5JG6A

Apc11-ubv shows role of noncovalent ring-ubiquitin interactions in processive multiubiquitination and ubiquitin chain elongation by apc/c
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
61
Chain Sequence
DENCGICRMAFNGCCPDCDDCPLVWGQCSHCFHMHCILKWLHAQQVQQHCPMCRQEWKFKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dual RING E3 Architectures Regulate Multiubiquitination and Ubiquitin Chain Elongation by APC/C.
pubmed doi rcsb
molecule keywords Anaphase-promoting complex subunit 11
molecule tags Cell cycle
source organism Homo sapiens
total genus 14
structure length 61
sequence length 65
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-04-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5jg6A00
2L75A 5B78A 4TKPB 2YSJA 4F52B 4L7XA 1U6GB 5LKUA 1JM7B 2EGPA 3HCSA 4W4UA 2VJFA 2LN0A 2CKLA 2FUUA 3ZVZB 5KH7A 1RMDA 2G43A 4S3OC 1MM3A 2L5UA 4V3KC 5LKTA 2OXQC 3ZPVE 2YYRA 4A4CA 2Y1MA 1JM7A 5FB0A 3O7AA 2LRIC 5I3LA 2BAYA 2MD8C 2KU3A 2MUMA 4UP0A 4WZ0A 5H9MA 2G45A 2JMJA 3SOUA 2CSZA 3O37A 2K17A 2KREA 2VPGA 3MHHA 2EA6A 4IC3A 3V43A 4FJCA 2E6RA 4N4FA 2YQMA 2KR4A 4ZDTA 5G05B 4GNFA 4YAXA 3HCTA 3KQIA 1E4UA 2LGVA 2LGKA 1IYMA 2L80A 4YABA 2G6QA 2KYUA 4FK5A 2C2LA 2ECTA 2LGGA 5B77A 3U5NA 2LV9A 5LKZA 5TBNA 3HCUA 3LRQA 3MHSA 2YQLA 3LQIA 4FIPA 2L43A 3RPGC 2LQ6A 4I7BA 1XWHA 4LJNA 2ECWA 2LXPC 1WEEA 5J3XA 2CT2A 5DKAA 2Y1NA 2Y43A 4UI9B 2ECVA 3PHDA 3O70A 1BORA 3LQHA 5FERA 2ECJA 2KIZA 4YBTA 5KH3A 3QZVA 2AN6A 2KFTA 2XB1A 3N9LA 5TDWA 5D1KB 2ZETC 1WGMA 1Z6UA 2K1JA 4N3WA 4PPEA 2MT5A 4GNEA 5B79A 5H1UA 3O34A 4YBMA 2MA6A 1WEUA 1LDJB 2VPEA 4AVXA 5B76A 1WESA 2LXHC 2LDRA 2ECGA 3LQJA 2KWJA 2KWOA 4AP4A 4I7CA 1DVPA 2VNFA 3RTRB 1K2FA 3ZYQA 2CSYA 5JG6A 1ZBDB 2YUCA 1WEQA 2HDPA 5LKXA 2ECNA 3FL2A 2YURA 3SHBA 5G04B 2XEUA 2M85A 2KGIA 3GL6A 3ZTGA 1WEMA 4WZ3B 3O35A 3L1ZB 4A4BA 3EB6A 5TDRA 3O33A 4WA6A 2ECIA 4QF2A 4X3GA 2JMIA 1VFYA 3DPLR 4MVTA 4B7YC 2UZGA 2PNXA 2IDAA 1WENA 4IC2A 3C5KA 3KNVA 1Z2QA 4A49A 1G25A 3PUQA 1VD4A 3T6RA 4YC9A 1WILA 5FEYA 2I50A 4R2YA 4YADA 5B75A 2F6NA 2M3HA 4AUQB 2YHOA 3O36A 4QF3A 1N87A 4R7EA 2MNZA 3U5PA 1WEPA 4LK9A 3N9OA 3ZVYA 3GV4A 3I2DA 2QICA 1LDKC 4MSXA 5DINA 2F42A 4CA1A 1Z60A 3IHPA 1HYIA 4FO9A 2KE1A 3N9MA 1HYJA 4BBQA 2YREA 5AITA 2MIQA 4O64A 4WZ2A 1WEVA 2VJEB 1X4JA 3DQVR 5FB1A 