  3MAU A;  5F9S A;  1N8P A;  5BJ3 A;  4GE7 A;  5LH9 A;  2E54 A;  3HMU A;  4PFF A;  4AO9 A;  1ASL A;  1U08 A;  5IWQ A;  1IX6 A;  2Z9W A;  4J5U A;  4M2J A;  4UHO A;  4A0G A;  2BWO A;  4E77 A;  3RBL A;  2R0T A;  3MKJ A;  4PFN A;  2CAN A;  2VI9 A;  3F0H A;  1VJO A;  2OKJ A;  5HDM A;  1BT4 A;  1J04 A;  4BMK A;  4WYF A;  2AY8 A;  4OT8 A;  1AHG A;  4Y0I A;  3W1H A;  4MGR A;  4EFF A;  5HXX A;  4A6R A;  1W3U A;  3AEM A;  3B46 A;  4ADB A;  3ASA A;  2VMU A;  1AX4 A;  1FG3 A;  2YCN A;  4ZAS A;  3TAT A;  1CQ7 A;  2BYL A;  1QIR A;  3TCM A;  1TAR A;  3UE8 A;  2CJG A;  3F6T A;  1QIS A;  3LWS A;  1DKA A;  3QI6 A;  1WKH A;  1CZC A;  2CJD A;  2JIS A;  3W1J A;  3DRD A;  2BIE A;  1V2F A;  2GMS A;  4ADC A;  5FT4 A;  1GBN A;  1CJ0 A;  1FG7 A;  1TOK A;  3FZ8 A;  4WXB A;  4JEX A;  1DGE A;  1MDZ A;  1QGN A;  3DXV A;  1WYV B;  4W1W A;  4BA4 A;  4DGT A;  3ACZ A;  3CBF A;  1ASB A;  3NDN A;  1CZE A;  4ISY A;  4XEW A;  5BJ4 A;  1ZOB A;  5EAV A;  1X2A A;  4MKK A;  4KYO A;  4L0O A;  3KGX A;  4ITX A;  2C44 A;  1AIC A;  1B9I A;  4LW4 A;  4A6U A;  2VMX A;  3ASB A;  2VGU A;  1WKG A;  4FFC A;  3MC6 C;  1O61 A;  5E5I A;  3NX3 A;  4MQQ A;  3BN1 A;  3AEN A;  2YKV A;  5TF5 A;  3WCN A;  1E5E A;  1B5O A;  5LHA A;  5DX5 A;  4WXG A;  1RVY A;  3MAF A;  2FNI A;  4ZAH A;  2OGA A;  1B8G A;  4WD2 A;  4WBT A;  4F5G A;  4XAU A;  1AY8 A;  3ELP A;  3N75 A;  4I8A A;  3QN6 A;  2BI5 A;  1RV3 A;  4JE5 A;  1KMK A;  1O62 A;  2EH6 A;  1X0M A;  1AMS A;  1YIY A;  1IX7 A;  3E2Z B;  2VMT A;  1GEY A;  1N2T A;  2ZUK A;  1BJO B;  2EO5 A;  4JEV A;  4LNM A;  3DU4 A;  4W8I A;  1C7G A;  1GC2 A;  1S06 A;  1O4S A;  4WLJ A;  3I4J A;  3AEL A;  4RKD A;  1S07 A;  2BHX A;  2YCT A;  1PFF A;  2AY2 A;  2W7G A;  4UHN A;  4A0H A;  1IAX A;  2V1P A;  2W7I A;  3QM2 A;  2VMV A;  1UU2 A;  2EGY A;  3A2B A;  3R4T A;  2VGT A;  3MAF B;  4RJ0 A;  2ZJG A;  1S08 A;  3RI6 A;  2AY6 A;  2VGW A;  1G4X A;  5G4J A;  5K8B A;  3HL2 A;  4U2H A;  2HZP A;  1CL2 A;  3B1D A;  3BWN C;  1OAT A;  1MLZ A;  2D7Y A;  1G7X A;  2E7J A;  1WYU A;  1E5F A;  4DBC A;  5G09 A;  4CVQ A;  2W8W A;  2O1B A;  1SPA A;  5M4D A;  1S0A A;  2XBN A;  2W7D A;  4WYE A;  2BKW A;  3FQ7 A;  4ZLV A;  3EI8 A;  4AOA A;  1IBJ A;  2VMP A;  3NRA A;  1KMJ A;  4XJM A;  1ELQ A;  2O7C A;  2QA3 A;  3EI7 A;  3WZF A;  2BIA A;  4K2I A;  1KKJ A;  1I29 A;  3MBB A;  1IVR A;  3E77 A;  1YIZ A;  1KL2 A;  2Z9U A;  3B1C A;  5EIG A;  5C6U A;  3IHJ A;  5FT6 A;  3ELE A;  3DR4 A;  1BKG A;  3QHX A;  5EUD A;  1AMQ A;  2JJE A;  4CBR A;  2W7E A;  2CFB A;  3A9X A;  4JEZ A;  2HP2 A;  4W1X A;  2AY3 A;  3E6G A;  1D7R A;  1ASN A;  4JEY A;  3CQ5 A;  4UOY A;  4ZDL A;  4IXS A;  5G2Q A;  1ASA A;  1V72 A;  4LC3 A;  2Z61 A;  3FVX A;  2BWN A;  2PO3 A;  1C7N A;  2DGK A;  3GZD A;  3L44 A;  4GEB A;  1KKP A;  3BCB A;  4F5F A;  