5IZEA

Hantaan virus l protein cap-snatching endonuclease
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
180
structure length
180
Chain Sequence
GMDKYREIHNKLKEFSPGTLTAVECIDYLDRLYAVRHDIVDQMIKHDWSDNKDSEEAIGKVLLFAGVPSNIITALEKKIIPNHPTGKSLKAFFKMTPDNYKISGTTIEFVEVTVTADVDKGIREKKLKYEAGLTYIEQELHKFFLKGEIPQPYKITFNVVAVRTDGSNITTQWPSRRNDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparative Structural and Functional Analysis of Bunyavirus and Arenavirus Cap-Snatching Endonucleases.
pubmed doi rcsb
molecule tags Transferase
source organism Hantaan virus
molecule keywords RNA-directed RNA polymerase L
total genus 59
structure length 180
sequence length 180
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2016-03-25
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...