5IXSA

Lactate dehydrogenase in complex with hydroxylactam inhibitor compound 9: (6r)-3-[(2-chlorophenyl)sulfanyl]-4-hydroxy-6-(3-hydroxyphenyl)-6-(thiophen-3-yl)-5,6-dihydropyridin-2(1h)-one
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
331
structure length
327
Chain Sequence
ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQSRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxireductase/oxireductase inhibitor
molecule keywords L-lactate dehydrogenase A chain
publication title Cell Active Hydroxylactam Inhibitors of Human Lactate Dehydrogenase with Oral Bioavailability in Mice.
pubmed doi rcsb
source organism Homo sapiens
total genus 117
structure length 327
sequence length 331
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 2016-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5ixsA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 5ixsA02
1SNYA 3AFNA 1HT0A 3WLEA 3VH4A 4OH1A 4M8SA 3PIDA 3MTJA 1MB4A 3U5TA 1U3TA 3JYQA 3DMTA 4NHEA 2E37A 4JJGA 2D2IA 5F21A 4J4HA 2Y0CA 4JK3A 4JJIA 4FFPA 3H5AA 2Y99A 3OIGA 4YT5A 1PS0A 4RQUA 2X5JO 2GPTA 4YT2A 3ZH2A 2Z5LA 3JYNA 5I7FA 5K6AA 1Q2XA 3GMDA 3CSDA 2P5YA 3AU9A 1LBEA 1N1EA 3I52A 3OH8A 4Q3CA 2W2KB 4YJGA 5AYVA 4E13A 2RAFA 3I5MA 3JQ6A 3FNEA 5JYEA 5ICSA 3HFSA 1A72A 3ENNA 4NU6A 4BO0A 5JW6A 3D3EA 3ROMA 1ADGA 2D8AA 2WEKA 1K6IA 1WW8A 3NTRA 3JD2A 4B3IA 1AE1A 1V35A 1B3BA 1U4SA 3SEFA 2ZTMA 4CLOB 5L95A 4PN3A 2W2LA 3KM0A 5JFOA 3KHUA 4IS3A 4UUNA 3KVOA 4B4WA 4OMUA 1E0DA 5CEEA 1Y9AA 1X15A 1Y8RB 4YVFA 1D4FA 2PKQP 1XGKA 3A9WA 3JQ8A 1BXZA 4IDDA 4LRTB 1I36A 4MVJH 4PZDA 4BNWA 3KEQA 2O2YA 2O50A 1UDAA 4MP6A 1Y8QA 4BQRA 1ZMTA 3LK7A 4IZHA 3CH6A 2FPPA 3OF2A 2J3JA 2FPGA 4FDAA 4A10A 3D64A 2IYPA 2VN8A 3ETDA 5DBFA 1R6DA 2DBZA 1U4OA 1Y1PA 2WMDA 4E32A 1I01A 1Q0QA 3S1LA 4TKLA 3ITDA 4XD2A 1O89A 2DBQA 1EFKA 1K5HA 1X14A 2FRDA 2NNLD 5T64A 3WGIA 3LT0A 4L75A 1MLDA 2BFMA 2D5AA 2EGGA 3AUTA 1JWAB 5FF9A 2OFPA 1CRWG 2OHXA 5A3JA 1A4UA 4DBZA 5TJHA 1GY8A 1SMKA 3SX2A 1Q1NA 2OOSA 1D1SA 4IDFA 1IY8A 3DZIA 3WGTA 1QR6A 3B6ZA 3OHSX 2X5OA 2UVDA 4DUPA 1NWCA 1UDCA 3GPIA 3R1IA 4EEXA 2JFHA 1C0PA 4XR9A 5T57A 2BFAA 3RUEA 1XQ6A 1S7CA 5C3MA 4Q3DA 2Y1DA 3O4RA 2X6TA 9LDBA 3KRTA 3IUPA 3NTQA 3VZQA 3G49A 3O9ZA 1D3AA 5DF1A 1I8TA 4TVOA 1EUZA 1PEDA 2PKRA 4YAGA 1AHHA 3GVPA 1IZ9A 4YRAA 1NASA 2GN6A 2WD8A 4RVUA 4Z3DA 4DLLA 1PQWA 1P1IA 5C5IA 4IBOA 2UDPA 4R54A 1DIBA 5JMPA 3DZJA 2QZ9A 2QYSA 1ZK1A 1P1FA 3H4VA 4P4NA 4IQ0A 5JDIA 4RDIA 3VVBA 3FR8A 2Q4EA 3R6DA 4I5EA 4Y8VA 5DCUA 4Z9YA 3D5TA 4WLOA 2OZPA 1ISJA 4XQCA 5ENDA 1E6WA 2UYYA 2I9PA 3P7MA 2RH4A 1H9BA 3K2EA 1SO8A 2JFFA 1B7GO 4C4OA 1ID1A 1WDLA 1E6EA 3OEYA 2EKPA 1Y5RA 1IPEA 3W8EA 2NV6A 1LLDA 5C7OO 4MIEA 1JN0A 1ZK0A 5G4KB 2PV7A 1LSSA 4WCFA 5A5FA 3WSWA 3ABIA 5KJ1A 1XU7A 4MVJE 1F17A 3WDSA 2VRCA 4CMEC 2P5UA 2RIRA 1GYRA 5A9SA 1PJ4A 5JYDA 2C59A 1JA9A 1PU2A 1AN9A 3WG9A 2DC1A 2P4QA 3WGZA 5A4DA 3VZSA 3L07A 3KV3O 1T2DA 1W8DA 4R1SA 3DBLB 2DTEA 4LW8A 3BMCB 3NTOA 1ZXBA 3QWFA 2C2YA 4NNJA 4NJMA 4KUEA 5H82A 2NLOA 3WTCA 1A71A 3ZWAA 1LDNA 3NV9A 4BO1A 2A92A 2J6IA 4ALMA 4E2ZA 1NAIA 2YFQA 4RZIA 2DFDA 4ROSA 5JC1A 3S2FA 1B3RA 3HHPA 4KZPA 1VL0A 4JGBA 3MJCA 1A9ZA 2OL4A 4CM8A 5C7LO 3LDHA 1N7HA 5I7VA 2AQKA 3AFMA 4IIUA 1M76A 3WLFA 4CLRB 3RBVA 5A05A 3FNGA 4PLCA 4B3HA 2POQX 4ZRMA 2X22A 3ADPA 1BMDA 5I9MA 1R16A 3OJOA 3BMQA 3CEAA 3DDNA 1YDWA 4NDNE 1L7EA 3I9LA 2A94A 1TT7A 5JY1A 1QYVA 5G0WA 3UFXA 2JCVA 1R12A 2C0CA 1X1EA 2CVQA 2P4HX 4GLOA 3S2IA 4BQPA 1ISHA 2IE0A 3NDIA 3RC7A 3L4BC 3L9WA 1YH3A 4WOJA 1VM6A 2Q4BA 3JQAA 2JL1A 2CVZA 3IL2A 3JQFC 1R4MB 3AK4A 3CPSA 4GWKA 4DIFA 1MFPA 4EEZA 4FIZA 3BTVA 1ISIA 1AXGA 3TSCA 3DFZA 1YL7A 3JYOA 3ETEA 4L4XA 5CHEA 3T4XA 1B26A 1HKUA 5JLAA 1T24A 3JV7A 3JQGB 4IPTA 1PL8A 4GX0A 3JYPA 4XYLA 2HSDA 4DIOA 4Z0PA 4R1UA 1GEEA 4XDYA 4CPDA 4TZKA 1J0XO 4OKNA 5CDYA 1EVYA 1MC5A 3TNLA 3OETA 2YQ5A 3AOGA 1QG6A 2NSDA 3LC2O 3GDOA 4HFNA 1PJ3A 1PWZA 4JBGA 4ZQHA 1XEAA 5THQA 3IMFA 7ADHA 3RROA 3ROPA 1L7DA 5KIAA 3RVDA 1SAYA 3AI3A 3SJUA 3U4IA 1PJ2A 1NWHA 1IYZA 4N18A 3NJ8A 3CTMA 2DQ4A 1JW9B 4E4YA 5CPBA 2PFGA 1UXGA 2DFVA 4H7PA 1OI7A 2G5CA 1KC1A 1GDHA 4RLSA 5A9TA 4YJGB 3D4NA 2D0IA 4KWIA 1DO8A 1OC4A 3H6KA 1ISGA 1PZFA 3WBFA 2Z1NA 4O6VA 1PIWA 2X5KO 2DPHA 1P1KA 3WFIA 3TZQA 3QRWA 2QG4A 4YA6A 3GY0A 4Z0HO 3WMXA 5CAEA 2GYYA 1C0LA 5JPIA 1GQ2A 4Q9NA 4AJIA 1O94A 5JO0A 4BNVA 1WDMA 3AWDA 4R69A 3PHLA 4FC6A 5IG2A 1K0UA 2W4QA 4PRLA 3WR5A 1KY4A 4NFYA 1Y8QB 1ADBA 1T2CA 3ICCA 2HKIA 2PLAA 3IC5A 4IGFA 1SCUA 2GDZA 3D4OA 4TKMA 4J4BA 1XA0A 3ZW8A 3U4HA 5GMOA 3OECA 2BHLA 3U0BA 1DIAA 2BFPA 3GA0A 4Q3EA 1LLQA 1PGQA 2FN7A 4BMSA 2B5VA 3E1KA 2VHZA 5DP1A 5T8KA 2W2KA 5F1PA 4J3FA 4FN4A 1H6AA 2BGMA 3DZKA 5L4NA 2FPIA 3LLVA 3PLNA 5GZ6A 2I3GA 4DPLA 4BNXA 4FOOA 4OYRA 1GUZA 4DQVA 3A4VA 1ZMOA 3U49A 5KJ6A 3L4SO 3OA0A 2O3QA 2B4TO 4L4RA 2O48X 3H7AA 3QVWA 2CDBA 4E12A 4CLOA 4OOFA 7MDHA 2VQ3A 3A28A 2YZ7A 4YT4A 4N5NA 2PWZA 3HQ4O 4XQ9A 5TS3A 3BMOB 1WMBA 2AG5A 5I7EA 3RWBA 2BELA 4BO9A 1ZBQA 1ZK4A 3GPDG 1W73A 4OM8A 4DTIA 1GEGA 3JYLA 4TSKA 5IDYA 3VH2A 2W2LD 3ZHYA 4CMJA 5JNLA 2EKQA 5F5LA 4JBIA 3SBOA 4ZGWA 5JXWA 3LC7O 3K73O 