5JEQA

Fragment of nitrate/nitrite sensor histidine kinase narq (r50k) in symmetric apo state
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
230
structure length
227
Chain Sequence
MIVKRPVSASLARAFFYIVLLSILSTGIALLTLASSLRDAEAINIAGSLKMQSYRLGYDLQSGSPQLNAHRQLFQQALHSPVLTNLNVWYVPEAVKTRYAHLNANWLEMNNRLSKGDLPWYQANINNYVNQIDLFVLALQHYAERKMLLVVAISLAGGIGIFTLVFFTLRRIRHQVVAPLNQLVTASQRIEHQFPPLDTNLPNELGLLAKTFNQMSSELHKLYRSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of transmembrane signaling by sensor histidine kinases.
pubmed doi rcsb
molecule keywords Nitrate/nitrite sensor protein NarQ
molecule tags Transferase
source organism Escherichia coli
total genus 100
structure length 227
sequence length 230
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2016-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00672 HAMP HAMP domain
A PF13675 PilJ Type IV pili methyl-accepting chemotaxis transducer N-term
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...