5J51A

Structure of tetrameric jacalin complexed with gal alpha-(1,4) gal
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
133
structure length
133
Chain Sequence
GKAFDDGAFTGIREINLSYNKETAIGDFQVVYDLNGSPYVGQNHKSFITGFTPVKISLDFPSEYIMEVSGYTGNVSGYVVVRSLTFKTNKKTYGPYGVTSGTPFNLPIENGLIVGFKGSIGYWLDYFSMYLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Effect of linkage on the location of reducing and nonreducing sugars bound to jacalin.
pubmed doi rcsb
molecule keywords Agglutinin alpha chain
molecule tags Sugar binding protein
total genus 31
structure length 133
sequence length 133
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2016-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01419 Jacalin Jacalin-like lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.100.10.30 Mainly Beta Aligned Prism Vitelline Membrane Outer Layer Protein I, subunit A Jacalin-like lectin domain 5j51A00
3LKYA 4R6QA 4PITA 5JM1A 4PIFA 1UGYA 5J50A 1ZGSA 1XXQA 4R6RA 3R50A 3MIVA 2GTYA 2GUCA 3R52A 1UH1A 3VY6A 1J4SA 2GUEA 3LLYA 4R6NA 3LL2A 1VBOA 4DDNA 2NU5A 4AKDA 2BMYA 1OUWA 1KUJA 3LL1A 1J4TA 1TOQA 4R6PA 1PXDA 3MIUA 1WS5C 2HYQA 1VBPA 3VZGA 1WS5A 3P8SA 3WOBA 2HYRA 1J4UA 3LM1A 4GX7A 2NUOA 4R6OA 1C3MA 3AQGA 3VZFA 1C3KA 1UGXA 3MITA 2GUDA 5J4TA 2GUXA 1C3NA 3VZEA 4AKCA 3LLZA 1ZGRA 4PIUA 4PIKA 2JZ4A 1XXRA 3R51A 3O44A 3APAA 1UGWC 1XEZA 2BMZA 1KU8A 5J51A 1UGWA 5J4XA 1JACA 2BN0A 1JOTA 1M26A 3WOCA 3LL0A 5BN6E 5AV7A 1X1VA 3VY7A 1WS4C 5EXGA 4MQ0A 1UH0A 4AKBA 4AK4A 4WOGA 1WS4A 1TP8A 1UGYC
chains in the Genus database with same CATH superfamily
3LKYA 4QX1A 4R6QA 4PITA 5JM1A 4PIFA 1UGYA 5J50A 1ZGSA 1XXQA 4R6RA 3R50A 3MIVA 2GTYA 2GUCA 3R52A 4QX2A 1UH1A 3VY6A 1J4SA 1VMOA 4D8MA 2GUEA 3LLYA 4R6NA 3LL2A 1VBOA 4DDNA 2NU5A 4AKDA 2BMYA 2C9KA 1OUWA 1KUJA 3LL1A 4QX3A 1J4TA 1TOQA 4R6PA 1PXDA 3MIUA 4W8JA 1WS5C 1DLCA 2HYQA 1VBPA 3VZGA 1WS5A 3P8SA 3WOBA 2HYRA 1J4UA 1CIYA 3LM1A 4QX0A 2QP2A 4GX7A 2NUOA 4R6OA 1C3MA 3AQGA 3VZFA 1C3KA 1UGXA 3MITA 2GUDA 5J4TA 2GUXA 1C3NA 3VZEA 4AKCA 3LLZA 1ZGRA 4PIUA 3TOWA 4ARYA 4PIKA 3EB7A 2JZ4A 1XXRA 3R51A 3O44A 4MOAA 3APAA 1UGWC 1XEZA 2BMZA 1I5PA 1W99A 4ARXA 1KU8A 5J51A 1UGWA 5J4XA 1JACA 1JI6A 2BN0A 1JOTA 1M26A 3WOCA 3LL0A 5BN6E 5AV7A 1X1VA 3VY7A 1WS4C 5EXGA 4MQ0A 1UH0A 4AKBA 4AK4A 4WOGA 1WS4A 1TP8A 1UGYC
chains in the Genus database with same CATH topology
3LKYA 4R6QA 4PITA 5JM1A 4PIFA 1UGYA 5J50A 1ZGSA 1XXQA 4R6RA 3R50A 3MIVA 2GTYA 2GUCA 3R52A 1UH1A 3VY6A 1J4SA 2GUEA 3LLYA 4R6NA 3LL2A 1VBOA 4DDNA 2NU5A 4AKDA 2BMYA 1OUWA 1KUJA 3LL1A 1J4TA 1TOQA 4R6PA 1PXDA 3MIUA 1WS5C 2HYQA 1VBPA 3VZGA 1WS5A 3P8SA 3WOBA 2HYRA 1J4UA 3LM1A 4GX7A 2NUOA 4R6OA 1C3MA 3AQGA 3VZFA 1C3KA 1UGXA 3MITA 2GUDA 5J4TA 2GUXA 1C3NA 3VZEA 4AKCA 3LLZA 1ZGRA 4PIUA 4PIKA 2JZ4A 1XXRA 3R51A 3O44A 3APAA 1UGWC 1XEZA 2BMZA 1KU8A 5J51A 1UGWA 5J4XA 1JACA 2BN0A 1JOTA 1M26A 3WOCA 3LL0A 5BN6E 5AV7A 1X1VA 3VY7A 1WS4C 5EXGA 4MQ0A 1UH0A 4AKBA 4AK4A 4WOGA 1WS4A 1TP8A 1UGYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LKY A;  