1AMA A;  1OXO A;  2OKK A;  1LC7 A;  1AMR A;  1LW5 A;  2Z67 A;  2RFV A;  3JU7 A;  3F9T A;  3EI9 A;  4XK1 A;  1MGV A;  2X5D A;  4JEW A;  3WLX A;  1CQ6 A;  1AIA A;  3RCH A;  1AKA A;  3FCR A;  4LNJ A;  4RLG A;  3WCO A;  4Q6R A;  1C0N A;  4M2M A;  1UKJ A;  2FN6 A;  3PD6 B;  4Q76 A;  1SF2 A;  3FRK A;  2JJH A;  2JG2 A;  1RV4 A;  3FD0 A;  2Q7W A;  2W7H A;  3M5U A;  2R5C A;  3USF A;  4F5I A;  4OCA A;  1W7N A;  4WXF A;  2DGM A;  2QB2 A;  1D7U A;  1JS6 A;  2QBT A;  4ZSY A;  4ZWM A;  3WKS A;  3B1E A;  4OTL A;  1CL1 A;  2ZY4 A;  5D5S A;  3AEM C;  4ZSW A;  1MLY A;  4A0R A;  3GET A;  3WX9 A;  4WYC A;  4E1O A;  3WGC A;  2R5E A;  3ECD A;  3RCH B;  4EMY A;  5M4B A;  1M6S A;  1XI9 A;  1M0N A;  1Y4I A;  3KE3 A;  2BI1 A;  4PIW A;  2W7K A;  3VK2 A;  1ARS A;  1IJI A;  3BC8 A;  5G4I A;  3AAT A;  4WLH A;  1SVV A;  2Z9X A;  5EQC A;  4K2M A;  4ZWV A;  5EUE A;  4XJO A;  4DQ6 A;  4LW2 A;  4ATP A;  4Y0D A;  2GB3 A;  3GJU A;  3DOD A;  5F8V A;  3VAX A;  2D66 A;  3FKD A;  2E7U A;  1SZS A;  3DXW A;  1GEX A;  3P6K A;  1VEF A;  2AEU A;  2C7T A;  3ZZJ A;  1ECX A;  3AEJ A; 
#chains in the Genus database with same CATH topology
 1DGD A;  1I43 A;  3CQ6 A;  1BS0 A;  1BW0 A;  2AAT A;  3EI5 A;  2Z20 A;  1GD9 A;  3ZRQ A;  2W7J A;  2BI3 A;  2YKY A;  4GSA A;  4RAE A;  4W91 A;  1DJ9 A;  2F8J A;  4JF0 A;  5M49 A;  1W23 A;  3PPL A;  4F5K A;  4BA5 A;  2BIG A;  1M4N A;  1S09 A;  3OP7 A;  2AY5 A;  3K40 A;  4ATQ A;  4GE4 A;  1M0Q A;  2HUI A;  1AIB A;  1B9H A;  2QMA A;  3CQ4 A;  1KAF A;  4WYD A;  1J32 A;  1WYT A;  1AHF A;  2DR1 A;  4IXZ A;  5I92 A;  2CJH A;  1EG5 A;  1AY5 A;  1GC3 A;  4UHM A;  1AHX A;  1GC4 A;  1YJY A;  3COG A;  4WYG A;  4LNL A;  1W7L A;  3AEN B;  2O0R A;  1ARH A;  1ASM A;  2XH1 A;  5EUN A;  1JS3 A;  3FZ7 A;  1LC8 A;  3H7F A;  4HF8 A;  3B8X A;  2QLR A;  1Z3Z A;  3FDB A;  3NYT A;  1C7O A;  4J8L A;  3AEO A;  1ASD A;  4E3R A;  3T32 A;  2ZY5 A;  2VLH A;  2A1V A;  3LG0 A;  2AY7 A;  1TAT A;  1QIT A;  2ZC0 A;  2CH2 A;  3K7Y A;  3LY1 A;  3TFT A;  5KTB A;  1DJE A;  2EZ1 A;  4R5F A;  3WKR A;  4IYO A;  4H51 A;  4A0F A;  4UQV A;  3P1T A;  4Y0H A;  1G4V A;  4GRX A;  1D7V A;  3N7N A;  4RIT A;  1WYT B;  2VMS A;  3JW9 A;  4GDY A;  1JF9 A;  3EI6 A;  4XQ2 A;  4WB0 A;  2ZSL A;  2CST A;  2E7I A;  2W7L A;  3RQ1 A;  4IXO A;  2D5Y A;  3GSB A;  1ASE A;  2VIB A;  3PAA A;  1OXP A;  2FNU A;  4OC9 A;  3LVJ A;  1H0C A;  4R5Z A;  3BWO A;  4TV7 A;  1M32 A;  4MSO A;  4F5J A;  1GEW A;  3CAI A;  4F5L A;  4W5K A;  3Q8N A;  1AAW A;  1QJ3 A;  1X28 A;  3BCA A;  2VMR A;  3A9Z A;  1G7W A;  3KGW A;  2W7M A;  2AY9 A;  1WYU B;  1XEY A;  3HVY A;  2Z9V A;  2D63 A;  3N0L A;  3PIU A;  2WK9 A;  3TFU A;  4OYT A;  2D64 A;  1Z7D A;  1X29 A;  4Q75 A;  1SZU A;  1ART A;  2Z1Z A;  4ZM4 A;  4EB7 A;  3DZZ A;  4W1V A;  3BS8 A;  1BJW A;  3E2Y