1E1MA 1H2HA 3BTSA 1HL3A 4E6PA 1XQ1A 4J2OA 3HN7A 5KVCA 3MJVA 5ILGA 2J3HA 4E30A 4XB1A 2ZJ0A 3MEQA 3JQBC 4R9RA 4UEJA 3WB9A 4HP8A 2P2SA 4PLHA 3DBVO 1TLTA 1YB1A 3H9GA 2O2SA 5CEJA 3GC6A 4DLAA 4MVJI 1H9AA 3TZ6A 3GLQA 1YB4A 4OSPA 4NMHA 4D3DA 4BNJA 5CDTA 1VJ0A 4QFCA 4CMGA 3AU8A 5JBIA 3Q3CA 1QLJA 3Q6IA 1YONA 3KYCB 5TJ9A 4YAIA 3CMCO 1BRMA 2HRBA 3DZBA 3I9OA 4J6FA 4BVAA 3C3XA 3Q9UA 1G6KA 1PGJA 2FHSA 5A9RA 1FJHA 4W6ZA 1EEHA 3FWZA 1FDTA 3PQEA 1P1JA 3CXRA 1MGOA 1ZNQO 4ND1A 4BNKA 1DFHA 3PWSA 1ENZA 5CDSA 1E77A 4BNMA 4NR0A 2YUTA 4A73A 4D0RA 1MV8A 4G81A 4BNTA 4GSLA 1ISMA 1IHXA 4EUEA 2BKAA 2EJVA 2FOIA 4J9VA 2CSUA 2WE7A 4GH5A 1QYDA 3VPGA 4LN1A 2IODA 3D3WA 4KQWA 4ALLA 1FDUA 3OICA 2R6JA 3C8MA 4KUHA 1LQTA 2X0NA 3E82A 1RM4A 2B4QA 3H9QA 4OGWA 4WK6A 4D44A 4UVDA 4B7XA 3INRA 4ZU3A 4KDFA 4XGKA 2J3KA 4UULA 4WLVA 2PH3A 1PS9A 4I5GA 3H2ZA 1DFIA 4NG5A 1BVUA 3H8VA 3PZBA 3OP4A 4LK3A 1B0AA 3AOEC 1RM5A 3GN1A 2V65A 2C82A 3T7CA 3GGGA 3KBOA 2HMTA 3S55A 1UUFA 4OOEA 3PFFA 4MPDA 4M87A 1HDCA 3AM3A 3LZ6A 1ZO8A 5G4KA 3S8MA 4BNUA 3RKRA 5JY6A 3OJ0A 3F9IA 1ZK3A 1KC3A 3B20A 4A2CA 4ITUA 1ZFNA 4GVLA 5EERA 3I6QA 1WXDA 1YL6A 2VOEA 3L0DA 4PGFA 4UVIA 3ZU2A 4E5NA 4E33A 4F45A 3CUKA 5B1YA 1YBMA 3OQ1A 4FBGA 3VZRA 1BSVA 3VPFA 4LSWA 1E7SA 2DLDA 3JQAB 4UUMA 4XA8A 1WZEA 3T7EA 1B14A 1Q7GA 3QVOA 2NVUB 3HDQA 2BRUA 4YRDA 2O3TA 4EYEA 2C7VA 1E5QA 3DBLA 4MOWA 4INAA 4E5PA 3ROQA 3GHHA 5I8ZA 4ZHSA 4DMLA 1ZJZA 4MP3A 2X0IA 1T1RA 4R41A 1NPTO 4L74A 5HA5A 4GMFA 5JAQA 1YO6A 3DHEA 2UAGA 1GZ3A 4PLWA 3JQFA 2DVMA 3AUSA 4UEKA 5A04A 2JAHA 3VDRA 3OEWA 4CLRA 5BQFA 4AVYA 3H65A 1SB8A 1ZXLA 3DBHB 1MXFA 3QIVA 1BTOA 3EUWA 1ONNA 3UUWA 3VPSA 1YGYA 1LRLA 2HJRA 1P44A 2YV1A 4PLPA 3Q11A 2D1YA 2I3AA 1R66A 4IXTA 4MKZA 1H6DA 4BHTA 4ALKA 3TN7A 5A5EA 1B16A 2I76A 2X9NA 3LLSA 2CNBA 1PZHA 4J9UE 1XDWA 3I83A 5JAMA 4FGWA 4YXFA 2BGKA 5TGDA 2UV8A 1O0SA 1T25A 3KETA 1PQPA 3WBBA 4N5MA 4D0SA 3ASVA 3UXYA 1R4MA 4Q39A 2Q99A 2IDZA 3FWNA 3CZMA 4IGEA 3SC4A 1DIHA 4GI2A 1N8KA 3IUSA 5L51A 1WDKA 3PDUA 1XG5A 4HV4A 4ZD6A 1HZZA 3WNVA 2VRBA 1Z7BA 2Y67A 5KNLA 4JBHA 2AE2A 3JQAD 3TDKA 4XRRA 3JQGA 1KEUA 2I65A 3OM9A 1D8AA 3DOOA 4GVXA 4L0QA 1GYPA 3ZGYA 1F14A 1QLHA 2DUWA 3QWIA 2ZB3A 2VNAA 3AUAA 4KWHA 4R5MA 5AXDA 2BMAA 2X0JA 3KLMX 3ZWOA 3WJAA 2VT2A 3P2OA 4XIYA 2OMEA 5LDHA 3C1OA 4MVJD 2ZB8A 4KMSA 3V2UA 1F12A 4ZN6A 2IZ0A 1EZ4A 4Z9XA 4AJ4A 1LRJA 4A03A 1YBVA 5AXAA 4IZIA 2WTBA 4G65A 1FF9A 3MZ0A 1U7HA 4WJZA 4BV8A 3DWFA 3I1JA 3MJEA 4IDBA 1U9JA 5TT0A 3K9QO 3O8QB 4RPGA 1P1HA 3JD3A 1J4AA 1PS8A 2I66A 3RU7A 3CKYA 3U3XA 4YACA 3TFQA 2B83A 4MJLA 1ENYA 3NUGA 3LYLA 4CV0A 4E0BA 2AXQA 3WMWA 2E4AA 5FYDA 3DZHA 2I5PO 1DRVA 4M1QA 3JD0A 1PL7A 2E6UX 4CLDA 1PR9A 3MJSA 4L4SA 4ND5A 3WYCA 3N58A 1DAPA 2BI8A 4HKTA 4QO8A 2VZ0A 3C7DB 3HDJA 4CMAA 4BNFA 1VE9A 2Q50A 3FPLA 1BGVA 2VWGA 2RCYA 3ONDA 1QYXA 4UAGA 3WGHA 1F0YA 1FDSA 1VSUA 1ZSNA 4Z9FA 4CJXA 1GCOA 5IN5A 3RKUA 2Y1OA 3C7CB 3PYXA 1XYGA 3V1TC 5L7WA 4XYBA 1C1XB 3OMLA 2EG9A 3RCBA 1P31A 2ZTUA 3GH3A 3ZNNA 4IJWA 2Q1SA 1CF2O 2AEFA 1XSEA 1A9YA 4F6CA 4N5LA 2HO5A 1J49A 1R4NA 1FDWA 1Y5MA 4IQGA 5DOZA 4BNGA 1OFGA 3I6IA 2FR1A 3E48A 2X1HA 2CF6A 2Y68A 1M75A 2QRKA 3KZVA 3M2TA 4IMPA 4DIBA 2ET6A 1ZUD1 4D3FA 2OXIA 3WIDA 3TOXA 4R68A 2EF1A 3DB2A 3GVCA 2EXXA 1LDBA 1DFGA 4K28A 1F8FA 1U2GA 3RJ9A 2SCUA 5JE8A 5IDQA 1Y9EA 3AY3A 5U1PA 4CUKA 1LNQA 5BSHA 1BDBA 2GZ2A 3GZNB 4OL9A 1W4ZA 4TRMA 3HB4X 1GPDG 1ONOA 1P3DA 1GZ6A 2HK8A 3RIHA 2J5QA 3ZNOA 3IP3A 3ZWBA 1KS9A 1WLYA 1X0XA 5HTOA 3I9MA 3KSUA 3OBBA 5IZ4A 4FB5A 1RPNA 1XLTA 1JKFA 2XXBA 3BMOA 3FCOA 3FPCA 5JO9A 3K5PA 4WKGA 1E1KA 1IB6A 3ZHXA 3ANLA 3NDRA 4R5HA 5IZCC 3NDJA 4D46A 2O7QA 1LSUA 3WQQA 2YY7A 4J1SA 4J0FA 3UICA 4BKPA 1EQ2A 2PD3A 4Y6PA 4GLLA 3LU1A 5A3VA 1UP4A 3D3WB 2VZ9A 1FMCA 4ONEA 3N74A 1V3UA 4RQTA 3WICA 2B69A 2D3TA 2NVWA 1E5LA 4ID9A 2GCGA 4RCVA 1A27A 2W90A 5DP2A 1BWSA 1YWGO 4L76A 3GVXA 4XYMA 3NYWA 3F46A 1FK8A 2YV2A 1HDYA 4FGSA 4CR8A 3KYDB 4WECA 3EAGA 3KYCA 4NBTA 2IEBA 1KVQA 3NEPX 4FFRA 1IUKA 3EVNA 4ESOA 5KJCA 3GGPA 5LC1A 1H2BA 4QX6A 5FWNA 1O95A 4D41A 1HYEA 4IJUA 3C1AA 3ENKA 2ZTVA 4IM7A 1CQIA 2V6MA 1NHWA 4HFJA 1YJ8A 2XOXA 3AJRA 4IY1A 5K0ZA 3ZHZA 2HK9A 4DC0A 3KB6A 4BGUA 4BMVA 4WLFA 1LDGA 5B4TA 3PK0A 3STHA 2J3IA 2EW8A 4B4OA 3G17A 5KVSA 4W9NC 3COSA 2JCYA 2EKLA 4RVGA 1IE3A 1CERA 3RFXA 1C1DB 5CDGA 3W8DA 4UREA 4M49A 4PLTA 2O3UA 1HLDA 1YOVB 3F47A 3GOHA 3GUCA 3O38A 1BHSA 4BNZA 5L4SA 1LQUA 2EP5A 2VHYA 2AHRA 1P45A 1MA0A 4LVCA 5L7YA 5KKAA 4BKQA 2X8LA 4TRNA 4JP2A 3W4IA 3IOYA 1SOVA 3O03A 3IDSA 4BB5A 1PJBA 2HMSA 4IXWA 4RDHA 3RC9A 1GADO 1GQYA 2HU2A 2VOJA 2G17A 4Q3BA 4PLGA 2Q2WA 2CUKA 4ZRNA 2NTVA 1JU9A 3KEOA 4AJEA 2HK7A 2NACA 1B8VA 4DBVO 5IJZA 5JDCA 3H5RA 1A5ZA 1SPXA 1TEHA 3GDFA 3NAQA 4RO0A 3PVZA 4CQMA 4FFMA 1YQDA 3AY6A 3ZNQA 1GFSA 2WYUA 2HMVA 2FWMX 3JQ7B 4NPCA 4NFHA 1EE9A 2CVOA 4R1NA 3IP1A 4OIMA 2I67A 3DHNA 2HDHA 3FRJA 4WEOA 1H6CA 1VI2A 4PLFA 5ER6A 5EESA 1NR7A 2R00C 1M66A 2NVUA 4WOKA 4MO2A 1IPFA 4FC7A 2YQ4A 3F4BA 2QQ5A 4W7HA 5AXBA 3BZUA 5AOVA 2DBVO 1V3TA 5LCXA 3JTMA 3RFTA 1GZ4A 4QO7A 4MVJA 4HFMA 3GNQA 3NT2A 3DBRA 4AJ2A 1HTBA 5EL0A 2C29D 3IAHA 1V0JA 1UDBA 1ZSVA 1VKOA 2FY8A 2WE8A 