4GNGA 2H0DB 1FP0A 2VPBA 2C2VS 2MA5A 3M99A 2QJ0A 4UP5A 2YW8A 5KH9A 2D8SA 3KV5A 2VP7A 3N9PA 2HYED 3ASLA 4LKAA 4GB0A 3M63A 1FBVA 4AYCA 3VK6A 4R8PK 5EYAF 4NN2A 2VJEA 4LLBA 4V3LC 1V87A 2FSAA 2NAAA 2H0DA 3NG2A 4LADB 4S3OB 5C11A 2YT5A 2M6MA 2F6JA 1VYXA 3SOWA 3N9NA 5AIUA 4YBSA 3M62A 2E6SA 5D1MB 4ZQLA 5LCWB 1CHCA 1X4UA 2YSMA 2RSDA 1WEOA 5H1TA 1WFKA 5TRBA 4L58A 3C6WA 3T7LA 4XI1A 2L0BA 1F62A 2VPDA 4B86C 1X4IA 3EB5A 4PTBA 5D1LB 2YU4A 2QIZA 3L11A 3U5MA 2YHNA 2FUIA 1WIMA 2LGLA 2MNYA 4CCGX 4BHWA 2K16A 5B8DA 1MM2A 4GNDA 2K4DA 3PURA 4Q6FA 2PUYA 4I7DA 1T1HA 2KWKA 2JRJA 2KWNA 5G0FA 2RI7A 3ZNIA 3HTKC 2EODA 2JMDA 3U5OA 3ZPV1 5C13A 4C9ZA 3RPGB 1WEWA 4A0CD 5TABA 2KGGA 3N9QA 4ZUXU 1JOCA 2MD7B 2M1RA 5H1VA 3SOXA 2DX8A 3L1XA 3KV6A 2VJFB 2CKLB 4AYCB 4P5OB 4YATA 1WE9A
chains in the Genus database with same CATH superfamily
2L75A 3DDTA 5B78A 4TKPB 2OWAA 4O62A 2YSJA 4Z0OA 4F52B 2B0OE 4L7XA 1U6GB 5LKUA 3LDYA 2CSVA 1DCQA 1JM7B 2EGPA 3HCSA 4W4UA 2VJFA 2LN0A 2CKLA 2FUUA 3ZVZB 2CRRA 5KH7A 2LAUA 4QQ4A 1RMDA 2G43A 4S3OC 1MM3A 2L5UA 4V3KC 2E61A 5LKTA 2OXQC 3ZPVE 3MDBC 4Z0RA 2YYRA 4A4CA 2Y1MA 1JM7A 5FB0A 3O7AA 2LRIC 5I3LA 2BAYA 2FFWA 2MD8C 2KU3A 2MUMA 4UP0A 4WZ0A 3JUEA 5H9MA 2G45A 3O47A 2JMJA 3SOUA 2CSZA 3O37A 2K17A 2KREA 2VPGA 3MHHA 2EA6A 5SVIB 4IC3A 5SVYA 3V43A 3LVRE 4FJCA 2E6RA 4N4FA 2YQMA 2KR4A 4ZDTA 5G05B 4GNFA 4YAXA 3HCTA 3KQIA 1E4UA 2LGVA 2LGKA 1IYMA 2DJAA 5SVIA 2L80A 4YABA 2G6QA 2KYUA 4FK5A 2C2LA 2ECTA 2LGGA 5B77A 3U5NA 2LV9A 5LKZA 5TBNA 3HCUA 4F1PA 3LRQA 3MHSA 2YQLA 3LQIA 4FIPA 2L43A 3RPGC 2LQ6A 4I7BA 1XWHA 4LJNA 2ECWA 2LXPC 1WEEA 4OGEA 5J3XA 2CT2A 5DKAA 2L7PA 2Y1NA 2Y43A 4UI9B 2ECVA 3PHDA 5SVXA 3O70A 1BORA 3LQHA 5FERA 2ECJA 2KIZA 2M13A 2EXUA 4YBTA 5KH3A 3FM8C 3QZVA 2AN6A 2KFTA 2XB1A 3N9LA 3LJUX 5TDWA 5D1KB 2ZETC 1WGMA 1Z6UA 2K1JA 5K3QA 4N3WA 4PPEA 2MT5A 4GNEA 5B79A 5H1UA 2EGMA 3O34A 4YBMA 2MA6A 1WEUA 4H9DA 3PLWA 1LDJB 2VPEA 4AVXA 5B76A 1WESA 2LXHC 2LDRA 2ECGA 3LQJA 2KWJA 2KWOA 4AP4A 4I7CA 1DVPA 2VNFA 3RTRB 1K2FA 3ZYQA 2CSYA 5JG6A 1ZBDB 2YUCA 1WEQA 2HDPA 5LKXA 2ECNA 3FL2A 2YURA 3SHBA 5G04B 2XEUA 2M85A 2KGIA 3GL6A 3ZTGA 1WEMA 4WZ3B 3O35A 3L1ZB 2RR4A 4A4BA 3EB6A 5TDRA 3O33A 2D8UA 4WA6A 2ECIA 4QF2A 4X3GA 2JMIA 1VFYA 3DPLR 4MVTA 4B7YC 2UZGA 2PNXA 2IDAA 1WENA 4IC2A 3H7HA 3C5KA 3KNVA 1Z2QA 4A49A 1G25A 