4R6Q A;  4PIT A;  5JM1 A;  4PIF A;  1UGY A;  5J50 A;  1ZGS A;  1XXQ A;  4R6R A;  3R50 A;  3MIV A;  2GTY A;  2GUC A;  3R52 A;  1UH1 A;  3VY6 A;  1J4S A;  2GUE A;  3LLY A;  4R6N A;  3LL2 A;  1VBO A;  4DDN A;  2NU5 A;  4AKD A;  2BMY A;  1OUW A;  1KUJ A;  3LL1 A;  1J4T A;  1TOQ A;  4R6P A;  1PXD A;  3MIU A;  1WS5 C;  2HYQ A;  1VBP A;  3VZG A;  1WS5 A;  3P8S A;  3WOB A;  2HYR A;  1J4U A;  3LM1 A;  4GX7 A;  2NUO A;  4R6O A;  1C3M A;  3AQG A;  3VZF A;  1C3K A;  1UGX A;  3MIT A;  2GUD A;  5J4T A;  2GUX A;  1C3N A;  3VZE A;  4AKC A;  3LLZ A;  1ZGR A;  4PIU A;  4PIK A;  2JZ4 A;  1XXR A;  3R51 A;  3O44 A;  3APA A;  1UGW C;  1XEZ A;  2BMZ A;  1KU8 A;  5J51 A;  1UGW A;  5J4X A;  1JAC A;  2BN0 A;  1JOT A;  1M26 A;  3WOC A;  3LL0 A;  5BN6 E;  5AV7 A;  1X1V A;  3VY7 A;  1WS4 C;  5EXG A;  4MQ0 A;  1UH0 A;  4AKB A;  4AK4 A;  4WOG A;  1WS4 A;  1TP8 A;  1UGY C; 
#chains in the Genus database with same CATH topology
 3LKY A;  4QX1 A;  4R6Q A;  4PIT A;  5JM1 A;  4PIF A;  1UGY A;  5J50 A;  1ZGS A;  1XXQ A;  4R6R A;  3R50 A;  3MIV A;  2GTY A;  2GUC A;  3R52 A;  4QX2 A;  1UH1 A;  3VY6 A;  1J4S A;  1VMO A;  4D8M A;  2GUE A;  3LLY A;  4R6N A;  3LL2 A;  1VBO A;  4DDN A;  2NU5 A;  4AKD A;  2BMY A;  2C9K A;  1OUW A;  1KUJ A;  3LL1 A;  4QX3 A;  1J4T A;  1TOQ A;  4R6P A;  1PXD A;  3MIU A;  4W8J A;  1WS5 C;  1DLC A;  2HYQ A;  1VBP A;  3VZG A;  1WS5 A;  3P8S A;  3WOB A;  2HYR A;  1J4U A;  1CIY A;  3LM1 A;  4QX0 A;  2QP2 A;  4GX7 A;  2NUO A;  4R6O A;  1C3M A;  3AQG A;  3VZF A;  1C3K A;  1UGX A;  3MIT A;  2GUD A;  5J4T A;  2GUX A;  1C3N A;  3VZE A;  4AKC A;  3LLZ A;  1ZGR A;  4PIU A;  3TOW A;  4ARY A;  4PIK A;  3EB7 A;  2JZ4 A;  1XXR A;  3R51 A;  3O44 A;  4MOA A;  3APA A;  1UGW C;  1XEZ A;  2BMZ A;  1I5P A;  1W99 A;  4ARX A;  1KU8 A;  5J51 A;  1UGW A;  5J4X A;  1JAC A;  1JI6 A;  2BN0 A;  1JOT A;  1M26 A;  3WOC A;  3LL0 A;  5BN6 E;  5AV7 A;  1X1V A;  3VY7 A;  1WS4 C;  5EXG A;  4MQ0 A;  1UH0 A;  4AKB A;  4AK4 A;  4WOG A;  1WS4 A;  1TP8 A;  1UGY C; 
#chains in the Genus database with same CATH homology
 3LKY A;  4R6Q A;  4PIT A;  5JM1 A;  4PIF A;  1UGY A;  5J50 A;  1ZGS A;  1XXQ A;  4R6R A;  3R50 A;  3MIV A;  2GTY A;  2GUC A;  3R52 A;  1UH1 A;  3VY6 A;  1J4S A;  2GUE A;  3LLY A;  4R6N A;  3LL2 A;  1VBO A;  4DDN A;  2NU5 A;  4AKD A;  2BMY A;  1OUW A;  1KUJ A;  3LL1 A;  1J4T A;  1TOQ A;  4R6P A;  1PXD A;  3MIU A;  1WS5 C;  2HYQ A;  1VBP A;  3VZG A;  1WS5 A;  3P8S A;  3WOB A;  2HYR A;  1J4U A;  3LM1 A;  4GX7 A;  2NUO A;  4R6O A;  1C3M A;  3AQG A;  3VZF A;  1C3K A;  1UGX A;  3MIT A;  2GUD A;  5J4T A;  2GUX A;  1C3N A;  3VZE A;  4AKC A;  3LLZ A;  1ZGR A;  4PIU A;  4PIK A;  2JZ4 A;  1XXR A;  3R51 A;  3O44 A;  3APA A;  1UGW C;  1XEZ A;  2BMZ A;  1KU8 A;  5J51 A;  1UGW A;  5J4X A;  1JAC A;  2BN0 A;  1JOT A;  1M26 A;  3WOC A;  3LL0 A;  5BN6 E;  5AV7 A;  1X1V A;  3VY7 A;  1WS4 C;  5EXG A;  4MQ0 A;  1UH0 A;  4AKB A;  4AK4 A;  4WOG A;  1WS4 A;  1TP8 A;  1UGY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...