3OIDA 3R3SA 4GBJA 4I5DA 4PG8A 1E1LA 1M2WA 3I4CA 3JD4A 4J7XA 2Q1UA 2YHIA 4XJSA 4HUJA 4AJHA 3CZRA 1BW9A 1YDEA 1N9GB 1W0CA 4YDRA 4CMKA 4I9NA 4BV9A 3DBHA 2NUAA 1OMOA 3H3JA 5BSFA 4DL9A 1LJ8A 1WNTA 2YJZA 1MXHA 3L9XA 4ZQFA 1DJQA 4I5FA 4PVCA 4DVJA 4CL3A 3KTDA 4XQGA 4NBVA 4C7JA 3PHHA 3G0OA 4WLNA 2WDZA 4EZBA 4CR7A 5L9AA 3IJPA 1PSDA 1ZH8A 5DULA 1CQJA 3Q1LA 1PQUA 4IDEA 2WYWA 3A06A 2GN4A 3H2SA 4R3WA 5CG2A 1NVMB 1M67A 2RBEA 3PYMA 2QRJA 1CEQA 3UCXA 4B7UA 2QW8A 4P22A 1IL0A 2B4RO 1G0OA 4G5HA 1PTJA 2G1UA 3GUYA 4U5QA 1HRDA 4HWKA 2BFOA 1Z74A 3ZWYA 3KOUA 4GKBA 4IINA 1ZVMA 4DQXA 1PR3A 4XYGA 4CUJA 1V6AA 4ZQGA 3SC6A 4K26A 1AXEA 4B4UA 4CM5A 4E3ZA 2ZJ1A 5G0VA 3RBZA 4CMIB 2Y0EA 2PGDA 1JDJA 3KLPX 5AXCA 2AMFA 2Q2QA 2IYOA 1I0ZA 1LDYA 1HYHA 1RYEA 1YB5A 3LSYA 4NK4A 3V2GA 3ZCXA 3RSHA 2Y1FA 3PRJA 4D3SA 4QQRA 3DAGA 2PTGA 2GN9A 1CETA 3BMNA 3PWKA 5TNXA 2ILTA 3ADOA 1WVGA 3U4CA 4E2XA 2ZQYA 5F1OA 3X2EA 3JQCA 4Q3NA 2NTJA 4MVJM 2G0TA 2A35A 2I99A 3HE3A 1SEPA 4RVDA 2PZMA 3ZN2A 1OBFO 1KEWA 2BLLA 1R4NB 3E5MA 3F6YA 3DMYA 3O8QA 4A5OA 3GK3A 5F5NA 3GN2A 3FTNA 1HE5A 4WUVA 2FP4A 4D7AA 3JQ9C 1ZEMA 1DIRA 3I4FA 4K6CA 1P33A 3DEYX 1N2SA 3EC7A 4BIIA 1NP3A 4BMNA 4I1IA 3DMTC 4PVDA 1J5PA 2QZZA 4RGBA 1E6UA 2G76A 5FI5A 5F3RA 2Q49A 5BSGA 3UOGA 1E7RA 1KYQA 4CUZA 5TX7A 3FNHA 5ENVA 4BNLA 4UUPA 4YEDA 1E3SA 1K89A 4TRRA 2ZTLA 4Y6RA 5K6AC 1VPDA 1R0LA 2V7PA 4NH4A 3UCEA 4B8ZA 3EGOA 3INTA 4GL4A 2AQ8A 4Z3KA 2QX7A 1NFFA 5HRUA 1G1AA 1T2EA 2JJYA 5JCJA 3BTUA 2Y1GA 2WM3A 1WZIA 1OAAA 4LGVA 5TT1A 1C1XA 2D59A 5JMWA 4EW6A 4BNNA 2A9FA 1LDEA 4YJFB 1A7AA 4M86A 2G82A 4E21A 1U28A 1XWFA 2H6EA 1NPDA 4LISA 5KVVA 4CODB 4NZ9A 4JROA 4W99A 3W6ZA 4RVHA 3RUDA 1HLPA 4QXMA 2CMDA 2DU8A 1ARZA 3I23A 4U6QA 3ZZNA 3GNSA 4DRYA 4MKRA 1O9BA 1U5CA 1AHIA 2EV9A 3DC2A 3V8BA 4IJVA 1Y7TA 1UR5A 4YYZA 4FS3A 1PGNA 4MP8A 3FR7A 3PHGA 4ZQBA 2C2XA 2WJPA 4NFSA 5KWEA 3K8ZA 3MOIA 3OJFA 3TZCA 4XEHA 1WAMA 4MVJF 3E8XA 3EW7A 3ZWNA 5G4LA 5HS6A 4E5YA 3GZNA 5HWSA 2NWQA 2HQ1A 2JKVA 2VYND 4YJHB 3QWHA 3D7LA 5CPFA 3RJ5A 4M89A 1I33A 3DAPA 4DQUA 3HB5X 1LXCA 3I9KA 1GR0A 4D79A 3PWZA 4W7IA 3P2YA 3WXBA 1MG0A 1I3NA 3U9LA 2PZJA 1E7WA 4XR4A 4YPOA 4CM1A 5T67A 1UXJA 3ZU4A 1UZLA 5DBGA 3WTBA 1LI4A 3NJ4A 3HJAA 4GQAA 1BG6A 1NM5A 1DHRA 4YT8A 1ULUA 1Z82A 2GASA 1I10A 3WOHA 1B8UA 3PHIA 4RLHA 2GERA 5B12A 3W8FA 1LEHA 3QQPA 3S2GA 2OO5A 1TXGA 1NFRA 4R1TA 1NVGA 1ZEJA 4BKUA 1JQBA 4Y6SA 4JCOA 3QJ5A 5EN4A 3ZWVA 5K9ZA 4E2YA 1DPGA 1RM0A 4E5MA 1T26A 4CMEA 1Z73A 4NK5A 4HNGA 3Q2KA 2OP1A 5DZSA 3WX0A 3X2FA 5BNIA 3DONA 2O3JA 1PWXA 2JCXA 3KYDA 4HY3A 4KUGA 4W9NA 5IFLA 5JDIC 4J7UA 4RF5A 3BA1A 2YV3A 5TRTA 1OZAA 1EDOA 2NTNA 4AICA 1E3IA 4G2NA 1HDRA 4GWGA 2GR9A 4IQ8A 3PJDA 3DXFA 4L73A 1GV1A 4DREA 4QSMA 1QYWA 5KJEA 1YQXA 3ULKA 5GZ1A 4HNHA 1KETA 3ZWCA 4GMGA 5IF3A 3NGXA 2VUTA 3G79A 1D1TA 3PQDA 5T6BA 4Y67A 1HEUA 2X0RA 4AFNA 3KSZO 5A1TA 5L40A 4CQMB 4M54A 3LT4A 4WCFC 3WJ7A 1U3UA 4KQXA 3VVCA 5JSFA 1K2WA 2HRZA 2P9GA 2H9IA 2VT3A 5KOIA 3H9UA 1U7TA 3TZHA 3WIEA 1WP4A 4GSKA 3P19A 1EBFA 2X86A 3INGA 3LT2A 2J8ZA 4ILKA 1C1DA 3W4KA 2PZKA 4NJOA 2QYTA 4K6FA 1DSSG 3EK2A 4GX2A 5TC4A 2XXJA 1LUAA 1YOVA 4O0LA 3RAJA 6LDHA 5KCZA 3ANMA 5COAA 4CQLB 3G1TA 1X0VA 1WWKA 2Q1WA 1E3LA 2NU8A 4YTEA 1YXMA 1EQUA 2AE1A 3HADA 1U3WA 3L4BA 4U6SA 5ADHA 4QFDA 2VUUA 1H6BA 1ZKMA 4GKVA 3DBRB 3MWEB 4DWVA 4LVUA 3GFBA 3UHAA 3JCZA 1QV6A 3RUAA 3UKOA 4OQZA 3ONEA 2DKNA 2YHIB 3RASA 2ZB4A 1BW9B 3TJRA 5DCWA 2HMWA 2EERA 3HWRA 5HS4A 3I9NA 3ORFA 4I8XA 3PZRA 3RC2A 1PJQA 4YJDA 5CEFA 1N1GA 3PTZA 4JLWA 2BD0A 4J4TA 5FFFA 1N92A 3GQVA 4P4GA 5B4UA 3UCFA 1VRWA 4J16A 3DO5A 2DM6A 3JQ7A 2BI7A 4GGOA 2PD4A 4U0JA 3PDJA 3P5SA 1EVJA 4B79A 2VHXA 3N7UA 1GYQA 1I3LA 4R9SA 1EFLA 1HE2A 2W8ZA 4TQGA 5TIIA 3LC1O 4DC1A 1T1SA 2EIHA 2F1KA 3H9JA 3ONFA 1XCBA 2LDXA 3UH1A 4YAKA 4YQYA 4CQMD 4BO8A 5IDXA 1KVRA 3U09A 4UEOA 3KSDO 3HDHA 1ZZEA 1NQOA 5EQFA 3RUIA 5HM8A 5JAIA 5IDWA 4A27A 2VTEA 1DLIA 2PGLA 3WGGA 8ADHA 1JAYA 2HLPA 3LQFA 1V9LA 4HXYA 3GEGA 3TL3A 4OAQA 4WCDA 4EJ6A 3QWBA 3RQSA 3MOGA 3OA2A 4FW8A 3BTOA 1NYTA 3UN1A 2Y0DA 2PR2A 3GR6A 1YBAA 1VL6A 2FSVA 2IZ1A 3GRPA 2JD0A 1N7GA 4JX8A 4ZQEA 4H16A 1N9GA 2PD6A 3W4JA 4E2WA 4KTTE 3BMNB 3RC1A 5EIOA 4KTVE 2DUUA 4ZVVA 1H94A 4RZHA 3VH1A 3NT5A 1OC2A 2IXBA 3EYWA 4EBFA 3H5NA 4RV9A 1A4IA 2H63A 2P9EA 1V3VA 3KUXA 2C07A 1Q7BA 5ITWA 2H5LA 1Z6ZA 4HADA 2NVBA 3LF2A 3ZU3A 5I8WA 1QYCA 5F1KA 3DL2A 5CDUA 1I2BA 5L7TA 4GPD1 2X9GA 1I30A 4WNCA 3PGJA 1LDMA 4PG5A 4J91A 2O3SA 1DXYA 3FD8A 4RJTA 1R0KA 1P0FA 5ER9A 2JHFA 2J5KA 2C7GA 2VYVA 1D7OA 1MUUA 2PK3A 1JAXA 3IQDB 4XJTA 1AGNA 1Z7EA 4CMIA 2HCTA 2VWHA 3EZLA 1XR3A 3FI9A 3ZV5A 2OUIA 2XPCA 1ZIDA 2DBRA 3DZGA 4XYEA 1E3WB 2B35A 4GAEA 3Q2IA 2NADA 3QVXA 4OXKA 1MFZA 1PJLA 3GFGA 3HDYA 4S1VA 3V1UA 2EJWA 4NIMA 1EVIA 1VJTA 3HNPA 2Y1CA 4I9UA 3F5QA 1YJQA 3VC7A 4BO3A 3ASUA 5J23A 4FSHA 4B4VA 2XAAA 1I3MA 2E49A 2TMDA 1X1TA 2B5WA 2VZ8A 4CM9D 1ML3A 1U8XX 2PKQO 4B7CA 3E5RA 2JHGA 1K6JA 3HG7A 1E7QA 2FZWA 1NQAO 3IKVA 1NX6A 2EHDA 3C24A 2ZYDA 2YDXA 4H15A 4J90A 3PQFA 4BO7A 1Q0HA 3OFSA 4RVFA 4J1TA 3SLKA 4BNIA 1F8GA 3PXXA 1K3TA 2PGJA 1KVSA 3GHYA 2BH9A 3AY7A 4D43A 1ADFA 1V8BA 3TF5A 5EJ2A 3WS7A 