3PUQA 1VD4A 2YVRA 3T6RA 2IQJA 4YC9A 1WILA 2XP0A 5FEYA 3M7KA 2I50A 4R2YA 4YADA 5B75A 2F6NA 2M3HA 4AUQB 2YHOA 3O36A 4OGCA 4QF3A 1N87A 4R7EA 2MNZA 2DSMA 3U5PA 1WEPA 4LK9A 3N9OA 3ZVYA 3GV4A 2JM3A 3I2DA 2QICA 1LDKC 4MSXA 5DINA 2F42A 4CA1A 2CRWA 1Z60A 3IHPA 1HYIA 4FO9A 2KE1A 3N9MA 1HYJA 2FD4A 4BBQA 2YREA 5AITA 2MIQA 4O64A 4WZ2A 1WEVA 3Q1DA 2VJEB 1X4JA 3DQVR 3FANA 5FB1A 1MBMA 4GNGA 2H0DB 1FP0A 2VPBA 2C2VS 2MA5A 3M99A 2QJ0A 4UP5A 2YW8A 5KH9A 3E2DA 2D8SA 2XOCA 3KV5A 2VP7A 2P57A 3N9PA 2HYED 3ASLA 4LKAA 4GB0A 3KDEC 3M63A 1FBVA 2MKEA 3VK6A 4AYCA 5EYAF 4R8PK 4NN2A 2VJEA 4LLBA 4V3LC 2XOYA 1V87A 2FSAA 2NAAA 2H0DA 3NG2A 3DWDA 4LADB 4S3OB 5C11A 3FJUB 2YT5A 2M6MA 2F6JA 1VYXA 3SOWA 3N9NA 3T9KA 2KKYA 5AIUA 4YBSA 3M62A 2E6SA 5D1MB 4ZQLA 5LCWB 1CHCA 1X4UA 2YSMA 2RSDA 1WEOA 5H1TA 3FAOA 1WFKA 5TRBA 4L58A 3C6WA 3T7LA 4XI1A 2L0BA 1F62A 2VPDA 4B86C 1X4IA 3EB5A 4PTBA 5D1LB 2YU4A 2QIZA 2KKXA 3L11A 3U5MA 2YHNA 2FUIA 1WIMA 2LGLA 2MNYA 4CCGX 4BHWA 2K16A 5B8DA 1MM2A 3FEHA 4GNDA 2K4DA 3PURA 4Q6FA 2PUYA 4I7DA 1T1HA 2KWKA 2JRJA 2KWNA 5G0FA 2RI7A 3ZNIA 3LVQE 3HTKC 2EODA 2JMDA 2JUNA 3U5OA 3ZPV1 5C13A 2CONA 4C9ZA 3RPGB 1WEWA 4A0CD 5TABA 2KGGA 3N9QA 4ZUXU 1JOCA 3SUBA 2MD7B 2XOZA 2M1RA 5H1VA 3SOXA 2DX8A 3L1XA 3KV6A 2VJFB 2CKLB 4AYCB 4P5OB 4YATA 1WE9A
chains in the Genus database with same CATH topology
2L75A 5B78A 4TKPB 2YSJA 4F52B 4L7XA 1U6GB 5LKUA 1JM7B 2EGPA 3HCSA 4W4UA 2VJFA 2LN0A 2CKLA 2FUUA 3ZVZB 5KH7A 1RMDA 2G43A 4S3OC 1MM3A 2L5UA 4V3KC 5LKTA 2OXQC 3ZPVE 2YYRA 4A4CA 2Y1MA 1JM7A 5FB0A 3O7AA 2LRIC 5I3LA 2BAYA 2MD8C 2KU3A 2MUMA 4UP0A 4WZ0A 5H9MA 2G45A 2JMJA 3SOUA 2CSZA 3O37A 2K17A 2KREA 2VPGA 3MHHA 2EA6A 4IC3A 3V43A 4FJCA 2E6RA 4N4FA 2YQMA 2KR4A 4ZDTA 5G05B 4GNFA 4YAXA 3HCTA 3KQIA 1E4UA 2LGVA 2LGKA 1IYMA 2L80A 4YABA 2G6QA 2KYUA 4FK5A 2C2LA 2ECTA 2LGGA 5B77A 3U5NA 2LV9A 5LKZA 5TBNA 3HCUA 3LRQA 3MHSA 2YQLA 3LQIA 4FIPA 2L43A 3RPGC 2LQ6A 4I7BA 1XWHA 4LJNA 2ECWA 2LXPC 1WEEA 5J3XA 2CT2A 5DKAA 2Y1NA 2Y43A 4UI9B 2ECVA 3PHDA 3O70A 1BORA 3LQHA 5FERA 2ECJA 2KIZA 4YBTA 5KH3A 3QZVA 2AN6A 2KFTA 2XB1A 3N9LA 5TDWA 5D1KB 2ZETC 1WGMA 1Z6UA 2K1JA 4N3WA 4PPEA 2MT5A 4GNEA 5B79A 5H1UA 3O34A 4YBMA 2MA6A 1WEUA 1LDJB 2VPEA 4AVXA 5B76A 1WESA 2LXHC 2LDRA 2ECGA 3LQJA 2KWJA 2KWOA 4AP4A 4I7CA 1DVPA 2VNFA 3RTRB 1K2FA 3ZYQA 2CSYA 