A;  3JWA A;  4ZDO A;  3EZS A;  2C81 A;  4A00 A;  2JGT A;  1BQD A;  3VP6 A;  2G6W A;  2VLF A;  4RM1 A;  1C4K A;  4NOG A;  2QB3 A;  2DKJ A;  3EIA A;  2PB2 A;  1IX8 A;  1N31 A;  1TOJ A;  3MAD A;  3G8M A;  1M0O A;  4XJL A;  4CBS A;  2ZYJ A;  4IX8 A;  2HOZ A;  5EIG B;  1AHE A;  2OQX A;  5EAA A;  2D65 A;  2BWP A;  3HLM A;  3LVM A;  1H1C A;  1AKB A;  3G7Q A;  3GZD C;  1LK9 A;  1LS3 A;  5AX8 A;  2FYF A;  2ZSM A;  4B9B A;  3MEB A;  3ZRR A;  5DB5 A;  4U1T A;  2JJG A;  5G0A A;  3WY7 A;  1C9C A;  3DR7 A;  1M0P A;  3DC1 A;  4FL0 A;  4GE9 A;  4OBU A;  1P3W A;  1LKC A;  1RVU A;  1DTY A;  1TOE A;  3UAK A;  2AEV A;  1TOG A;  2JJF A;  1GCK A;  3FSL A;  3LVK A;  2C0R A;  3E9K A;  3NTJ A;  4N0B A;  1OHY A;  2HUU A;  3A9Y A;  2DOU A;  4F4E A;  3FVU A;  5EFS A;  2W8V A;  4R8D A;  1BJ4 A;  1V2D A;  1MDO A;  1WYV A;  3PDX A;  1YOO A;  4K2B A;  4TMR A;  1EJI A;  2OGE A;  2VMQ A;  3L8A A;  2OAT A;  4B98 A;  4RIZ A;  3WGB A;  3UWC A;  3FZ6 A;  8AAT A;  2CIN A;  3BB8 A;  1TAS A;  3DYD A;  2YHK A;  4KAM A;  3AOV A;  1I48 A;  1LC5 A;  4M2K A;  3PJ0 A;  1V2E A;  5D95 A;  3GR9 A;  4O6Z A;  2R5C B;  2W8T A;  1JG8 A;  2FQ6 A;  3NU8 A;  1D2F A;  2DGL A;  2GMU A;  1PG8 A;  5E3K A;  3JWB A;  2AY1 A;  2FM1 A;  2GSA A;  2HOR A;  3K28 A;  4IW7 A;  5J8Q A;  5M46 A;  3JZL A;  1O69 A;  3R9A A;  3ZRP A;  3FFR A;  1W7M A;  4TN4 A;  2WK7 A;  3NU7 A;  1ASC A;  4ADD A;  1DFO A;  2ORD A;  4JE5 D;  4AZK A;  4P3M A;  3FDD A;  1AKC A;  2WK8 A;  4R2N A;  2YKX A;  3MC6 A;  2PB0 A;  3OKS A;  2VMZ A;  1UU1 A;  4QGR A;  3VK3 A;  3NNK A;  4P7Y A;  2ZY3 A;  1YJS A;  2W7F A;  3AEJ C;  3ATH A;  2D7Z A;  3E2Z A;  2CH1 A;  3JTX A;  1ZC9 A;  3I5T A;  1BJO A;  4A6T A;  2HP1 A;  4WYA A;  3VOM A;  4XJP A;  4H63 Q;  2BI2 A;  1GDE A;  1FC4 A;  3AEP A;  3PA9 A;  1QZ9 A;  5DJ1 A;  1B5P A;  2CTZ A;  3GWP A;  4WP0 A;  1ZOD A;  3FTB A;  4ZDP A;  1D7S A;  2TPL A;  3D6K A;  3AV7 A;  2HOX A;  3EZ1 A;  3HDO A;  4ZM3 A;  1AJS A;  2EPJ A;  3NUB A;  4AH3 A;  5HHY A;  1B4X A;  3RBF A;  2VGZ A;  1MDX A;  5DJ9 A;  3GZC A;  4BQ0 A;  2QSR A;  1SZK A;  2VIA A;  1ARG A;  3N4S A;  4EU1 A;  1KL1 A;  1IUG A;  1MAQ A;  1ASF A;  5JAY A;  2VMO A;  3W1I A;  4K05 A;  2CY8 A;  5E4Z A;  3HBX A;  4BHD A;  2WKA A;  3HQT A;  2YKU A;  2V0Y A;  3EIB A;  3N5M A;  4RJY A;  1VP4 A;  3BWN A;  2VGS A;  1IAY A;  3IF2 A;  7AAT A;  3A8U X;  3G0T A;  3HT4 A;  2NMP A;  1LW4 A;  1I41 A;  3QGU A;  1AJS B;  3QPG A;  1T3I A;  4OMA A;  1M7Y A;  2DKB A;  4PVF A;  1BQA A;  2YRI A;  2D61 A;  4AZJ A;  4F5M A;  4IY7 A;  5G2P A;  4A72 A;  4AO4 A;  3LVL B;  2AY4 A;  1TPL A;  4JF1 A;  4ITG A;  1ARI A;  4ADE A;  9AAT A;  2VMW A;  4RKC A;  2W8J A;  2VMY A;  1AAM A;  2VGV A;  3FVS A;  3I16 A;  4E3Q A;  2Z1Y A;  1ELU A;  1PMM A;  1YAA A;  1MAP A;  4IYO B;  4MKJ A;  3QBO A;  