5IN4A 5TLSA 1X7HA 1LSJA 4DLBA 3T4EA 2Q46A 1HDOA 2GLXA 1SB9A 2O3RA 3BAZA 1HDGO 1MP0A 1CIVA 5THKA 2VYNA 4Y9DA 2NU9A 1NHGA 3E9NA 4IDCA 4RPLA 1QSGA 4Z6KA 2FR0A 1PZGA 5HBRA 1LLUA 4RPKA 3F3SA 3GG2A 4N54A 1HZJA 3VPHA 2GF2A 3V2HA 3PYLA 5A02A 3AW9A 2CY0A 1GL3A 1ENPA 1XKQA 5T8KC 3QLJA 3DTYA 3GF4A 2PH5A 3DTTA 4F46A 5TQVA 3QSGA 3EZYA 3GGOA 4MDHA 1TI7A 3TWOA 4P4LA 2DT5A 3JQBA 4ND4A 4XIJA 3RUHA 2WD7B 4EGFA 5FEUA 1DRUA 2O4UX 4AJLA 2Q3EA 1K6XA 4WLEA 5BT9A 2HJSA 3PLRA 3ICPA 1RYDA 3UW3A 3SJ7A 4YJFA 2GSDA 5CFZA 2UUPA 3LVFO 3HN2A 4J1QA 1EUDA 3VAZA 1B2LA 3WQRA 4BKOA 1RWBA 3ITKA 3ROKA 5CG1A 1JKIA 1EDZA 2R2GA 1PJSA 3QWAA 1TA4A 5JCJD 3E18A 3GG9A 4Y98A 1DRWA 4PLYA 1IZ0A 5DDIP 2P91A 4IS2A 3NRCA 5DT9A 4FJ2A 4PG6A 4XGNA 3W6UA 5JS6A 2QHXA 4EITA 4WASA 1GCUA 1LC3A 3ON5A 5EQDA 1TVEA 3H9EO 3VOSA 2GO1A 5I9LA 1VJ1A 3PJFA 4I08A 4ZICA 5A06A 3AI2A 3ETGA 1W6UA 1N5DA 1R37A 1XU9A 1PX0A 2YW9A 3E9MA 2CDCA 3QHAA 3L77A 1X7DA 2EEZA 3K92A 3WQSB 4BKRA 5BNTA 5ITVA 4RL6A 1R15A 1HYGA 2GZ1A 3ZI0A 1UZNA 2D4AA 4MVJG 4YJHA 4QT0A 1BXGB 1ORRA 3RU9A 1L1FA 4JJFA 1I3KA 3EDMA 1C3VA 3LT1A 2NM0A 1CDOA 5KTKA 4YRBA 4KDEA 4II2A 3PJEA 1RJWA 1DOHA 3EVTA 1DLJA 3B1KA 2P9CA 4J2HA 5EMHA 3K6JA 1NFQA 3VTFA 4DYDA 1I5RA 4E5KA 3GEMA 3IS3A 1P0CA 4DPMA 4ND3A 3AOEA 4X54A 3TZKA 3PFWO 4FCCA 1YE3A 2ZYGA 4IUYA 4RF4A 1ISFA 4QEDA 3EY4A 4MKXA 3IKTA 3PGXA 3UF0A 1KVTA 1T2FA 5H81A 3SLGA 1A7KA 2LDBA 2ZCUA 1KBZA 2VHWA 2OP0A 3MJTA 3M6IA 3M2PA 4JIGA 1UAGA 3MCVA 5ICMA 3R0IA 4JQCA 4CLEA 2GZ3A 1DJNA 2AA3A 1MC4A 1YS4A 4JP3A 4PLZA 4J0EA 3AI1A 1HETA 1C14A 3CE6A 2IEDA 3IJRA 4ZJUA 1SEVA 2Z95A 2VWQA 4J49A 2H1SA 5JAZA 4YWJA 1I32A 2DPGA 1H5QA 4OO3A 3D5QA 3JD1A 1KEPA 3A1NA 2X9VA 2AEMA 1KOLA 1DIGA 1U1IA 3GAFA 2WYVA 5G2OA 2ZATA 3WYEA 3EHEA 3UVEA 1PJCA 1UXKA 3E9QA 1YL5A 3GRKA 3ZWPA 4LRSB 5G0SA 3NT4A 2RHCA 4DYVA 4AJNA 2RH8A 5COQA 3F4LA 3K30A 2CF5A 3QVSA 4PG4A 2NQTA 1MX3A 5H83A 1I24A 4BGIA 3C7AA 1ADCA 4HFRA 4L9RA 4BNHA 4R4JA 1X7GA 4CQLA 3ZWWA 3BXXA 4DGSA 5L53A 3L6EA 4AJPA 1NR1A 2JD2A 1E7MA 4E31A 2EW2A 3D0OA 4FPXA 1YKFA 4LCEA 4PLVA 5I9NA 5LDGA 1FDVA 3WGYA 3ST7A 3NGLA 5I7SA 3ZV3A 4A0SA 4QUKA 1HWYA 2EWMA 3G3EA 2X58A 4DXHA 3WGOA 2X4GA 3KXDA 2CFCA 2D5CA 1HXHA 2AW5A 3AM4A 2Q1TA 1U5AA 3D4PA 3PHJA 4EI2A 1NXQA 4LMPA 4BO2A 3OQ6A 5B37A 3RFVA 4MINA 2Y93A 1KERA 1DC6A 3VKVA 1HDZA 4R01A 1U3VA 2YHUA 3E03A 2AG8A 5U4QA 3DFUA 2DTXA 2XF8A 4LSMA 2ZKLA 4AL4A 4KP7A 4XX0A 1O8CA 1Y6JA 3QP9A 2ZB7A 4A7PA 4OQYA 3RUCA 4TZTA 1LA2A 4YQZA 4FR5A 4RVSA 4CM4A 6ADHA 2FR8A 3RI3A 4HBGA 4CLHA 4B3JA 4LMRA 3RUFA 2YDYA 1GUFA 4CL8A 1XHLA 4IIVA 1DC5A 3TOZA 3PEFA 4CMBA 2AEJA 2P68A 3I3OA 2IXAA 1P1RA 3OJEA 1M6WA 1KVUA 2Z1MA 4PZEA 1PGOA 4OKIA 4CM9A 4CM6A 2CDAA 5KKCA 1GU7A 3ZHBA 4CM3A 2QRLA 1UP7A 2FZEA 4EDFA 1LLCA 4WGGA 4EUHA 2BGLA 4GX1A 3C1TA 2NQ8A 4TWRA 1IHYA 2NU7A 4RF2A 3AUUA 4J7CA 1BDMA 3GAZA 4FFNA 3MJ4A 4S3MA 1P74A 3F5SA 2Y1EA 3O26A 4W82A 3FHLA 1PJTA 5COBA 1YVEI 3L6DA 3B1JA 4DA9A 2EGHA 1SOWA 1AUPA 2UUOA 4U8GA 4CLXA 5JCXA 5KJFA 4CV1A 4WPGA 1GQQA 3CINA 4OXNA 2JAPA 1Q7CA 1NNUA 1TT5A 3OQBA 4KOAA 3QY9A 4R3NA 2A4KA 1NQTA 1MG5A 2BF7A 1O5IA 2TMGA 4O1MA 3HSKA 1PL6A 3QA9A 4YB8A 4W4TA 1VKNA 3UGKA 1E3WA 3JQ8B 4MVJP 1SBYA 3W1VA 1GTMA 2FMUA 4C7KA 3QE3A 4FJ0A 2V6FA 5AQ1A 3FTPA 4ALNA 2VUSA 1UXHA 2VYVD 1WMAA 3GEDA 2B37A 2WWRA 2ZIZA 4O59O 4AJOA 1QMGA 2IRWA 2Q2VA 4DPKA 3JQDA 2YFHA 4N7RA 1JTVA 1TB4A 3GZ4A 2NU6A 3M1LA 3MTGA 4XB2A 1VL8A 1M6HA 5DCYA 4DMMA 8LDHA 5A03A 5JC8A 4JXKA 2DAPA 5MDHA 4YBZA 1JVSA 4ND2A 2O7SA 4WLUA 3Q0EA 5T5QA 1NPYA 2E82A 1LU9A 3UAGA 9LDTA 3KO8A 1HE3A 2C5AA 3F1LA 3WYBA 1EUCA 1C0IA 3TQHA 4CR6A 3ZU5A 5G0TA 4ALJA 3OIFA 4NBWA 5BNFA 3QW2A 4O5OA 3WSVA 1X13A 2OBNA 1Y8RA 4F3YA 2C20A 5IZCA 1GPJA 1IULA 3ZV6A 5GZ3A 5IXYA 3GMSA 4XWYA 3WWYA 4NI5A 3PPIA 3VZPA 4CMCA 3ZV4A 1WPQA 2ZCVA 1T4BA 1UH5A 4CMHA 1E92A 2GNAA 4UVEA 5TSDA 1JVBA 5L3ZA 1RKXA 4MIYA 4TROA 4NU5A 1EMDA 3HUDA 5L45A 2I6TA 2WD7A 2X7HA 4BGEA 4CM7A 5B4VA 1VSVA 2Q45A 4RPHA 1UJMA 2J5RA 3FF4A 1C0KA 2GD1O 1H93A 2B0JA 4AJKA 2B36A 2RHRA 1ZCJA 2VWPA 4FOSA 5G0UA 4PG7A 3VDQA 4BO6A 1JWBB 3H3FA 1KEVA 4BGVA 1EK6A 3DR3A 4CV3A 2PA3A 1VC2A 1KIFA 4FD3A 4URFA 4TRJA 1PZEA 4K1LA 1T2AA 3WWZA 1ONPA 2IZZA 5GY7A 1HSOA 3CIFA 1NTOA 5FI3A 4R51A 3ZWMA 3L6OO 5C37A 3VPXA 1UP6A 2ZYAA 3RD5A 4BUCA 3FN4A 4AJJA 1I2ZA 4D45A 3R3JA 4P38A 2JD1A 5BSEA 1ENOA 3GDGA 3PIIA 3BHJA 3D1LA 4PIVA 4A26A 4B8WA 1ZSYA 4WCFB 1DHTA 5DNAA 3ZWXA 5C7IO 4NQZA 4UUOA 3PJGA 4YR9A 4XCVA 1F06A 2Y66A 3HFGA 1JKJA 5TF4A 1GD1O 3PI7A 2E48A 2ZQZA 4YAJA 2HAEA 4PCVA 1CJCA 5A9SB 5CP8A 4BL5A 3FSRA 4BO5A 1KY5A 1QP8A 3DHYA 1BXGA 3OJLA 3GT0A 4U7WA 4AG3A 3AM5A 4LCJA 3ZW9A 5KVQA 2QIOA 3IIEA 1UAYA 1HF3A 4BS9A 4D42A 3ANNA 4TMFA 4RORA 4QTZA 4NJMB 4F6LA 2C54A 1S6YA 2PY6A 5AVOA 2VCYA 1J6UA 3DZFA 3BYZA 3VTZA 1G0NA 1ZJYA 3JSAA 1R0SA 2O23A 1BVRA 2V6GA 1EE2A 1E3JA 3VH3A 4GGPA 2AQIA 1T4DA 1CYDA 1E1NA 1GUYA 3B70A 3NKLA 4H3VA 4CM8B 4BOYA 3F1KA 4EJ0A 1I2CA 4QECA 3ZNPA 1DC4A 1SZJG 3BMQB 3K96A 2EP7A 3QV1A 4IJKA 1SC6A 2CZCA 2DTDA 3TL2A 1JLLA 2OGUA 2HUNA 3S2EA 4R16A 1EVZA 2CD9A 4XRGA 4OJNA 2GGSA 1ZK2A 4YAEA 3GVHA 3MWDB 3BIOA 4IMRA 2JFGA 2R00A 3I9JA 1E3EA 2AQHA 3GNTA 