5JG6A 1ZBDB 2YUCA 1WEQA 2HDPA 5LKXA 2ECNA 3FL2A 2YURA 3SHBA 5G04B 2XEUA 2M85A 2KGIA 3GL6A 3ZTGA 1WEMA 4WZ3B 3O35A 3L1ZB 4A4BA 3EB6A 5TDRA 3O33A 4WA6A 2ECIA 4QF2A 4X3GA 2JMIA 1VFYA 3DPLR 4MVTA 4B7YC 2UZGA 2PNXA 2IDAA 1WENA 4IC2A 3C5KA 3KNVA 1Z2QA 4A49A 1G25A 3PUQA 1VD4A 3T6RA 4YC9A 1WILA 5FEYA 2I50A 4R2YA 4YADA 5B75A 2F6NA 2M3HA 4AUQB 2YHOA 3O36A 4QF3A 1N87A 4R7EA 2MNZA 3U5PA 1WEPA 4LK9A 3N9OA 3ZVYA 3GV4A 3I2DA 2QICA 1LDKC 4MSXA 5DINA 2F42A 4CA1A 1Z60A 3IHPA 1HYIA 4FO9A 2KE1A 3N9MA 1HYJA 4BBQA 2YREA 5AITA 2MIQA 4O64A 4WZ2A 1WEVA 2VJEB 1X4JA 3DQVR 5FB1A 4GNGA 2H0DB 1FP0A 2VPBA 2C2VS 2MA5A 3M99A 2QJ0A 4UP5A 2YW8A 5KH9A 2D8SA 3KV5A 2VP7A 3N9PA 2HYED 3ASLA 4LKAA 4GB0A 3M63A 1FBVA 4AYCA 3VK6A 4R8PK 5EYAF 4NN2A 2VJEA 4LLBA 4V3LC 1V87A 2FSAA 2NAAA 2H0DA 3NG2A 4LADB 4S3OB 5C11A 2YT5A 2M6MA 2F6JA 1VYXA 3SOWA 3N9NA 5AIUA 4YBSA 3M62A 2E6SA 5D1MB 4ZQLA 5LCWB 1CHCA 1X4UA 2YSMA 2RSDA 1WEOA 5H1TA 1WFKA 5TRBA 4L58A 3C6WA 3T7LA 4XI1A 2L0BA 1F62A 2VPDA 4B86C 1X4IA 3EB5A 4PTBA 5D1LB 2YU4A 2QIZA 3L11A 3U5MA 2YHNA 2FUIA 1WIMA 2LGLA 2MNYA 4CCGX 4BHWA 2K16A 5B8DA 1MM2A 4GNDA 2K4DA 3PURA 4Q6FA 2PUYA 4I7DA 1T1HA 2KWKA 2JRJA 2KWNA 5G0FA 2RI7A 3ZNIA 3HTKC 2EODA 2JMDA 3U5OA 3ZPV1 5C13A 4C9ZA 3RPGB 1WEWA 4A0CD 5TABA 2KGGA 3N9QA 4ZUXU 1JOCA 2MD7B 2M1RA 5H1VA 3SOXA 2DX8A 3L1XA 3KV6A 2VJFB 2CKLB 4AYCB 4P5OB 4YATA 1WE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L75 A;  5B78 A;  4TKP B;  2YSJ A;  4F52 B;  4L7X A;  1U6G B;  5LKU A;  1JM7 B;  2EGP A;  3HCS A;  4W4U A;  2VJF A;  2LN0 A;  2CKL A;  2FUU A;  3ZVZ B;  5KH7 A;  1RMD A;  2G43 A;  4S3O C;  1MM3 A;  2L5U A;  4V3K C;  5LKT A;  2OXQ C;  3ZPV E;  2YYR A;  4A4C A;  2Y1M A;  1JM7 A;  5FB0 A;  3O7A A;  2LRI C;  5I3L A;  2BAY A;  2MD8 C;  2KU3 A;  2MUM A;  4UP0 A;  4WZ0 A;  5H9M A;  2G45 A;  2JMJ A;  3SOU A;  2CSZ A;  3O37 A;  2K17 A;  2KRE A;  2VPG A;  3MHH A;  2EA6 A;  4IC3 A;  3V43 A;  4FJC A;  2E6R A;  4N4F A;  2YQM A;  2KR4 A;  4ZDT A;  5G05 B;  4GNF A;  4YAX A;  3HCT A;  3KQI A;  1E4U A;  2LGV A;  2LGK A;  1IYM A;  2L80 A;  4YAB A;  2G6Q A;  2KYU A;  4FK5 A;  2C2L A;  2ECT A;  2LGG A;  5B77 A;  3U5N A;  2LV9 A;  5LKZ A;  5TBN A;  3HCU A;  3LRQ A;  3MHS A;  2YQL A;  3LQI A;  4FIP A;  2L43 A;  3RPG C;  2LQ6 A;  4I7B A;  1XWH A;  4LJN A;  2ECW