1OHV A;  3TQX A;  1CQ8 A;  3ISL A;  4EB5 A;  2GQN A;  4N0W A;  4WB0 B;  4MQR A;  1EQB A;  3BV0 A;  1QJ5 A;  3PDB A;  3FQ8 A;  3NYU A;  2EZ2 A;  3PGY A;  4F5H A;  2ZP7 A;  1DJU A;  3NUI A;  3ZZK A;  1AY4 A;  4CXQ A;  2X3L A;  2BI9 A;  3II0 A;  1AHY A;  1CS1 A;  3N4X A;  4KXK A;  3FFH A;  1OHW A;  1ORD A;  3FQA A;  1YNU A;  1AJR A;  1YJZ A;  2W8U A;  1TOI A;  3H14 A;  3LV2 A;  2ZY2 A;  2HOY A;  2VI8 A;  1SFF A;  2YOB A;  2R2N A;  2X8U A;  1BJN A;  3BCX A;  3PD6 A;  1UU0 A;  2X5F A;  5FT8 A;  5FT5 A;  4OBV A;  4CXR A;  2VMN A;  3KKI A;  4MY5 A;  3VK4 A;  3EUC A;  4MQP A;  2BYJ A;  1GC0 A;  1ASG A;  3NYS A;  4HVK A;  1WST A;  2VYC A;  2CB1 A;  2HUF A;  3AOW A;  3GBX A;  1PMO A;  4Q31 A;  3RUY A;  2YCP A;  3PDB B;  2YRR A;  3E2F A;  3MAU A;  5F9S A;  1N8P A;  5BJ3 A;  4GE7 A;  5LH9 A;  2E54 A;  3HMU A;  4PFF A;  4AO9 A;  1ASL A;  1U08 A;  5IWQ A;  1IX6 A;  2Z9W A;  4J5U A;  4M2J A;  4UHO A;  4A0G A;  2BWO A;  4E77 A;  3RBL A;  2R0T A;  3MKJ A;  4PFN A;  2CAN A;  2VI9 A;  3F0H A;  1VJO A;  2OKJ A;  5HDM A;  1BT4 A;  1J04 A;  4BMK A;  4WYF A;  2AY8 A;  4OT8 A;  1AHG A;  4Y0I A;  3W1H A;  4MGR A;  4EFF A;  5HXX A;  4A6R A;  1W3U A;  3AEM A;  3B46 A;  4ADB A;  3ASA A;  2VMU A;  1AX4 A;  1FG3 A;  2YCN A;  4ZAS A;  3TAT A;  1CQ7 A;  2BYL A;  1QIR A;  3TCM A;  1TAR A;  3UE8 A;  2CJG A;  3F6T A;  1QIS A;  3LWS A;  1DKA A;  3QI6 A;  1WKH A;  1CZC A;  2CJD A;  2JIS A;  3W1J A;  3DRD A;  2BIE A;  1V2F A;  2GMS A;  4ADC A;  5FT4 A;  1GBN A;  1CJ0 A;  1FG7 A;  1TOK A;  3FZ8 A;  4WXB A;  2EYQ A;  4JEX A;  1DGE A;  1MDZ A;  1QGN A;  3DXV A;  1WYV B;  4W1W A;  4BA4 A;  4DGT A;  3ACZ A;  3CBF A;  1ASB A;  3NDN A;  1CZE A;  4ISY A;  4XEW A;  5BJ4 A;  1ZOB A;  5EAV A;  1X2A A;  4MKK A;  4KYO A;  4L0O A;  3KGX A;  4ITX A;  2C44 A;  1AIC A;  1B9I A;  4LW4 A;  4A6U A;  2VMX A;  3ASB A;  2VGU A;  1WKG A;  4FFC A;  3MC6 C;  1O61 A;  5E5I A;  3NX3 A;  4MQQ A;  3BN1 A;  3AEN A;  2YKV A;  5TF5 A;  3WCN A;  1E5E A;  1B5O A;  5LHA A;  5DX5 A;  4WXG A;  1RVY A;  3MAF A;  2FNI A;  4ZAH A;  2OGA A;  1B8G A;  4WD2 A;  4WBT A;  4F5G A;  4XAU A;  1AY8 A;  3ELP A;  3N75 A;  4I8A A;  3QN6 A;  2BI5 A;  1RV3 A;  4JE5 A;  1KMK A;  1O62 A;  2EH6 A;  1X0M A;  1AMS A;  1YIY A;  1IX7 A;  3E2Z B;  2VMT A;  1GEY A;  1N2T A;  2ZUK A;  1BJO B;  2EO5 A;  4JEV A;  4LNM A;  3DU4 A;  4W8I A;  1C7G A;  1GC2 A;  1S06 A;  1O4S A;  4WLJ A;  3I4J A;  3AEL A;  4RKD A;  1S07 A;  2BHX A;  2YCT A;  1PFF A;  2AY2 A;  2W7G A;  4UHN A;  4A0H A;  1IAX A;  2V1P A;  2W7I A;  3QM2 A;  2VMV A;  1UU2 A;  2EGY A;  3A2B A;  3R4T A;  2VGT A;  3MAF B;  4RJ0 A;  2ZJG A;  1S08 A;  3RI6 A;  2AY6 A;  2VGW A;  1G4X A;  5G4J A;  5K8B A;  3HL2 A;  3H9X A;  4U2H A;  2HZP A;  1CL2 A;  3B1D A;  3BWN C;  1OAT A;  1MLZ A;  2D7Y A;  