3JQEA 4JNKA 1VLLA 1NAHA 1QV7A 1H0KA 4XQEA 5IAAA 5DOVA 1GV0A 2VRCD 4WE3A 1P9LA 4XZ3A 3VKUA 3BMCA 4NBRA 1HSZA 4U0KA 3DOCA 4FFOA 4BB6A 1EK5A 3G1UA 4ALIA 3DQPA 5JDCC 2OORA 4JN6B 3U4DA 5DN9A 4P8RA 5EINA 5IXSA 4IDAA 3SVTA 4WNIA 3GVIA 4Z0TA 4YCAA 2GRAA 4EUFA 1O6ZA 1UZMA 2GN8A 3TPCA 1BXKA 5ILOA 3LF1A 4XGIA 5U9CA 3NX4A 1B15A 5ES3A 1DEHA 3V1YA 2Y05A 3RBXA 1YQGA 1RM3A 2V6BA 4J43A 4CM4B 3M1AA 1ULSA 3U62A 4RPJA 1YRLA 3OSUA 4NBUA 2FSSA 3DOJA 2VHVA 1DB3A 3A14A 3B1FA 1P77A 4MIOA 1IOLA 2X23A 4XDZA 1U2DA 1OOEA 1NVTA 1LSOA 4O63O 1B8PA 3WNQA 1DC3A 4RF3A 3VHRA 3BHMA 1LRKA 3BHIA 4WEQA 1CWUA 2O4CA 1U8FO 4EJMA 1LX6A 4K9DA 4M55A 3CMMA 1GAEO 5DBIA 2WSBA 1XIVA 5MGBA 5L4LA 1LTHR 2OBYA 1UXIA 1NQ5A 3FNFA 5BR7A 4BO4A 3EMKA 3TFOA 3V5NA 4GX5A 2GUGA 4UVHA 1Z75A 3ZDFA 4Q3AA 3HZZA 4IDGA 3E6AA 1LC0A 4XKJA 1EBUA 1Z45A 2W98A 1DAOA 1NBOA 4AJ1A 2C5EA 3TRIA 1QXSA 3PP8A 3Q9NA 4ZA2A 3KYBA 4II3A 1QRRA 4FJ1A 3QVTA 1Q0LA 1PGPA 1FXSA 4FQ8A 1HDXA 3FBGA 4TVBA 4BNYA 2ZK7A 4OSOA 2PZLA 1ZW1A 4I9HA 4J1NA 1TT5B 2F00A 3DAFA 4PZCA 4OXYA 1E7YA 3FBTA 4OHUA 1QKIA 3C85A 4PFJA 4UVGA 3WGQA 2YYYA 3WFJA 1QORA 2PNFA 3SXPA 3K2BA 2HMUA 4L8VA 4CV2A 4FFLA 5EPOA 1Y81A 1DBVO 1XELA 1HE4A 1DDOA 4PRKA 3JQ9A 3K31A 4HX5A 2VNSA 2VTDA
chains in the Genus database with same CATH superfamily
1SNYA 3GLIB 1R7RA 1HT0A 3DKKA 2ZRQA 4OH1A 3VH4A 2NPOA 3WLEA 2IL1A 3PIDA 1C0EA 2WA1A 3GT4A 3K9CA 3MTJA 4KMRA 2MJLA 3DMTA 3OCZA 4NHEA 3UMYA 3K0FA 4J4HA 1X7ZA 4TWZA 4YT5A 3TKYA 4ZDKA 1YJBA 3CH7A 3H5AA 5HGXA 1ZI9A 1HA3A 2YS6A 1ZOIA 5CA0A 4LQLA 4JJ7A 2QAGC 5TB5A 3V8MA 4O33A 5KNDA 4JU9A 1QO0D 4C4SA 2FSHA 5K6AA 2Q0QA 1Q2XA 2P5YA 1CNEA 1N1EA 3OE1A 1XQ9A 5KO2A 2RAFA 3LIIA 4LYJA 4MRPA 5JYEA 4AECA 2FPIB 3R9KA 1IWBB 5J4KA 3HFSA 1A72A 4ENQA 5JW6A 4D74A 1M8FA 5EIEA 2FN9A 1JB9A 4GKJB 2JGNA 2QUKA 1BWQA 4QGBA 4ZVOA 1WQ4A 4KLZA 5BUCA 1EUCB 1V35A 1B3BA 3GLKA 1TF2A 1P2TA 3SEFA 2IS4A 1DCFA 5EYPB 3PD0A 4BLQA 4CLOB 2W2LA 3KM0A 2QQGA 3HTXA 4UUNA 1W8IA 3EG5A 3DP9A 5FTNA 1Y9AA 4G63A 5E8RA 1Y8RB 5B2ZA 5EWJA 1D4FA 2PKQP 3A9WA 3SOPA 3JQ8A 2RKBA 1Z26A 4PZDA 1QZTA 1SUSA 2GEBA 2FEOA 4MP6A 1SJ9A 1UDAA 1BCRB 3QITA 1ZMTA 3LK7A 4UPDA 4DCPA 3CH6A 2BEKA 2FPPA 3Q98A 1KDOA 1O97D 1TVKB 2I71A 2J3JA 2FPGA 4FDAA 1R9NA 2PE5A 1W5FA 4KQ9A 3LOPA 3ETDA 1O94D 1QHIA 1R6DA 2I87A 2O0HA 1TVCA 3CUEF 4QPJC 4CVNA 2WM9B 3PGA1 1I01A 4Y1FA 3KTOA 1A4RA 1ACMA 4RH1A 3VUEA 1HMPA 1GGJA 2GBLA 3MG9A 4FHZA 4XD2A 3W6PA 2DBQA 2EARA 3RSFA 5F7OA 4KN9S 2H00A 3OFVA 1EFKA 1JXMA 1XFAA 2NNLD 3QH4A 3AZPA 4GI1A 1JTEA 4MHSA 4OCZA 3LT0A 3NW9A 3JWJA 2BFMA 4L75A 4EHBA 1T8WA 5D85A 1JWAB 4FMCF 1YVUA 4W5RA 3OEEA 1XZPA 1VRCA 2X13A 4YRPA 3BL5A 3QMMA 2IPLA 2GXUA 3N2EA 3YASA 2Q6OA 1W2GA 4JT9A 1Q1NA 1V37A 3PR1A 2OQRA 3UG7A 2IEAA 1D1SA 1J8FA 1JXOA 3EZ6A 3IRVA 1H2EA 3BD6A 3PPXA 3DZIA 2F3TA 4XTCS 2PO5A 1G2QA 2ZB2A 2KM1A 5IC6A 3U1VA 3WY9A 1NWCA 4L3WA 4ZRDA 2GCNA 5IYZF 3GDHA 5J2TF 5TPZA 1EJ2A 4CKCB 4XR9A 5T57A 2H3EA 3KQPA 3QLTA 3TIXB 2PUCA 2IIPA 4B17A 2WK1A 4C20A 9LDBA 2B5OA 3KRTA 5IMBA 1JKJB 3IUPA 5BVGB 1CRQA 4HN9A 3IP9A 5C8VA 3VZQA 2ZJ8A 4D81A 1X42A 5DF1A 4OVKA 3A4TA 2P6OA 4KXUA 1PEDA 3A4MA 2VAVA 2MIIA 4I2VA 1CDZA 3M5CA 3KD3A 3ZX4A 2GBFA 1H2XA 1JDVA 1XHFA 2IFTA 2ZE7A 2Q6LA 4D5EA 4PPQA 4WOCA 1JJFA 1WV0A 2Q9UA 2QUHA 3ABSB 3FPAA 4GFDA 1C7IA 3FNIA 1Y42X 4YFYA 5KHLB 1YR6A 2UDPA 4DFDA 4R54A 5T6MA 4NF2A 4DEYA 5JMPA 1QGUB 3DZJA 4TMTA 2MSLA 5B1IA 1KS2A 4AY2A 3DL0A 3FLMA 1PR0A 1VIVA 1KAHA 5HKKD 2FH5B 4RDIA 3G2MA 3F6SA 3VVBA 3KJGA 1BMFA 3HBAA 1J0CA 1P62B 2Y4NA 3HY3A 1ZRNA 3NIGB 4UM7A 4XQCA 2OZPA 5ENDA 4FLFA 2UYYA 4RA9B 2LPMA 1FTNA 2VJQA 3A10A 4RUKA 1OQAA 4BMYA 2WSSA 2RH4A 1QE5A 3K2EA 4AF6A 1H85A 2G1PA 1CUVA 1SVUA 3P9KA 1ID1A 4G0ZA 3OEYA 3L6CA 4G24A 4LWPA 3HEBA 5F3WB 1Y5RA 3P9CA 1IPEA 2W2XA 3V32A 4E4RA 5C7OO 1O58A 1ZK0A 5G4KB 3K4PA 1TO6A 5B1DA 2PV7A 1LSSA 2XUDA 3ZIUA 4F2PA 4WCFA 1A5BB 1RC1A 2A5FA 4CYMA 1NJ6A 1YMVA 1QIIA 3ABIA 1W36D 1SQ5A 3MGBA 3WRVA 2Q5CA 1W6RA 1XU7A 5G02A 4K2HA 4GHWA 3WL3A 1R0RE 3P45A 1RYNA 2WKRA 1OFUX 4CGYA 2YZMA 3U3KA 5A9SA 1K6EA 2ZSHA 4KQEA 2ZREA 2P4QA 3OHPA 3UT0A 3A3OA 3VZSA 3L07A 5A5EA 3RVLA 1W8DA 4Q16A 4A1FA 4BFLA 1R18A 2VSYA 2W6NA 3L0YA 4R1SA 1U7UA 1SQFA 3TR5A 5KSZA 1EZ1A 1AX9A 5JG7A 4RGVA 3TTYA 1YI1A 5BV8A 5CA0F 1Y3FE 5KPDA 2V8BA 2A92A 1OIXA 1C7JA 2QD5A 4AN1A 4E2ZA 1NAIA 2IKSA 4RZIA 3SQNA 1NMQA 2CL6X 1JZQA 3Q7IA 5CMLA 5BN5A 1NF2A 1JA0A 4FEEA 4JGIA 4URHA 5FJJA 1JXQA 1A9ZA 2IEYA 3NAMA 3CF6R 1IZYA 1IAQA 1N7HA 1QF9A 1TM1E 1M76A 2AQKA 2IHKA 2QD1A 2QLBA 3O1HB 1IONA 5A05A 4BB0A 2GD6A 2YOFA 2XT9A 4XB6B 8AT1A 1CZLA 2BKLA 5IT0A 1DMSA 4CKWA 3ISTA 4YCBA 3BMQA 3EVFA 4ED9A 4ZZ1A 3DDNA 1P2VA 4LTDA 4WOPA 4TXMA 3WLHA 5KDLA 3DVRX 1V1RB 5CB8A 1L7OA 4B3FX 5G0WA 3GJ0A 3ZJVA 1BCSB 4I8IA 1GAJA 1OZ0A 2IE0A 2NSHA 5JUWA 3RC7A 4C88A 5CA1B 5JI3E 1YH3A 1E0KA 2J9XB 3LKDA 4BX0A 1Z35A 2JHCA 2VDPB 3JQAA 1YC2A 3J81A 1FQWA 1KPIA 4QYIB 3G0BA 3C39A 2DMRA 3O1LA 1FFCA 2QX9A 1SUCA 1PNOA 2QY9A 4ETNA 3BK7A 3PQ3A 1L5MA 1QHHA 4GWKA 1HE1C 1TJ5A 5K2OA 4FTWA 2WWGA 4DIFA 3MBKA 5ESWA 5REQB 1PLLA 2HGSA 4D3ZA 1ZM4A 4DV4B 3DFZA 2F43B 3LX4A 4L4XA 3MMXA 5FBWB 3OKFA 5JLAA 3DO6A 3HJRA 2QUJA 