A;  2LXP C;  1WEE A;  5J3X A;  2CT2 A;  5DKA A;  2Y1N A;  2Y43 A;  4UI9 B;  2ECV A;  3PHD A;  3O70 A;  1BOR A;  3LQH A;  5FER A;  2ECJ A;  2KIZ A;  4YBT A;  5KH3 A;  3QZV A;  2AN6 A;  2KFT A;  2XB1 A;  3N9L A;  5TDW A;  5D1K B;  2ZET C;  1WGM A;  1Z6U A;  2K1J A;  4N3W A;  4PPE A;  2MT5 A;  4GNE A;  5B79 A;  5H1U A;  3O34 A;  4YBM A;  2MA6 A;  1WEU A;  1LDJ B;  2VPE A;  4AVX A;  5B76 A;  1WES A;  2LXH C;  2LDR A;  2ECG A;  3LQJ A;  2KWJ A;  2KWO A;  4AP4 A;  4I7C A;  1DVP A;  2VNF A;  3RTR B;  1K2F A;  3ZYQ A;  2CSY A;  5JG6 A;  1ZBD B;  2YUC A;  1WEQ A;  2HDP A;  5LKX A;  2ECN A;  3FL2 A;  2YUR A;  3SHB A;  5G04 B;  2XEU A;  2M85 A;  2KGI A;  3GL6 A;  3ZTG A;  1WEM A;  4WZ3 B;  3O35 A;  3L1Z B;  4A4B A;  3EB6 A;  5TDR A;  3O33 A;  4WA6 A;  2ECI A;  4QF2 A;  4X3G A;  2JMI A;  1VFY A;  3DPL R;  4MVT A;  4B7Y C;  2UZG A;  2PNX A;  2IDA A;  1WEN A;  4IC2 A;  3C5K A;  3KNV A;  1Z2Q A;  4A49 A;  1G25 A;  3PUQ A;  1VD4 A;  3T6R A;  4YC9 A;  1WIL A;  5FEY A;  2I50 A;  4R2Y A;  4YAD A;  5B75 A;  2F6N A;  2M3H A;  4AUQ B;  2YHO A;  3O36 A;  4QF3 A;  1N87 A;  4R7E A;  2MNZ A;  3U5P A;  1WEP A;  4LK9 A;  3N9O A;  3ZVY A;  3GV4 A;  3I2D A;  2QIC A;  1LDK C;  4MSX A;  5DIN A;  2F42 A;  4CA1 A;  1Z60 A;  3IHP A;  1HYI A;  4FO9 A;  2KE1 A;  3N9M A;  1HYJ A;  4BBQ A;  2YRE A;  5AIT A;  2MIQ A;  4O64 A;  4WZ2 A;  1WEV A;  2VJE B;  1X4J A;  3DQV R;  5FB1 A;  4GNG A;  2H0D B;  1FP0 A;  2VPB A;  2C2V S;  2MA5 A;  3M99 A;  2QJ0 A;  4UP5 A;  2YW8 A;  5KH9 A;  2D8S A;  3KV5 A;  2VP7 A;  3N9P A;  2HYE D;  3ASL A;  4LKA A;  4GB0 A;  3M63 A;  1FBV A;  4AYC A;  3VK6 A;  4R8P K;  5EYA F;  4NN2 A;  2VJE A;  4LLB A;  4V3L C;  1V87 A;  2FSA A;  2NAA A;  2H0D A;  3NG2 A;  4LAD B;  4S3O B;  5C11 A;  2YT5 A;  2M6M A;  2F6J A;  1VYX A;  3SOW A;  3N9N A;  5AIU A;  4YBS A;  3M62 A;  2E6S A;  5D1M B;  4ZQL A;  5LCW B;  1CHC A;  1X4U A;  2YSM A;  2RSD A;  1WEO A;  5H1T A;  1WFK A;  5TRB A;  4L58 A;  3C6W A;  3T7L A;  4XI1 A;  2L0B A;  1F62 A;  2VPD A;  4B86 C;  1X4I A;  3EB5 A;  4PTB A;  5D1L B;  2YU4 A;  2QIZ A;  3L11 A;  3U5M A;  2YHN A;  2FUI A;  1WIM A;  2LGL A;  2MNY A;  4CCG X;  4BHW A;  2K16 A;  5B8D A;  1MM2 A;  4GND A;  2K4D A;  3PUR A;  4Q6F A;  2PUY A;  4I7D A;  1T1H A;  2KWK A;  2JRJ A;  2KWN A;  5G0F A;  2RI7 A;  3ZNI A;  3HTK C;  2EOD A;  2JMD A;  3U5O A;  3ZPV 1;  5C13 A;  4C9Z A;  3RPG B;  1WEW A;  4A0C D;  5TAB A;  2KGG A;  3N9Q A;  4ZUX U;  1JOC A;  2MD7 B;  2M1R A;  5H1V A;  3SOX A;  2DX8 A;  3L1X A;  3KV6 A;  2VJF B;  2CKL B;  4AYC B;  4P5O B;  4YAT A;  1WE9 A; 