2FKI A;  1G7X A;  2E7J A;  1WYU A;  1E5F A;  4DBC A;  5G09 A;  4CVQ A;  2W8W A;  2O1B A;  1SPA A;  5M4D A;  1S0A A;  2XBN A;  2WB6 A;  2W7D A;  4WYE A;  2BKW A;  3FQ7 A;  4ZLV A;  3EI8 A;  4AOA A;  1IBJ A;  2VMP A;  3NRA A;  1KMJ A;  4XJM A;  1ELQ A;  2O7C A;  2QA3 A;  3EI7 A;  3WZF A;  2BIA A;  4K2I A;  1KKJ A;  1I29 A;  3MBB A;  1IVR A;  3E77 A;  1YIZ A;  1KL2 A;  2Z9U A;  3B1C A;  5EIG A;  5C6U A;  3IHJ A;  5FT6 A;  3ELE A;  3DR4 A;  1BKG A;  3QHX A;  5EUD A;  1AMQ A;  2JJE A;  4CBR A;  2W7E A;  2CFB A;  3A9X A;  4JEZ A;  2HP2 A;  4W1X A;  2AY3 A;  3E6G A;  1D7R A;  1ASN A;  4JEY A;  3CQ5 A;  4UOY A;  4ZDL A;  2KFP A;  4IXS A;  5G2Q A;  1ASA A;  1V72 A;  4LC3 A;  2Z61 A;  3FVX A;  2BWN A;  2PO3 A;  1C7N A;  2DGK A;  3GZD A;  3L44 A;  4GEB A;  1KKP A;  3BCB A;  4F5F A;  3N4R A;  1AMA A;  1OXO A;  2OKK A;  1LC7 A;  1AMR A;  1LW5 A;  2Z67 A;  2RFV A;  3JU7 A;  3F9T A;  3EI9 A;  4XK1 A;  1MGV A;  2X5D A;  4JEW A;  3WLX A;  1CQ6 A;  1AIA A;  3RCH A;  1AKA A;  3FCR A;  4LNJ A;  4RLG A;  3WCO A;  4Q6R A;  1C0N A;  4M2M A;  1UKJ A;  2FN6 A;  3PD6 B;  4Q76 A;  1SF2 A;  3FRK A;  2JJH A;  2JG2 A;  1RV4 A;  3FD0 A;  2Q7W A;  2W7H A;  3M5U A;  2R5C A;  3USF A;  4F5I A;  4OCA A;  1W7N A;  4WXF A;  2G7J A;  2DGM A;  2QB2 A;  1D7U A;  1JS6 A;  2QBT A;  4ZSY A;  4ZWM A;  3WKS A;  3B1E A;  4OTL A;  1CL1 A;  2ZY4 A;  5D5S A;  3AEM C;  4ZSW A;  1MLY A;  4A0R A;  3GET A;  3WX9 A;  4WYC A;  4E1O A;  3WGC A;  2R5E A;  3ECD A;  3RCH B;  4EMY A;  5M4B A;  1M6S A;  1XI9 A;  1M0N A;  1Y4I A;  3KE3 A;  2BI1 A;  4PIW A;  2W7K A;  3VK2 A;  1ARS A;  1IJI A;  3BC8 A;  5G4I A;  3AAT A;  4WLH A;  1SVV A;  2Z9X A;  5EQC A;  4K2M A;  4ZWV A;  5EUE A;  4XJO A;  4DQ6 A;  4LW2 A;  4ATP A;  4Y0D A;  2GB3 A;  3GJU A;  3DOD A;  5F8V A;  3VAX A;  2D66 A;  3FKD A;  2E7U A;  1SZS A;  3DXW A;  1GEX A;  3P6K A;  1VEF A;  2AEU A;  2C7T A;  3ZZJ A;  1ECX A;  3AEJ A; 
#chains in the Genus database with same CATH homology
 1DGD A;  1I43 A;  3CQ6 A;  1BS0 A;  1BW0 A;  2AAT A;  3EI5 A;  2Z20 A;  1GD9 A;  3ZRQ A;  2W7J A;  2BI3 A;  2YKY A;  4GSA A;  4RAE A;  4W91 A;  1DJ9 A;  2F8J A;  4JF0 A;  5M49 A;  1W23 A;  3PPL A;  4F5K A;  4BA5 A;  2BIG A;  1M4N A;  1S09 A;  3OP7 A;  2AY5 A;  3K40 A;  4ATQ A;  4GE4 A;  1M0Q A;  2HUI A;  1AIB A;  1B9H A;  2QMA A;  3CQ4 A;  4WYD A;  1J32 A;  1WYT A;  1AHF A;  2DR1 A;  4IXZ A;  5I92 A;  2CJH A;  1EG5 A;  1AY5 A;  1GC3 A;  4UHM A;  1AHX A;  1GC4 A;  1YJY A;  3COG A;  4WYG A;  4LNL A;  1W7L A;  3AEN B;  2O0R A;  1ARH A;  1ASM A;  2XH1 A;  5EUN A;  1JS3 A;  3FZ7 A;  1LC8 A;  3H7F A;  4HF8 A;  3B8X A;  2QLR A;  1Z3Z A;  3FDB A;  3NYT A;  1C7O A;  4J8L A;  3AEO A;  1ASD A;  4E3R A;  3T32 A;  2ZY5 A;  2VLH A;  2A1V A;  3LG0 A;  2AY7 A;  1TAT A;  1QIT A;  2ZC0 A;  2CH2 