4IPTA 3NYRA 3HKBA 2VDWB 5L3RA 5TPWB 4F97A 1GZHB 1Q5PA 5HIIA 4R2XA 1WB6A 3HJFA 1ECFA 5FWDA 2HSDA 5EHIA 2VXCA 2R25B 5IAOA 3RPEA 4ZDWA 1W4LA 4QBKA 2BKXA 1O4WA 3PPVA 4LE0A 1U2PA 4AUMA 5IUKC 4B7AA 1T4MA 1MC5A 3EASA 1SBHA 2CCKA 2HHLA 2PSDA 3TNLA 3OU7A 1QKKA 4AXBA 3FNBA 4FZVA 4HQRA 1CVIA 4HDMA 2ZG6A 4BFZA 1B2RA 2FPLA 3RT1A 3LC2O 3GDOA 2XZOA 1HZZC 1PWZA 3GUVA 4QPPA 2PT9A 4DSNA 4OJQA 5CT6A 4ENPA 3ZOKA 5C3UA 1XEAA 3G0CA 4M22A 3NPAA 5THQA 5KTRA 3CVXA 1H1LA 2CBZA 3CLUC 3G59A 3HMQA 4HCJA 3ROPA 5K0JA 2QG6A 3RVDA 4W5NA 2FSVC 4MWTA 3V8PA 3AI3A 4DSZA 1Q0RA 1KJZA 5TVKA 1IYZA 3HR4A 1SQ6A 4YP6A 5JS2A 2HNAA 3N8IA 1JW9B 3K0FB 3KS9A 2QM0A 4G0QA 4E4YA 5CPBA 1O0BA 3TCNA 4C04A 2PFGA 1UXGA 2ORWA 2DEUA 3PDHA 1UPCA 4CIVA 1RQRA 1VHLA 5LSAA 4DV0B 1HNWB 3EFBA 1KC1A 1GDHA 3ZHQA 1V11B 3D4NA 4HDRA 2D0IA 2FQXA 3E7PA 3SCZA 3VR4A 2HR1A 3WKCA 1U7ZA 1OC4A 3H6KA 3Q4GA 5JTTA 1NMYA 2LKCA 4BC1A 2GARA 1KFBB 3K0KA 4DZZA 5BYKA 2QE7D 4KQJA 4O6VA 1ZQ1A 4CKBA 3MGGA 1P1KA 2QTGA 4HDOB 3TZQA 2GTIA 3IA2A 2ZXFA 5C32A 1LW6E 1RHQA 4Z0HO 4NCKA 2GYYA 5ALPA 1QFXA 4G09A 2D13A 4I8DA 4YIHA 1PTKA 3L1UA 4P7KA 1T91A 2RH9B 1EHCA 1GQ2A 2YRWA 4ANFA 4MLPA 1FMLA 3D7NA 2EKZA 3DV9A 3ZD9A 4TTIA 4BNVA 4WZZA 1Z63A 3AWDA 5EXDA 2JFXA 4PAGA 3ZKAA 2ETXA 4TM8A 3IVRA 3TLAA 2V96A 3PSAA 3SY8A 4PONA 3VNBA 5I7RA 3QYJA 1IEVA 1II9A 4D9EA 1FIUA 3RE1A 4P7BA 2PLAA 2FPPB 1DAEA 1X80A 1V5WA 4L5YA 3ZTWA 3WADA 3PXUA 4IGFA 1SCUA 1WCXA 4TKMA 4B9EA 4H7FA 1LNSA 1R74A 1XA0A 2KBFA 3C7KA 4UBMA 4E03A 5KYYA 5IKXA 4YJ2F 3H8SA 4MAAA 2BHLA 3WOVA 1SCIA 5I9TA 4F5DA 2DPYA 1NVVQ 3LTEA 4Q3EA 5CDFA 1Q57A 2FN7A 2GUWA 5F7XA 2B5VA 4IHQA 1QV9A 4XFKA 5E2AA 2Q3FA 4ZGGA 5AKIA 2IOYA 2VJPA 2SCUB 2ZULA 4FYXA 9GPBA 1GTRA 4KSBA 3EQ8A 2O8FA 1EHIA 1RCFA 5DP1A 4BQIA 2W2KA 2A84A 2YCLA 4Q1CA 5AJVB 4BYGA 4PNPA 1DUIA 3DGEC 3LLVA 3PLNA 4DMGA 5L4NA 5K09A 1ABBA 2QPAA 3KXPA 4BNXA 1UMBB 4DPLA 1YBFA 2FFAA 2MYNA 1CEXA 3A4VA 4D4HA 4R2KA 4G5RA 3B7GA 2WB4A 4MYUA 1LW7A 3VNRA 2O48X 3H7AA 5BSTA 4KR3A 1DKQA 1OH7A 2EC5A 3ADDA 4E12A 1CEEA 3K0CA 3SKXA 4CETA 1KJQA 1YTLA 2M2IA 1SR8A 2PX2A 4YRLA 2D00A 4PICA 1DTWB 1FFDA 4EGSA 3HY6A 3WKEA 5TS3A 5LYJA 2CV1A 5KX5F 2AG5A 1DDIA 2ERXA 4BN0A 3EEQA 3DUFA 3A6PC 1ZK4A 4MW0A 3IE2A 4JIMA 4EMBA 5LWQA 1W73A 2VDLB 2CCJA 2CYAA 4OM8A 5E7MA 1GEGA 1XCOA 2YINC 3JYLA 1SBIA 1Q3HA 3OJCA 4TSKA 3ZXYA 1RPJA 1NBHA 2CMKA 2W2LD 4EJSC 5IVPA 4AKGA 1PSZA 2GVZC 6CHYA 3EZXA 1J0BA 5F5LA 4JBIA 3SBOA 4EBBA 4ZGWA 5JXWA 4Q4JB 4BX9A 1E1MA 4EA7A 5TMPA 2ZBRA 1XQ1A 5KYUB 4MS1B 3HN7A 4L8WB 5KVCA 4E11A 4XB1A 4PPFA 1HRKA 3N3BC 3MEQA 2C2GA 1S9HA 3DMFA 3W05A 4DRZA 1YB1A 4O4IA 2CBXA 2O2SA 2QN7A 2WSYB 5GV7A 1YR8A 2O8BA 1ESZA 4I0WB 3WK8A 2XQIA 1OWMA 3GLQA 4MS4A 1YB4A 3G0IA 1K1EA 4YI5A 4EYOA 4EG7A 4CMGA 3AU8A 2BM8A 5JS7A 3FHOA 3FOBA 3KOZA 2F9MA 3CMCO 1PDVA 1YR2A 2PKEA 1G18A 4BASA 3O91A 3I9OA 1I7LA 1SCNE 4OH7A 4OQXA 3ZHRA 3N0VA 1RBQA 2R84A 5ALEA 1IJFA 3HXTA 1G6KA 4DMUB 2FHSA 1FJHA 1LI5A 2DSTA 3FVWA 4LXHA 4ND8B 4XUDA 3FWZA 4Q37A 3QOXA 3JRNA 2DJIA 2CMHA 2R2AA 1GZ7A 1FC0A 4ND1A 4LZWA 4PXAA 1DFHA 2O7NA 1H0RA 3UMRA 4Z5XA 5MFPA 3QBDA 4LOKA 3DV0A 1CQPA 4OK6A 3AERA 4MQ6A 2FDRA 4RSGA 4BNMA 4D4KA 4A73A 1YFJA 4G81A 5D51S 3R5JA 1F6BA 4GSLA 1T4GA 1RC0A 2XUJA 4NE7A 1J24A 4XLTA 2FOIA 2CSUA 2VJYA 5J2UB 2NGRA 1PQYA 1XROA 1QYDA 4UTPA 2CJYA 2QZSA 2ZE6A 5TPZD 4QBIA 4D9CA 1JJAA 2W6JA 3D3WA 3UGTA 4ZDJA 3EVAA 4QE3A 1I5EA 5KHOC 1ECCA 3E82A 2CL5A 5K3AA 5J58A 5LQDA 3TMYA 2WMNB 3BCUA 5TS2A 1M6VA 4UDNA 1P8JA 4P4SB 4UVDA 2DXIA 3G23A 1O95C 2XCQA 421PA 3RYFB 3L49A 1QWSA 2H5IA 1QGAA 2H07A 1GQFA 1V96A 4XGKA 4DJFC 5KTTA 1V8FA 4RQAA 1HLFA 4QUHA 4I5GA 3GJXC 1JFTA 3R75A 4OQQA 2D6FA 4KVZA 3TJZA 2GAAA 2R7LA 4HAWA 4C5BA 2AB0A 4NG5A 4LK3A 2W8BB 2ATIA 4M4SA 3AOEC 4KO1S 1NI3A 1AUQA 2CLDX 2JIMA 4OYHA 4X61A 1FTYA 5A0FA 5KYNA 1L4GA 2QVLA 1KFJB 2B1RA 4FKBA 2A0YA 2OBFA 3LP6A 2V55B 5T41A 4YDQA 1VYUA 4KQIA 3MLEA 3ND8A 1Z4IA 5LQNA 2JJMA 3RYCB 1BMFD 2EX4A 5K0FA 1ECPA 1TQ4A 1D8TA 2FWPA 4PYOA 4B40A 4JVNA 3F9IA 4X6YA 3VVMA 1Z56C 1U1EA 5F77A 2E4ZA 3B20A 1ESMA 2JB9A 2GJ4A 3S8YA 3IUYA 4GI7A 2WU1A 1ZFNA 1JG4A 1XP5A 2PSSA 5EERA 5D8DA 2K6GA 1Z16A 3U5ZB 1QVVA 2DFLA 2VOEA 5ELXA 4K8RB 4UVIA 1XDUA 2IYSA 3ZU2A 3K70C 2IHBA 3OQ1A 1PZMA 1RTTA 1T0HB 1XZMA 3QNUA 1SG9A 3THXA 1E7SA 3JQAB 4R1PA 3T7EA 4C3VA 1WZEA 4JHXA 1MEJA 4MV0A 2O1SA 1EDDA 4LJRA 1EFTA 2NO7A 2C2ZA 1U8TA 2B1QA 2BRUA 1L3IA 2PUHA 3DBLA 4MOWA 4RGYA 5HKLA 3RYIA 3ODGA 4RTPA 2HPHA 1DEXA 5C31A 4HZUB 1XZEA 3O8CA 3GHHA 1JIXA 3L79A 3ZW7A 1TK3A 1JECA 1KZHA 4WZAE 4OHZA 5G1OA 1TZJA 1RP7A 1VI5A 2ODPA 2QW1A 1BN6A 1MQ9A 1NPTO 4L74A 5KCMA 4AZ0A 5JAQA 4HQ0A 3COJA 1EVKA 1Q22A 3DHEA 3W1WA 4PLWA 3J7AC 3AUSA 3WIOA 5A04A 2YFYA 4FP9A 3L7BA 3OEWA 4CLRA 5CGZA 1U0HC 2H0QA 2QQ0A 4QYTA 4UDYX 3H65A 4IH9A 1L7NA 3DBHB 3EC1A 4N03A 5EP1A 1L0BA 2C83A 2ZJYA 1MDFA 1B6GA 3NHFA 3FUXA 4DJ5X 1LRLA 4NYJQ 1V7PC 3Q11A 2D1YA 2P40A 4IXTA 4PLPA 4Q3OA 4UHCA 1H65A 3F98A 4PX3A 3TN7A 1G19A 4V0NA 1W52X 2OYCA 3ZHCA 3WAJA 4QQKA 4N6OA 1C8KA 4J9UE 4MWEA 2FJUA 3I83A 4MQ5A 4TTSA 5JAMA 5HIAA 2DB3A 3P9ZA 1L7PA 2G9VA 2B0CA 4KE6A 1TRHA 4BJ3A 5IM4A 1GNLA 1X92A 4LQ4A 3KETA 5HM6A 