#chains in the Genus database with same CATH topology
 2L75 A;  3DDT A;  5B78 A;  4TKP B;  2OWA A;  4O62 A;  2YSJ A;  4Z0O A;  4F52 B;  2B0O E;  4L7X A;  1U6G B;  5LKU A;  3LDY A;  2CSV A;  1DCQ A;  1JM7 B;  2EGP A;  3HCS A;  4W4U A;  2VJF A;  2LN0 A;  2CKL A;  2FUU A;  3ZVZ B;  2CRR A;  5KH7 A;  2LAU A;  4QQ4 A;  1RMD A;  2G43 A;  4S3O C;  1MM3 A;  2L5U A;  4V3K C;  2E61 A;  5LKT A;  2OXQ C;  3ZPV E;  3MDB C;  4Z0R A;  2YYR A;  4A4C A;  2Y1M A;  1JM7 A;  5FB0 A;  3O7A A;  2LRI C;  5I3L A;  2BAY A;  2FFW A;  2MD8 C;  2KU3 A;  2MUM A;  4UP0 A;  4WZ0 A;  3JUE A;  5H9M A;  2G45 A;  3O47 A;  2JMJ A;  3SOU A;  2CSZ A;  3O37 A;  2K17 A;  2KRE A;  2VPG A;  3MHH A;  2EA6 A;  5SVI B;  4IC3 A;  5SVY A;  3V43 A;  3LVR E;  4FJC A;  2E6R A;  4N4F A;  2YQM A;  2KR4 A;  4ZDT A;  5G05 B;  4GNF A;  4YAX A;  3HCT A;  3KQI A;  1E4U A;  2LGV A;  2LGK A;  1IYM A;  2DJA A;  5SVI A;  2L80 A;  4YAB A;  2G6Q A;  2KYU A;  4FK5 A;  2C2L A;  2ECT A;  2LGG A;  5B77 A;  3U5N A;  2LV9 A;  5LKZ A;  5TBN A;  3HCU A;  4F1P A;  3LRQ A;  3MHS A;  2YQL A;  3LQI A;  4FIP A;  2L43 A;  3RPG C;  2LQ6 A;  4I7B A;  1XWH A;  4LJN A;  2ECW A;  2LXP C;  1WEE A;  4OGE A;  5J3X A;  2CT2 A;  5DKA A;  2L7P A;  2Y1N A;  2Y43 A;  4UI9 B;  2ECV A;  3PHD A;  5SVX A;  3O70 A;  1BOR A;  3LQH A;  5FER A;  2ECJ A;  2KIZ A;  2M13 A;  2EXU A;  4YBT A;  5KH3 A;  3FM8 C;  3QZV A;  2AN6 A;  2KFT A;  2XB1 A;  3N9L A;  3LJU X;  5TDW A;  5D1K B;  2ZET C;  1WGM A;  1Z6U A;  2K1J A;  5K3Q A;  4N3W A;  4PPE A;  2MT5 A;  4GNE A;  5B79 A;  5H1U A;  2EGM A;  3O34 A;  4YBM A;  2MA6 A;  1WEU A;  4H9D A;  3PLW A;  1LDJ B;  2VPE A;  4AVX A;  5B76 A;  1WES A;  2LXH C;  2LDR A;  2ECG A;  3LQJ A;  2KWJ A;  2KWO A;  4AP4 A;  4I7C A;  1DVP A;  2VNF A;  3RTR B;  1K2F A;  3ZYQ A;  2CSY A;  5JG6 A;  1ZBD B;  2YUC A;  1WEQ A;  2HDP A;  5LKX A;  2ECN A;  3FL2 A;  2YUR A;  3SHB A;  5G04 B;  2XEU A;  2M85 A;  2KGI A;  3GL6 A;  3ZTG A;  1WEM A;  4WZ3 B;  3O35 A;  3L1Z