A;  3K7Y A;  3LY1 A;  3TFT A;  5KTB A;  1DJE A;  2EZ1 A;  4R5F A;  3WKR A;  4IYO A;  4H51 A;  4A0F A;  4UQV A;  3P1T A;  4Y0H A;  1G4V A;  4GRX A;  1D7V A;  3N7N A;  4RIT A;  1WYT B;  2VMS A;  3JW9 A;  4GDY A;  1JF9 A;  3EI6 A;  4XQ2 A;  4WB0 A;  2ZSL A;  2CST A;  2E7I A;  2W7L A;  3RQ1 A;  4IXO A;  2D5Y A;  3GSB A;  1ASE A;  2VIB A;  3PAA A;  1OXP A;  2FNU A;  4OC9 A;  3LVJ A;  1H0C A;  4R5Z A;  3BWO A;  4TV7 A;  1M32 A;  4MSO A;  4F5J A;  1GEW A;  3CAI A;  4F5L A;  4W5K A;  3Q8N A;  1AAW A;  1QJ3 A;  1X28 A;  3BCA A;  2VMR A;  3A9Z A;  1G7W A;  3KGW A;  2W7M A;  2AY9 A;  1WYU B;  1XEY A;  3HVY A;  2Z9V A;  2D63 A;  3N0L A;  3PIU A;  2WK9 A;  3TFU A;  4OYT A;  2D64 A;  1Z7D A;  1X29 A;  4Q75 A;  1SZU A;  1ART A;  2Z1Z A;  4ZM4 A;  4EB7 A;  3DZZ A;  4W1V A;  3BS8 A;  1BJW A;  3E2Y A;  3JWA A;  4ZDO A;  3EZS A;  2C81 A;  4A00 A;  2JGT A;  1BQD A;  3VP6 A;  2G6W A;  2VLF A;  4RM1 A;  1C4K A;  4NOG A;  2QB3 A;  2DKJ A;  3EIA A;  2PB2 A;  1IX8 A;  1N31 A;  1TOJ A;  3MAD A;  3G8M A;  1M0O A;  4XJL A;  4CBS A;  2ZYJ A;  4IX8 A;  2HOZ A;  5EIG B;  1AHE A;  2OQX A;  5EAA A;  2D65 A;  2BWP A;  3HLM A;  3LVM A;  1H1C A;  1AKB A;  3G7Q A;  3GZD C;  1LK9 A;  1LS3 A;  5AX8 A;  2FYF A;  2ZSM A;  4B9B A;  3MEB A;  3ZRR A;  5DB5 A;  4U1T A;  2JJG A;  5G0A A;  3WY7 A;  1C9C A;  3DR7 A;  1M0P A;  3DC1 A;  4FL0 A;  4GE9 A;  4OBU A;  1P3W A;  1LKC A;  1RVU A;  1DTY A;  1TOE A;  3UAK A;  2AEV A;  1TOG A;  2JJF A;  1GCK A;  3FSL A;  3LVK A;  2C0R A;  3E9K A;  3NTJ A;  4N0B A;  1OHY A;  2HUU A;  3A9Y A;  2DOU A;  4F4E A;  3FVU A;  5EFS A;  2W8V A;  4R8D A;  1BJ4 A;  1V2D A;  1MDO A;  1WYV A;  3PDX A;  1YOO A;  4K2B A;  4TMR A;  1EJI A;  2OGE A;  2VMQ A;  3L8A A;  2OAT A;  4B98 A;  4RIZ A;  3WGB A;  3UWC A;  3FZ6 A;  8AAT A;  2CIN A;  3BB8 A;  1TAS A;  3DYD A;  2YHK A;  4KAM A;  3AOV A;  1I48 A;  1LC5 A;  4M2K A;  3PJ0 A;  1V2E A;  5D95 A;  3GR9 A;  4O6Z A;  2R5C B;  2W8T A;  1JG8 A;  2FQ6 A;  3NU8 A;  1D2F A;  2DGL A;  2GMU A;  1PG8 A;  5E3K A;  3JWB A;  2AY1 A;  2FM1 A;  2GSA A;  2HOR A;  3K28 A;  4IW7 A;  5J8Q A;  5M46 A;  3JZL A;  1O69 A;  3R9A A;  3ZRP A;  3FFR A;  1W7M A;  4TN4 A;  2WK7 A;  3NU7 A;  1ASC A;  4ADD A;  1DFO A;  2ORD A;  4JE5 D;  4AZK A;  4P3M A;  3FDD A;  1AKC A;  2WK8 A;  4R2N A;  2YKX A;  3MC6 A;  2PB0 A;  3OKS A;  2VMZ A;  1UU1 A;  4QGR A;  3VK3 A;  3NNK A;  4P7Y A;  2ZY3 A;  1YJS A;  2W7F A;  3AEJ C;  3ATH A;  2D7Z A;  3E2Z A;  2CH1 A;  3JTX A;  1ZC9 A;  3I5T A;  1BJO A;  4A6T A;  2HP1 A;  4WYA A;  3VOM A;  4XJP A;  4H63 Q;  2BI2 A;  1GDE A;  1FC4 A;  3AEP A;  3PA9 A;  1QZ9 A;  5DJ1 A;  1B5P A;  2CTZ A;  3GWP A;  4WP0 A;  1ZOD A;  3FTB A;  4ZDP A;  1D7S A;  2TPL A;  3D6K A;  3AV7 A;  2HOX A;  3EZ1 A;  3HDO A;  4ZM3 A;  1AJS A;  2EPJ A;  3NUB A;  