4LIPD 4TGLA 1J07A 4N5MA 4D0SA 1R4MA 4JL5A 3M3HA 2P77A 5TVGA 4BVLA 4ERXA 4F8YA 3SC4A 1IQUA 2OV6A 3BSFA 4GI2A 2I03A 5L51A 3MCAA 1L7RA 1XG5A 3KAJA 4HV4A 2I0FA 1WKBA 1WS6A 4ZD6A 2ZIXB 2CJPA 2Q8NA 3BHNA 5HJ5A 2ZZMA 2ZRLA 2XNHA 3WHLA 4EGAA 4JBHA 3JQAD 2V8OA 2WWHA 2RB4A 2WFZA 2FQYA 4IDHA 3JQGA 3P2EA 3OM9A 3MJRA 1CJBA 1LGYA 1I1HA 1JDSA 2GXSA 2PJUA 3AUAA 4F3NA 2VPTA 5AXDA 1RBYA 2BMAA 3KLMX 3RRZA 1KEZA 4A2PA 2E4XA 3VJRA 4PHGA 3P2OA 1WTCA 3CO0S 3INNA 5I9BA 1DARA 4J94A 4NY1A 4WXEA 4Y6QA 5KYGA 2BDTA 4UBKA 2ZB8A 2QLJA 1QIKA 1F12A 2MSEB 2IZ0A 3FG9A 3G02A 3SZ3A 3O0DA 1YBVA 2AOXA 3DEZA 1Z4QA 3QNMA 4QWMA 4RIGA 4UXJA 2WTBA 121PA 3DT8A 4G65A 4EG1A 4IFEA 1FF9A 2F67A 2BTQB 1XAIA 1T9HA 3DCIA 3T1NA 3FIUA 1OKKA 4MR8B 1XBTA 2LTAA 2OYSA 4MV1A 1KY3A 3CCBA 1A8PA 3DAYA 3IQIX 3O8QB 2EFHB 2NP7A 2CNKA 2G6BA 4RPGA 3JD3A 2ZSDA 1J4AA 1PS8A 2XUIA 2D7CA 2ICAA 2ZSAA 1DXOA 2B83A 4ITVA 4MJLA 3TFQA 2FP4B 5I9SA 4HN4B 4MQEA 4C2AA 5KYYB 1E2HA 2E4AA 4DV2B 5EP3A 2I5PO 3LUGA 2J1LA 1BROA 3PQ2A 4DCNA 3HKEA 4MXDA 2E6UX 4KLRA 4LJAA 5DCLA 2H4ZA 5EE3A 3B51X 3TX6A 3V1LA 1EBBA 1P4JA 1V8ZA 3MJSA 1XUOA 4N3BA 3SHQA 1S3FA 3WYCA 2YWGA 4HKTA 3C7DB 1NRJB 3O4FA 4BNFA 5ICEA 1QCDA 2CB0A 1A8SA 3KQQA 4HLUC 5TY0A 3IYLW 2O1WA 3PFBA 5H8WA 4P4UA 1JPVA 1QYXA 3WGHA 3HV2A 1E9AA 2HQSA 4MRNA 1ZMRA 1VSUA 3VKGA 3UW1A 2ZUCA 4CJXA 1GCOA 3C5HA 3EXIA 3AEYA 1VCIA 1V1MA 1XYGA 4E15A 2CKDA 4KHPB 3FLBA 5ERYA 3CWQA 3VR4D 4EFNA 3LHSA 3RCBA 3WKDA 1UMCA 4Z7QB 2ZTUA 5LKRA 4DUZB 1IBCA 2PMEA 2RHGB 3KZOA 3L4JA 4GYWA 4LXXA 2AEFA 2BGTA 4RTNA 4Y2XA 1P8AA 1ZU4A 2G83A 5HOQA 2WINI 3N2GB 4CF7A 3FMVA 3MHTA 2JGRA 3OQPA 2VTBA 3WWEA 5K0EA 1KDTA 2HUPA 3LY9A 2FFHA 3GIWA 3HDVA 3ABQB 1UC5B 2HDWA 2OXIA 4WACA 3WIDA 3TOXA 4R68A 3JPWA 4FFBA 2JI8A 1I6MA 2XQJA 5CURA 1PWEA 4K28A 3IEVA 4PX5A 5HF5A 1OTXA 4QFMA 2IWHA 2LIVA 2O6HA 1DAKA 2WJYA 1PZNA 1QPZA 1U2GA 2AFRA 3W5JA 2H2FA 3GX1A 1G8HA 2X1LA 3AY3A 4K3VA 1ZD8A 1G17A 6PFKA 4CUKA 4MS4B 1CUSA 5EEGA 5FLYA 5AJYA 1OY1A 4KJXA 2AMJA 4W5TA 1I9GA 4XI9A 3A9SA 4FNGA 2ON6A 4HEHA 4EO4A 1W4ZA 4LAFA 1WBDA 1OFVA 4HB2A 1RHMA 1GPDG 4RVOA 1UFVA 3IB6A 3RIHA 3GLUA 3RTEA 3QPBA 3UK1A 3O2QB 2ACVA 1YIOA 2PBLA 4GVPA 3ZJUA 1Y7IA 4ML3A 5EIAA 4MYCA 4BRWA 2YYZA 2H8GA 5AKLA 4U7JA 4C6TA 4UBNA 5IZ4A 4QASA 5EQTA 4FB5A 1GG5A 2LXNA 1UJ4A 2QLNA 4PIMA 1QFMA 4DNOA 3ZI7A 1KNXA 2YS7A 1A88A 2X1MA 4G37A 4EZEA 3AERB 1USKA 4LJYA 3ZVMA 3IIKA 3CW9A 3I32A 3MT8A 5E6RA 3TRFA 3ZHXA 3PKJA 1K2VN 2C04A 2JZNA 3LY7A 1OT5A 4KH0A 5K0CA 4D46A 3QKWA 4E51A 1MTZA 1JHPA 3S8EA 5IM4F 2YY7A 1STOA 1BE0A 4BMXA 3N05A 2JI9A 5KTSA 3RVRA 4RJKA 2DKFA 4GUDA 5LMNB 1MKYA 4OGGA 3D3WB 2DR0A 1AKTA 1FMCA 4ONEA 4R2MA 2VKTA 4X1KB 4YJ3A 4AKEA 4HAYA 3OQIB 3FOFC 2XRYA 2NVWA 4Q01A 4HGNA 1E5LA 4ID9A 4RCVA 3UAYA 2XZLA 1TJ3A 1E2GA 1TZMA 2ATVA 2HLDA 3C45A 4ZAWA 2A9PA 1A27A 3R7WA 1C41A 2IVFA 2R8EA 3KR0A 3LYHA 1YFKA 2OC9A 3X43A 3AZQA 1QQ7A 3K05A 2IU6A 1T6BY 2YV2A 4PYLA 4FGSA 2MT9A 3QK7A 3ILYA 3GLHE 3MK31 5SZKB 3GP8A 3EAGA 2IEBA 1R5BA 1KVQA 3TRDA 1AKVA 4ESOA 5HKOA 3EXEA 1ZM3A 1F48A 2E0IA 1IHOA 4IGIA 5IAGA 3C8HA 3VAAA 4RAQA 3ZX5A 1W36C 2SKDA 5BQ5A 2GHRA 1P2BA 4JJEA 4D41A 1HYEA 3NG1A 4QNNA 3RRYA 4PXYA 5B53A 1RZUA 4N8EA 4O1HA 3JAWB 1CCWA 2AXNA 3E61A 2H1OA 1H0HA 1GSOA 2FU5C 3AJRA 2WG0A 3ZHZA 2VXYA 4MUYA 4DC0A 4CIYA 3TZLA 4OREX 3IVGA 4BGUA 3M4NA 4IZ6A 4C4TA 3NIFB 2EQAA 3HYLA 3STHA 2J3IA 1G4HA 2G80A 2IGTA 1C9EA 2L82A 2WP0A 4HH4A 1L5LA 3VPBA 1OD6A 2QG9A 3T3EA 1N2ZA 4O8ZA 2JCYA 2ZRCA 3SDZA 1IE3A 1CERA 1ESDA 4O29A 2IIBA 4DJAA 1UODA 2C3OA 3R3UA 1E59A 1I0IA 4AWXA 1QR2A 5GM1A 1N1MA 4DNXA 1XNGA 1YOVB 2VDRB 4OYLA 4FD2A 1OIVA 3GOHA 3KC2A 5GOTA 2XA9A 3VO8A 1K4MA 1BHSA 2PEZA 1LQUA 2J9RA 1QCYA 2VDNB 1CF4A 1N0UA 1AKMA 4IJMA 2BE9A 1JG2A 3JAMA 5KKAA 3V4ZA 1RWOA 4UOZA 1ONBA 2W6JD 1VMEA 6GPBA 3CURA 4P33A 1Y9DA 1YVRA 3L93A 4KRXA 1ORDA 5E6UA 5CFMA 2ZJ6A 5K3OA 2HMSA 4RDHA 4MCHA 4KWTA 1V6SA 3KALA 1TTHA 1PL0A 3FGPA 4UUBA 1Z18A 1FX0A 5ALYA 4IIDA 3S28A 3DLCA 3FWKA 2CUKA 1Z25A 2C0PA 2PMKA 5J1TB 3ZQUA 4BZWA 4DG5A 3UQZA 4ZRNA 4FU0A 3Q40A 1GG2A 2DHCA 3KEOA 2NACA 4M9RA 4S1WA 1GRNA 1B8VA 2ENWA 4AJEA 1HBJA 5JDCA 3T5BA 4ZC8A 3UJNA 3G8DA 3W9YA 2Q0HA 3PE6A 1BKSB 4Y9SA 4ZI7A 4FWTA 1TYEB 1A76A 1VRVA 1YQDA 1XL0A 1BGWA 1K3FA 3N5CA 3K8OE 4Z8YA 3DS8A 3ZNQA 3NUQA 5IAKA 1FX1A 5KYTA 1U0BB 4WFJA 1N2HA 1E1CA 4PPNA 3LE8A 4OIMA 3GRFA 4ON9A 3FRJA 4Q9AA 1P4AA 2R8RA 3CCFA 1O77A 2OKCA 2ZRIA 3IEIA 3CNHA 3AETA 4HX2A 4JZYA 1O6GA 4GE0A 2ECOA 3OT5A 5EESA 1M66A 1X77A 2NVUA 2K2WA 2C9YA 5D7BA 4A1OA 1TMYA 5K20A 2WQ6A 5B7NA 1IPFA 2MHCA 3U16A 1F2UB 1JLMA 2QJRA 3F4BA 3SNKA 3VXKA 1EXDA 2JLVA 2IPMA 5AXBA 4W9RA 4WQMA 2HJ9A 3SXJA 2G25A 4Q4LA 1G5IA 1I4WA 2AT1A 3BSWA 1VG8A 1VKZA 4RC9A 2X0EA 3RFTA 3U7FB 4QO7A 3LWNA 1N0HA 3K8YA 5E4TA 2WAXA 2A1TR 3GNQA 1FUIA 3IVCA 3DBRA 1XAJA 2JH3A 4V0RA 4AJ2A 2C29D 3IAHA 8ABPA 2WE8A 4ZQIA 4OK3A 5EJ8A 3LO8A 2Q5EA 4FLMA 4YQEA 3I4CA 3P2IA 1SCDA 1U5BA 3UPUA 3JD4A 2I2DA 2YHIA 4YYEA 4FNOA 1BW9A 4X85A 1GPWB 1W0CA 2FG6C 5ESXA 2G4LA 1E32A 2OG2A 1Z6XA 4YQFA 1NXOA 1ODSA 4TTRA 5A1TA 4L08A 4WHMA 3ZEAA 4LJ9A 5KTPA 4M88A 4ZQFA 1GCAA 3PX2A 2Q29A 1WXGA 5K3DA 1CNMA 4OU5A 4P80A 2PUGA 