B;  2RR4 A;  4A4B A;  3EB6 A;  5TDR A;  3O33 A;  2D8U A;  4WA6 A;  2ECI A;  4QF2 A;  4X3G A;  2JMI A;  1VFY A;  3DPL R;  4MVT A;  4B7Y C;  2UZG A;  2PNX A;  2IDA A;  1WEN A;  4IC2 A;  3H7H A;  3C5K A;  3KNV A;  1Z2Q A;  4A49 A;  1G25 A;  3PUQ A;  1VD4 A;  2YVR A;  3T6R A;  2IQJ A;  4YC9 A;  1WIL A;  2XP0 A;  5FEY A;  3M7K A;  2I50 A;  4R2Y A;  4YAD A;  5B75 A;  2F6N A;  2M3H A;  4AUQ B;  2YHO A;  3O36 A;  4OGC A;  4QF3 A;  1N87 A;  4R7E A;  2MNZ A;  2DSM A;  3U5P A;  1WEP A;  4LK9 A;  3N9O A;  3ZVY A;  3GV4 A;  2JM3 A;  3I2D A;  2QIC A;  1LDK C;  4MSX A;  5DIN A;  2F42 A;  4CA1 A;  2CRW A;  1Z60 A;  3IHP A;  1HYI A;  4FO9 A;  2KE1 A;  3N9M A;  1HYJ A;  2FD4 A;  4BBQ A;  2YRE A;  5AIT A;  2MIQ A;  4O64 A;  4WZ2 A;  1WEV A;  3Q1D A;  2VJE B;  1X4J A;  3DQV R;  3FAN A;  5FB1 A;  1MBM A;  4GNG A;  2H0D B;  1FP0 A;  2VPB A;  2C2V S;  2MA5 A;  3M99 A;  2QJ0 A;  4UP5 A;  2YW8 A;  5KH9 A;  3E2D A;  2D8S A;  2XOC A;  3KV5 A;  2VP7 A;  2P57 A;  3N9P A;  2HYE D;  3ASL A;  4LKA A;  4GB0 A;  3KDE C;  3M63 A;  1FBV A;  2MKE A;  3VK6 A;  4AYC A;  5EYA F;  4R8P K;  4NN2 A;  2VJE A;  4LLB A;  4V3L C;  2XOY A;  1V87 A;  2FSA A;  2NAA A;  2H0D A;  3NG2 A;  3DWD A;  4LAD B;  4S3O B;  5C11 A;  3FJU B;  2YT5 A;  2M6M A;  2F6J A;  1VYX A;  3SOW A;  3N9N A;  3T9K A;  2KKY A;  5AIU A;  4YBS A;  3M62 A;  2E6S A;  5D1M B;  4ZQL A;  5LCW B;  1CHC A;  1X4U A;  2YSM A;  2RSD A;  1WEO A;  5H1T A;  3FAO A;  1WFK A;  5TRB A;  4L58 A;  3C6W A;  3T7L A;  4XI1 A;  2L0B A;  1F62 A;  2VPD A;  4B86 C;  1X4I A;  3EB5 A;  4PTB A;  5D1L B;  2YU4 A;  2QIZ A;  2KKX A;  3L11 A;  3U5M A;  2YHN A;  2FUI A;  1WIM A;  2LGL A;  2MNY A;  4CCG X;  4BHW A;  2K16 A;  5B8D A;  1MM2 A;  3FEH A;  4GND A;  2K4D A;  3PUR A;  4Q6F A;  2PUY A;  4I7D A;  1T1H A;  2KWK A;  2JRJ A;  2KWN A;  5G0F A;  2RI7 A;  3ZNI A;  3LVQ E;  3HTK C;  2EOD A;  2JMD A;  2JUN A;  3U5O A;  3ZPV 1;  5C13 A;  2CON A;  4C9Z A;  3RPG B;  1WEW A;  4A0C D;  5TAB A;  2KGG A;  3N9Q A;  4ZUX U;  1JOC A;  3SUB A;  2MD7 B;  2XOZ A;  2M1R A;  5H1V A;  3SOX A;  2DX8 A;  3L1X A;  3KV6 A;  2VJF B;  2CKL B;  4AYC B;  4P5O B;  4YAT A;  1WE9 A; 
#chains in the Genus database with same CATH homology