4AH3 A;  5HHY A;  1B4X A;  3RBF A;  2VGZ A;  1MDX A;  5DJ9 A;  3GZC A;  4BQ0 A;  2QSR A;  1SZK A;  2VIA A;  1ARG A;  3N4S A;  4EU1 A;  1KL1 A;  1IUG A;  1MAQ A;  1ASF A;  5JAY A;  2VMO A;  3W1I A;  4K05 A;  2CY8 A;  5E4Z A;  3HBX A;  4BHD A;  2WKA A;  3HQT A;  2YKU A;  2V0Y A;  3EIB A;  3N5M A;  4RJY A;  1VP4 A;  3BWN A;  2VGS A;  1IAY A;  3IF2 A;  7AAT A;  3A8U X;  3G0T A;  3HT4 A;  2NMP A;  1LW4 A;  1I41 A;  3QGU A;  1AJS B;  3QPG A;  1T3I A;  4OMA A;  1M7Y A;  2DKB A;  4PVF A;  1BQA A;  2YRI A;  2D61 A;  4AZJ A;  4F5M A;  4IY7 A;  5G2P A;  4A72 A;  4AO4 A;  3LVL B;  2AY4 A;  1TPL A;  4JF1 A;  4ITG A;  1ARI A;  4ADE A;  9AAT A;  2VMW A;  4RKC A;  2W8J A;  2VMY A;  1AAM A;  2VGV A;  3FVS A;  3I16 A;  4E3Q A;  2Z1Y A;  1ELU A;  1PMM A;  1YAA A;  1MAP A;  4IYO B;  4MKJ A;  3QBO A;  1OHV A;  3TQX A;  1CQ8 A;  3ISL A;  4EB5 A;  2GQN A;  4N0W A;  4WB0 B;  4MQR A;  1EQB A;  3BV0 A;  1QJ5 A;  3PDB A;  3FQ8 A;  3NYU A;  2EZ2 A;  3PGY A;  4F5H A;  2ZP7 A;  1DJU A;  3NUI A;  3ZZK A;  1AY4 A;  4CXQ A;  2X3L A;  2BI9 A;  3II0 A;  1AHY A;  1CS1 A;  3N4X A;  4KXK A;  3FFH A;  1OHW A;  1ORD A;  3FQA A;  1YNU A;  1AJR A;  1YJZ A;  2W8U A;  1TOI A;  3H14 A;  3LV2 A;  2ZY2 A;  2HOY A;  2VI8 A;  1SFF A;  2YOB A;  2R2N A;  2X8U A;  1BJN A;  3BCX A;  3PD6 A;  1UU0 A;  2X5F A;  5FT8 A;  5FT5 A;  4OBV A;  4CXR A;  2VMN A;  3KKI A;  4MY5 A;  3VK4 A;  3EUC A;  4MQP A;  2BYJ A;  1GC0 A;  1ASG A;  3NYS A;  4HVK A;  1WST A;  2VYC A;  2CB1 A;  2HUF A;  3AOW A;  3GBX A;  1PMO A;  4Q31 A;  3RUY A;  2YCP A;  3PDB B;  2YRR A;  3E2F A;  3MAU A;  5F9S A;  1N8P A;  5BJ3 A;  4GE7 A;  5LH9 A;  2E54 A;  3HMU A;  4PFF A;  4AO9 A;  1ASL A;  1U08 A;  5IWQ A;  1IX6 A;  2Z9W A;  4J5U A;  4M2J A;  4UHO A;  4A0G A;  2BWO A;  4E77 A;  3RBL A;  2R0T A;  3MKJ A;  4PFN A;  2CAN A;  2VI9 A;  3F0H A;  1VJO A;  2OKJ A;  5HDM A;  1BT4 A;  1J04 A;  4BMK A;  4WYF A;  2AY8 A;  4OT8 A;  1AHG A;  4Y0I A;  3W1H A;  4MGR A;  4EFF A;  5HXX A;  4A6R A;  1W3U A;  3AEM A;  3B46 A;  4ADB A;  3ASA A;  2VMU A;  1AX4 A;  1FG3 A;  2YCN A;  4ZAS A;  3TAT A;  1CQ7 A;  2BYL A;  1QIR A;  3TCM A;  1TAR A;  3UE8 A;  2CJG A;  3F6T A;  1QIS A;  3LWS A;  1DKA A;  3QI6 A;  1WKH A;  1CZC A;  2CJD A;  2JIS A;  3W1J A;  3DRD A;  2BIE A;  1V2F A;  2GMS A;  4ADC A;  5FT4 A;  1GBN A;  1CJ0 A;  1FG7 A;  1TOK A;  3FZ8 A;  4WXB A;  2EYQ A;  4JEX A;  1DGE A;  1MDZ A;  1QGN A;  3DXV A;  1WYV B;  4W1W A;  4BA4 A;  4DGT A;  3ACZ A;  3CBF A;  1ASB A;  3NDN A;  1CZE A;  4ISY A;  4XEW A;  5BJ4 A;  1ZOB A;  5EAV A;  1X2A A;  4MKK A;  4KYO A;  4L0O A;  3KGX A;  4ITX A;  2C44 A;  1AIC A;  1B9I A;  4LW4 A;  4A6U A;  2VMX A;  3ASB A;  2VGU A;  1WKG A;  4FFC A;  3MC6 C;  1O61 A;  5E5I A;  3NX3 A;  4MQQ A;  3BN1 A;  3AEN A;  2YKV A;  5TF5 A;  