5J4TA

Structure of tetrameric jacalin complexed with glcnac beta-(1,3) gal-beta-ome
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
133
structure length
133
Chain Sequence
GKAFDDGAFTGIREINLSYNKETAIGDFQVVYDLNGSPYVGQNHKSFITGFTPVKISLDFPSEYIMEVSGYTGNVSGYVVVRSLTFKTNKKTYGPYGVTSGTPFNLPIENGLIVGFKGSIGYWLDYFSMYLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distortion of the ligand molecule as a strategy for modulating binding affinity: Further studies involving complexes of jacalin with beta-substituted disaccharides.
pubmed doi rcsb
molecule keywords Agglutinin alpha chain
molecule tags Sugar binding protein
total genus 29
structure length 133
sequence length 133
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2016-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01419 Jacalin Jacalin-like lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.100.10.30 Mainly Beta Aligned Prism Vitelline Membrane Outer Layer Protein I, subunit A Jacalin-like lectin domain 5j4tA00
4R6NA 3R51A 3VY6A 4PITA 2GUCA 3AQGA 1X1VA 1PXDA 1UGWA 5J4TA 1TOQA 2NUOA 1J4TA 4PIKA 1JACA 4PIUA 3LL1A 2GUXA 3LL2A 2GUDA 1TP8A 3LKYA 1WS4A 4R6RA 1ZGSA 1C3KA 3VY7A 3LLYA 5JM1A 4MQ0A 1C3NA 1OUWA 2HYQA 2BN0A 4AKBA 3MIVA 5J4XA 1C3MA 3APAA 1VBOA 3WOBA 2JZ4A 3LL0A 4R6PA 1WS5C 1KU8A 3MITA 3P8SA 1UGYC 1UH1A 4AKDA 4DDNA 5EXGA 3WOCA 1XXRA 1JOTA 3VZFA 3O44A 4GX7A 1UH0A 2HYRA 2BMZA 1UGYA 1KUJA 5J50A 1J4SA 3LM1A 2BMYA 3R50A 1ZGRA 4R6OA 4AK4A 3MIUA 1VBPA 1XEZA 3R52A 3VZGA 5BN6E 3VZEA 1XXQA 1UGXA 4AKCA 1M26A 3LLZA 4R6QA 1WS5A 1WS4C 4WOGA 1J4UA 5AV7A 2GTYA 1UGWC 2NU5A 2GUEA 5J51A 4PIFA
chains in the Genus database with same CATH superfamily
4R6NA 3R51A 3VY6A 4PITA 2GUCA 1VMOA 3AQGA 4QX0A 1X1VA 1PXDA 1UGWA 5J4TA 2C9KA 1TOQA 2NUOA 1J4TA 4PIKA 1DLCA 1JACA 4PIUA 4QX1A 3EB7A 3LL1A 2GUXA 3LL2A 2GUDA 3TOWA 1TP8A 3LKYA 1WS4A 1CIYA 4R6RA 1ZGSA 1C3KA 3VY7A 3LLYA 5JM1A 4MQ0A 1C3NA 1OUWA 2HYQA 2BN0A 4AKBA 4D8MA 3MIVA 4ARYA 5J4XA 1C3MA 3APAA 1VBOA 3WOBA 2JZ4A 3LL0A 4R6PA 1WS5C 4QX2A 1KU8A 3MITA 3P8SA 4ARXA 1JI6A 1UGYC 1UH1A 4AKDA 4DDNA 5EXGA 3WOCA 4QX3A 1XXRA 1JOTA 3VZFA 3O44A 4GX7A 1UH0A 2HYRA 2BMZA 1UGYA 1KUJA 4W8JA 4MOAA 5J50A 1I5PA 1J4SA 3LM1A 2BMYA 3R50A 1ZGRA 4R6OA 4AK4A 3MIUA 1VBPA 1XEZA 3R52A 3VZGA 5BN6E 3VZEA 1XXQA 1UGXA 4AKCA 1M26A 3LLZA 4R6QA 1WS5A 1WS4C 4WOGA 1J4UA 5AV7A 2GTYA 1W99A 1UGWC 2QP2A 2NU5A 2GUEA 5J51A 4PIFA
chains in the Genus database with same CATH topology
4R6NA 3R51A 3VY6A 4PITA 2GUCA 3AQGA 1X1VA 1PXDA 1UGWA 5J4TA 1TOQA 2NUOA 1J4TA 4PIKA 1JACA 4PIUA 3LL1A 2GUXA 3LL2A 2GUDA 1TP8A 3LKYA 1WS4A 4R6RA 1ZGSA 1C3KA 3VY7A 3LLYA 5JM1A 4MQ0A 1C3NA 1OUWA 2HYQA 2BN0A 4AKBA 3MIVA 5J4XA 1C3MA 3APAA 1VBOA 3WOBA 2JZ4A 3LL0A 4R6PA 1WS5C 1KU8A 3MITA 3P8SA 1UGYC 1UH1A 4AKDA 4DDNA 5EXGA 3WOCA 1XXRA 1JOTA 3VZFA 3O44A 4GX7A 1UH0A 2HYRA 2BMZA 1UGYA 1KUJA 5J50A 1J4SA 3LM1A 2BMYA 3R50A 1ZGRA 4R6OA 4AK4A 3MIUA 1VBPA 1XEZA 3R52A 3VZGA 5BN6E 3VZEA 1XXQA 1UGXA 4AKCA 1M26A 3LLZA 4R6QA 1WS5A 1WS4C 4WOGA 1J4UA 5AV7A 2GTYA 1UGWC 2NU5A 2GUEA 5J51A 4PIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R6N A;  3R51 A;  3VY6 A;  4PIT A;  2GUC A;  3AQG A;  1X1V A;  1PXD A;  1UGW A;  5J4T A;  1TOQ A;  2NUO A;  1J4T A;  4PIK A;  1JAC A;  4PIU A;  3LL1 A;  2GUX A;  3LL2 A;  2GUD A;  1TP8 A;  3LKY A;  1WS4 A;  4R6R A;  1ZGS A;  1C3K A;  3VY7 A;  3LLY A;  5JM1 A;  4MQ0 A;  1C3N A;  1OUW A;  2HYQ A;  2BN0 A;  4AKB A;  3MIV A;  5J4X A;  1C3M A;  3APA A;  1VBO A;  3WOB A;  2JZ4 A;  3LL0 A;  4R6P A;  1WS5 C;  1KU8 A;  3MIT A;  3P8S A;  1UGY C;  1UH1 A;  4AKD A;  4DDN A;  5EXG A;  3WOC A;  1XXR A;  1JOT A;  3VZF A;  3O44 A;  4GX7 A;  1UH0 A;  2HYR A;  2BMZ A;  1UGY A;  1KUJ A;  5J50 A;  1J4S A;  3LM1 A;  2BMY A;  3R50 A;  1ZGR A;  4R6O A;  4AK4 A;  3MIU A;  1VBP A;  1XEZ A;  3R52 A;  3VZG A;  5BN6 E;  3VZE A;  1XXQ A;  1UGX A;  4AKC A;  1M26 A;  3LLZ A;  4R6Q A;  1WS5 A;  1WS4 C;  4WOG A;  1J4U A;  5AV7 A;  2GTY A;  1UGW C;  2NU5 A;  2GUE A;  5J51 A;  4PIF A; 
#chains in the Genus database with same CATH topology
 4R6N A;  3R51 A;  3VY6 A;  4PIT A;  2GUC A;  1VMO A;  3AQG A;  4QX0 A;  1X1V A;  1PXD A;  1UGW A;  5J4T A;  2C9K A;  1TOQ A;  2NUO A;  1J4T A;  4PIK A;  1DLC A;  1JAC A;  4PIU A;  4QX1 A;  3EB7 A;  3LL1 A;  2GUX A;  3LL2 A;  2GUD A;  3TOW A;  1TP8 A;  3LKY A;  1WS4 A;  1CIY A;  4R6R A;  1ZGS A;  1C3K A;  3VY7 A;  3LLY A;  5JM1 A;  4MQ0 A;  1C3N A;  1OUW A;  2HYQ A;  2BN0 A;  4AKB A;  4D8M A;  3MIV A;  4ARY A;  5J4X A;  1C3M A;  3APA A;  1VBO A;  3WOB A;  2JZ4 A;  3LL0 A;  4R6P A;  1WS5 C;  4QX2 A;  1KU8 A;  3MIT A;  3P8S A;  4ARX A;  1JI6 A;  1UGY C;  1UH1 A;  4AKD A;  4DDN A;  5EXG A;  3WOC A;  4QX3 A;  1XXR A;  1JOT A;  3VZF A;  3O44 A;  4GX7 A;  1UH0 A;  2HYR A;  2BMZ A;  1UGY A;  1KUJ A;  4W8J A;  4MOA A;  5J50 A;  1I5P A;  1J4S A;  3LM1 A;  2BMY A;  3R50 A;  1ZGR A;  4R6O A;  4AK4 A;  3MIU A;  1VBP A;  1XEZ A;  3R52 A;  3VZG A;  5BN6 E;  3VZE A;  1XXQ A;  1UGX A;  4AKC A;  1M26 A;  3LLZ A;  4R6Q A;  1WS5 A;  1WS4 C;  4WOG A;  1J4U A;  5AV7 A;  2GTY A;  1W99 A;  1UGW C;  2QP2 A;  2NU5 A;  2GUE A;  5J51 A;  4PIF A; 
#chains in the Genus database with same CATH homology
 4R6N A;  3R51 A;  3VY6 A;  4PIT A;  2GUC A;  3AQG A;  1X1V A;  1PXD A;  1UGW A;  5J4T A;  1TOQ A;  2NUO A;  1J4T A;  4PIK A;  1JAC A;  4PIU A;  3LL1 A;  2GUX A;  3LL2 A;  2GUD A;  1TP8 A;  3LKY A;  1WS4 A;  4R6R A;  1ZGS A;  1C3K A;  3VY7 A;  3LLY A;  5JM1 A;  4MQ0 A;  1C3N A;  1OUW A;  2HYQ A;  2BN0 A;  4AKB A;  3MIV A;  5J4X A;  1C3M A;  3APA A;  1VBO A;  3WOB A;  2JZ4 A;  3LL0 A;  4R6P A;  1WS5 C;  1KU8 A;  3MIT A;  3P8S A;  1UGY C;  1UH1 A;  4AKD A;  4DDN A;  5EXG A;  3WOC A;  1XXR A;  1JOT A;  3VZF A;  3O44 A;  4GX7 A;  1UH0 A;  2HYR A;  2BMZ A;  1UGY A;  1KUJ A;  5J50 A;  1J4S A;  3LM1 A;  2BMY A;  3R50 A;  1ZGR A;  4R6O A;  4AK4 A;  3MIU A;  1VBP A;  1XEZ A;  3R52 A;  3VZG A;  5BN6 E;  3VZE A;  1XXQ A;  1UGX A;  4AKC A;  1M26 A;  3LLZ A;  4R6Q A;  1WS5 A;  1WS4 C;  4WOG A;  1J4U A;  5AV7 A;  2GTY A;  1UGW C;  2NU5 A;  2GUE A;  5J51 A;  4PIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...