2Y1KA 2QTFA 4B0OA 2XA2A 3D6HA 1PJ8A 5AHOA 3TR6A 4R0MA 4H7HA 1NN5A 3FMPB 1IG0A 4EG5A 1O2DA 5L9AA 1ABFA 1XMXA 3LCUA 5DULA 3T5CA 3MN1A 3H2SA 1QLWA 4R3WA 3TJMA 3PC8A 4IVQA 2QW8A 3NALA 1KH1A 4P22A 1J00A 3R3HA 3KYJB 3HYTA 3IA7A 2DWPA 1PTJA 2HXYA 2HOQA 5FOSA 1HRDA 3UMJA 4HWKA 2Q3BA 3K15A 1Y48E 4YJ3F 4B31A 1XCJA 4DMRA 5JLJA 2O8CB 2O7VA 3PNLA 1PR3A 1Y4ZA 2VZLA 5G1PA 4JL6A 2DH5A 4K26A 1RHJA 1AXEA 1FFWA 3FMFA 3NUZA 4CM5A 3L7IA 4CMIB 4F2WA 3MAJA 3ZDDA 2PGDA 3NHJA 3BD7A 3KLPX 2X2OA 3H9BA 1KI4A 3DFMA 1JEYB 2Q2QA 1NNLA 4M0UA 3SD7A 1CB0A 2WVJA 4O2BF 4P2GA 4V0LA 4MW2A 2HNBA 2PL5A 2H1HA 2Y1FA 1N75A 4QQRA 4NAHA 3QXCA 1Y33E 1X9GA 2GN9A 1KO8A 1F1BA 3BXOA 1OZGA 3KXKA 3R5SA 3EXIB 3VC1A 4AKTA 1LS6A 5BUSA 1WXXA 1YD7A 4KLNA 4CIDA 1J22A 3H42B 4C3OB 3ADOA 3NU1A 1BKYA 1WVGA 2B34A 2PWYA 4C87A 2VEOA 4WN9A 3NETA 1ZJWA 1U98A 4TUYF 2FW0A 2G0TA 2ZR8A 3STYA 3IV7A 4DA4A 3IT3A 3QX9A 3ZN2A 2C1EA 1J8MF 1V4NA 3TDMA 3W34A 4R40A 4DXDA 1JQ3A 3OIYA 3DMYA 2ZOSA 4DW8A 2VTBB 3MS4A 5F5NA 3V42A 3GN2A 3OTGA 4AO8A 2I6GA 1ZI6A 4BIIA 1ZONA 3HP1A 3DEYX 1PUXA 1N2SA 3N07A 4M1OA 4WL0A 3TLCA 4X3OA 5DWQA 1ISRA 2OECA 4RY2A 1F8XA 1FA9A 4G41A 1ODFA 3FDXA 4M98A 3DMTC 4GPEA 1RZRA 5LZ2A 2VK4A 3WDMA 5CT9A 2BMFA 3KQVA 1FYEA 4X60A 1XU4A 1SZCA 3KT6A 5F3RA 3TIGA 4QEZA 3UOGA 5BSGA 5TX7A 3QFCA 3B2QA 3L8CA 4EY7A 4UUPA 5K6AC 2BE7A 1IIRA 3C6KA 2ZTLA 4Y6RA 3KPYA 5DLPA 3I04A 1N6HA 2IK8A 3UCEA 5CX4A 4LBYA 4J76A 4Z3KA 3L7MA 1NFFA 1UOPA 3VR6H 1AVTA 3K5WA 1T2EA 1DWUA 2JJYA 1SIWA 2XYVA 3PFKA 4IL5A 3BTUA 4DSOA 3OU2A 3GZJA 1WZIA 3SIXA 4HNTA 1C1XA 4F56A 1DPFA 2FLKA 2FMHA 4YJFB 3KJZA 2D3WA 4LG1A 3N8HA 4QYSA 5KVVA 2JBAA 4LISA 2JASA 2ACKA 2CLMB 4JYZA 4B7ZA 2NTYC 2ZSEA 1ZCBA 3FCSB 4NZ9A 4V3CA 3W6ZA 4JI7B 1EIWA 1YKGA 2FW1A 4TT8A 4U6QA 3EPJA 3BREA 3AR8A 4KRFA 4KPEC 1D04A 2GKOA 4MKRA 5KPJA 1Q0ZA 2NUPA 5FDFA 4ZI3A 3LDUA 5GPBA 1R5JA 1O9BA 3KUCA 1AHIA 2BR3A 5HIMA 3FTQA 3IOCA 4LKRA 1NUAA 2QXYA 2Y9PB 4IJVA 5FLXA 2IYUA 4YYZA 2RDMA 2ASVA 2QX4A 2W5UA 2Z4RA 1LFDB 4MP8A 2GBLC 3FR7A 1SKMA 1A50B 3WYFA 3ZDAA 2I7CA 5FL7A 1E1DA 2AOTA 3MOIA 3SN6A 3OJFA 4BVGA 2ZIEA 5J5AA 1WAMA 3E8XA 3EW7A 3FYUC 3JW8A 3ZWNA 4E5YA 1N57A 4IYJA 4Z86A 4FMDF 5HWSA 4OFXA 2IPOA 4MRMB 2VK1A 2WV9A 2IPNA 2AK2A 1X1AA 2HQ1A 5ADWA 2EVWX 1J2EA 4QD3A 2XZTA 1Z28A 1I33A 1G7TA 3DAPA 3HB5X 4M89A 4QAJA 3UOAB 2HV9A 3I9KA 3OFKA 1NF3A 4D79A 3PWZA 4JB3A 3FYSA 2HMYB 1MG0A 3R4VA 4OGFA 3IEXA 4OHFA 3KUDA 4EATA 2PZJA 3GYGA 1FP7A 4XR4A 2YJTD 3UWMA 4YPOA 4R2WA 3QG1A 1UXJA 3DYBA 3GO4A 5T67A 2JLQA 3ZU4A 5DBGA 4C9BA 1D5WA 3OMXA 3UT5A 1LB1B 5FP0A 4RHYA 5KOYA 1NM5A 1UJNA 1XK7A 4BMPB 3DE5X 4CF6A 2GASA 2GLUA 1S4MA 3WI7A 2XDAA 4M0PA 3R3ZA 1MB2A 3W8FA 3RVPA 1FMTA 3S2GA 4F3KA 1UOEA 2FVYA 2IYVA 3E81A 3EVEA 3GCDA 4IR7A 1ZVQA 5CNIA 3U39A 3KT8A 4WA8A 1AKEA 2AEEA 2QN3A 1JIJA 3FUVA 4WTOA 4JCOA 4GPIB 4M1TA 3IUMA 4Y6SA 1OBVA 1Y9ZA 2VAWA 4UBIA 2YWCA 5IBCA 3ZWVA 3KL4A 1FXUA 1R2QA 1KEKA 1VP3A 2H48A 4JLBA 3IBCA 4CMEA 1Z73A 3SP1A 1S3GA 1UBTS 4NK5A 2UZ1A 4R2LA 5KUTA 2Q9BA 4Z7JA 2NPFA 2WW8A 3X2FA 2O3JA 5IFLA 3FF1A 4HY3A 4EHIA 2AD5A 4L16A 4DWJA 1OZAA 3NBMA 1EDOA 1W46A 2HLDD 4R05A 2NTNA 3C5EA 3CX7A 2IS6A 1DTEA 4GWGA 2OV1A 1E9RA 3MJFA 3PJDA 3DXFA 2V3CC 3ORSA 4DREA 3FLAA 3FZYA 1P2GA 2R66A 2FUCA 1SOAA 4GKAA 4HNHA 4JWKA 4ZOEA 1KETA 1Z2DA 3ZWCA 1Z2NX 3OOWA 2VUTA 3LRPA 4KRYA 1D1TA 2UXDB 3VR5H 3PQDA 1DEOA 1Z12A 3V46A 4AFNA 1KFCB 1JR3A 2CFIA 5AHKA 4C05A 4ZI7B 1H4VB 3LT4A 4I2NA 4WCFC 3ZR4B 3DXYA 4A8JC 4ARAA 5AW3A 1U3UA 1NJ8A 1T5OA 3PNKA 5DGTA 2HRZA 4KPUA 4L9WA 2G6TA 3IPXA 3H9UA 1U7TA 3TZHA 3WIEA 5AKEA 3GLHB 2PZGA 4GSKA 4UEWA 4EY3A 1EBFA 2AFVA 2QW0X 1L5FA 3INGA 3OC6A 5B3KA 1E9EA 3LOUA 4RSHA 4ILKA 3W4KA 5BNZA 2PZKA 3P2KA 2EAUA 5EA2A 5JNSA 2QYTA 4FR0A 1WHSB 2QY6A 4DV6B 2X1VA 1Y3DE 5IEBA 2E7ZA 1CPYA 4KGXA 3HXQA 5CXSA 3UJHA 4IX1A 2VH1A 1OASA 1P5FA 2YC4C 4OHMA 1X0VA 1J09A 2PMBA 2WTNA 5A9SB 4LY3A 3B6JA 1EK2A 5HCUA 5HUJA 2ARKA 2NU8A 1J7JA 5D3KA 4TLCA 1U3WA 3L4BA 5ADHA 3ER8A 1H6BA 3F6CA 5CYFA 3DBRB 2PJZA 4ZVSA 4PZYA 3ZJTA 3RUAA 1JYEA 3H8WA 5A7FA 2ZAYA 4LOAA 2YHIB 5LZ5A 4EPRA 4DM4A 2XD9A 3I2YX 1BW9B 3TJRA 3IJEB 2HMWA 3TPFA 3B3JA 4NXMB 1SM4A 1XAGA 3NHSA 3WLSA 3I9NA 4N3CA 2EQ5A 4C07A 5LOVB 2FP3A 5C18A 4TL7A 3NHBA 1E4EA 3PTZA 2P2NA 3R09A 4UHJA 1AZWA 1PD0A 2CXRA 3A3YA 1H3FA 3FOCA 4LQCA 4P4GA 3QY0A 1VRWA 3BORA 5JALA 3COPA 3DO5A 3JQ7A 2I91A 3D81A 2F9FA 3L5OA 1CX9B 2I22A 1EVJA 1PJAA 1MH1A 3RVJA 1YS7A 4BX2A 2JA1A 3DKRA 4TQGA 2W8ZA 1DKPA 4X8HA 4I6EA 2F1KA 1A98A 3SQXA 1FLAA 1XCBA 2FJ0A 3LWZA 4LOIA 3UH1A 4ZZ3A 5EWLB 4BO8A 5IDXA 1GGMA 4D57A 1KVRA 1VG9B 4MGKR 3D6UA 2J46A 5D5QA 3WLTA 4E5UA 5EQFA 3RUIA 3BXPA 3T12A 3T9BA 4PYIA 3K1AA 2VTEA 1HNZB 1JAYA 3L6RA 5CITA 1CW2B 3UHJA 4CQJA 1K4YA 5DGXA 2JF0A 3TL3A 3MOGA 1TVMA 2D74A 3VU9B 1YOBA 4LZNA 2P9YA 4US1R 2JLWA 1CR2A 3D3KA 2CWWA 1QIJA 1TADA 1ULTA 5EEHA 4FHGA 3OQJA 3KJXA 5C80A 5TQ0B 2OV2A 1LV8A 5J4YA 1GPLA 3VOTA 2JD0A 2KW5A 1QK3A 1U6IA 4ZQEA 1KH2A 5E1MA 4MZDA 4FMPA 4MPRA 3W4JA 1DOAA 3TUIC 5KNCH 4KTTE 1TU3A 5EZYA 4OHXA 5EIOA 1ZGJA 4ZVVA 3VH1A 3NT5A 4FYHA 4HGYA 3EYWA 4QOSA 3O95A 5DEIA 3TCKA 3ZS8A 2BONA 4CCSA 4RV9A 4B48A 4WFIA 1ZICA 3AGPA