3WCN A;  1E5E A;  1B5O A;  5LHA A;  5DX5 A;  4WXG A;  1RVY A;  3MAF A;  2FNI A;  4ZAH A;  2OGA A;  1B8G A;  4WD2 A;  4WBT A;  4F5G A;  4XAU A;  1AY8 A;  3ELP A;  3N75 A;  4I8A A;  3QN6 A;  2BI5 A;  1RV3 A;  4JE5 A;  1KMK A;  1O62 A;  2EH6 A;  1X0M A;  1AMS A;  1YIY A;  1IX7 A;  3E2Z B;  2VMT A;  1GEY A;  1N2T A;  2ZUK A;  1BJO B;  2EO5 A;  4JEV A;  4LNM A;  3DU4 A;  4W8I A;  1C7G A;  1GC2 A;  1S06 A;  1O4S A;  4WLJ A;  3I4J A;  3AEL A;  4RKD A;  1S07 A;  2BHX A;  2YCT A;  1PFF A;  2AY2 A;  2W7G A;  4UHN A;  4A0H A;  1IAX A;  2V1P A;  2W7I A;  3QM2 A;  2VMV A;  1UU2 A;  2EGY A;  3A2B A;  3R4T A;  2VGT A;  3MAF B;  4RJ0 A;  2ZJG A;  1S08 A;  3RI6 A;  2AY6 A;  2VGW A;  1G4X A;  5G4J A;  5K8B A;  3HL2 A;  3H9X A;  4U2H A;  2HZP A;  1CL2 A;  3B1D A;  3BWN C;  1OAT A;  1MLZ A;  2D7Y A;  2FKI A;  1G7X A;  2E7J A;  1WYU A;  1E5F A;  4DBC A;  5G09 A;  4CVQ A;  2W8W A;  2O1B A;  1SPA A;  5M4D A;  1S0A A;  2XBN A;  2WB6 A;  2W7D A;  4WYE A;  2BKW A;  3FQ7 A;  4ZLV A;  3EI8 A;  4AOA A;  1IBJ A;  2VMP A;  3NRA A;  1KMJ A;  4XJM A;  1ELQ A;  2O7C A;  2QA3 A;  3EI7 A;  3WZF A;  2BIA A;  4K2I A;  1KKJ A;  1I29 A;  3MBB A;  1IVR A;  3E77 A;  1YIZ A;  1KL2 A;  2Z9U A;  3B1C A;  5EIG A;  5C6U A;  3IHJ A;  5FT6 A;  3ELE A;  3DR4 A;  1BKG A;  3QHX A;  5EUD A;  1AMQ A;  2JJE A;  4CBR A;  2W7E A;  2CFB A;  3A9X A;  4JEZ A;  2HP2 A;  4W1X A;  2AY3 A;  3E6G A;  1D7R A;  1ASN A;  4JEY A;  3CQ5 A;  4UOY A;  4ZDL A;  2KFP A;  4IXS A;  5G2Q A;  1ASA A;  1V72 A;  4LC3 A;  2Z61 A;  3FVX A;  2BWN A;  2PO3 A;  1C7N A;  2DGK A;  3GZD A;  3L44 A;  4GEB A;  1KKP A;  3BCB A;  4F5F A;  3N4R A;  1AMA A;  1OXO A;  2OKK A;  1LC7 A;  1AMR A;  1LW5 A;  2Z67 A;  2RFV A;  3JU7 A;  3F9T A;  3EI9 A;  4XK1 A;  1MGV A;  2X5D A;  4JEW A;  3WLX A;  1CQ6 A;  1AIA A;  3RCH A;  1AKA A;  3FCR A;  4LNJ A;  4RLG A;  3WCO A;  4Q6R A;  1C0N A;  4M2M A;  1UKJ A;  2FN6 A;  3PD6 B;  4Q76 A;  1SF2 A;  3FRK A;  2JJH A;  2JG2 A;  1RV4 A;  3FD0 A;  2Q7W A;  2W7H A;  3M5U A;  2R5C A;  3USF A;  4F5I A;  4OCA A;  1W7N A;  4WXF A;  2G7J A;  2DGM A;  2QB2 A;  1D7U A;  1JS6 A;  2QBT A;  4ZSY A;  4ZWM A;  3WKS A;  3B1E A;  4OTL A;  1CL1 A;  2ZY4 A;  5D5S A;  3AEM C;  4ZSW A;  1MLY A;  4A0R A;  3GET A;  3WX9 A;  4WYC A;  4E1O A;  3WGC A;  2R5E A;  3ECD A;  3RCH B;  4EMY A;  5M4B A;  1M6S A;  1XI9 A;  1M0N A;  1Y4I A;  3KE3 A;  2BI1 A;  4PIW A;  2W7K A;  3VK2 A;  1ARS A;  1IJI A;  3BC8 A;  5G4I A;  3AAT A;  4WLH A;  1SVV A;  2Z9X A;  5EQC A;  4K2M A;  4ZWV A;  5EUE A;  4XJO A;  4DQ6 A;  4LW2 A;  4ATP A;  4Y0D A;  2GB3 A;  3GJU A;  3DOD A;  5F8V A;  3VAX A;  2D66 A;  3FKD A;  2E7U A;  1SZS A;  3DXW A;  1GEX A;  3P6K A;  1VEF A;  2AEU A;  2C7T A;  3ZZJ A;  1ECX A;  3AEJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...