 2L75 A;  5B78 A;  4TKP B;  2YSJ A;  4F52 B;  4L7X A;  1U6G B;  5LKU A;  1JM7 B;  2EGP A;  3HCS A;  4W4U A;  2VJF A;  2LN0 A;  2CKL A;  2FUU A;  3ZVZ B;  5KH7 A;  1RMD A;  2G43 A;  4S3O C;  1MM3 A;  2L5U A;  4V3K C;  5LKT A;  2OXQ C;  3ZPV E;  2YYR A;  4A4C A;  2Y1M A;  1JM7 A;  5FB0 A;  3O7A A;  2LRI C;  5I3L A;  2BAY A;  2MD8 C;  2KU3 A;  2MUM A;  4UP0 A;  4WZ0 A;  5H9M A;  2G45 A;  2JMJ A;  3SOU A;  2CSZ A;  3O37 A;  2K17 A;  2KRE A;  2VPG A;  3MHH A;  2EA6 A;  4IC3 A;  3V43 A;  4FJC A;  2E6R A;  4N4F A;  2YQM A;  2KR4 A;  4ZDT A;  5G05 B;  4GNF A;  4YAX A;  3HCT A;  3KQI A;  1E4U A;  2LGV A;  2LGK A;  1IYM A;  2L80 A;  4YAB A;  2G6Q A;  2KYU A;  4FK5 A;  2C2L A;  2ECT A;  2LGG A;  5B77 A;  3U5N A;  2LV9 A;  5LKZ A;  5TBN A;  3HCU A;  3LRQ A;  3MHS A;  2YQL A;  3LQI A;  4FIP A;  2L43 A;  3RPG C;  2LQ6 A;  4I7B A;  1XWH A;  4LJN A;  2ECW A;  2LXP C;  1WEE A;  5J3X A;  2CT2 A;  5DKA A;  2Y1N A;  2Y43 A;  4UI9 B;  2ECV A;  3PHD A;  3O70 A;  1BOR A;  3LQH A;  5FER A;  2ECJ A;  2KIZ A;  4YBT A;  5KH3 A;  3QZV A;  2AN6 A;  2KFT A;  2XB1 A;  3N9L A;  5TDW A;  5D1K B;  2ZET C;  1WGM A;  1Z6U A;  2K1J A;  4N3W A;  4PPE A;  2MT5 A;  4GNE A;  5B79 A;  5H1U A;  3O34 A;  4YBM A;  2MA6 A;  1WEU A;  1LDJ B;  2VPE A;  4AVX A;  5B76 A;  1WES A;  2LXH C;  2LDR A;  2ECG A;  3LQJ A;  2KWJ A;  2KWO A;  4AP4 A;  4I7C A;  1DVP A;  2VNF A;  3RTR B;  1K2F A;  3ZYQ A;  2CSY A;  5JG6 A;  1ZBD B;  2YUC A;  1WEQ A;  2HDP A;  5LKX A;  2ECN A;  3FL2 A;  2YUR A;  3SHB A;  5G04 B;  2XEU A;  2M85 A;  2KGI A;  3GL6 A;  3ZTG A;  1WEM A;  4WZ3 B;  3O35 A;  3L1Z B;  4A4B A;  3EB6 A;  5TDR A;  3O33 A;  4WA6 A;  2ECI A;  4QF2 A;  4X3G A;  2JMI A;  1VFY A;  3DPL R;  4MVT A;  4B7Y C;  2UZG A;  2PNX A;  2IDA A;  1WEN A;  4IC2 A;  3C5K A;  3KNV A;  1Z2Q A;  4A49 A;  1G25 A;  3PUQ A;  1VD4 A;  3T6R A;  4YC9 A;  1WIL A;  5FEY A;  2I50 A;  4R2Y A;  4YAD A;  5B75 A;  2F6N A;  2M3H A;  4AUQ B;  2YHO A;  3O36 A;  4QF3 A;  1N87 A;  4R7E A;  2MNZ A;  3U5P A;  1WEP A;  4LK9 A;  3N9O A;  3ZVY A;  3GV4 A;  3I2D A;  2QIC A;  1LDK C;  4MSX A;  5DIN A;  2F42 A;  4CA1 A;  1Z60 A;  3IHP A;  1HYI A;  4FO9 A;  2KE1 A;  3N9M A;  1HYJ A;  4BBQ A;  2YRE A;  5AIT A;  2MIQ A;  4O64 A;  4WZ2 A;  1WEV A;  2VJE B;  1X4J A;  3DQV R;  5FB1 A;  4GNG A;  2H0D B;  1FP0 A;  2VPB A;  2C2V S;  2MA5 A;  3M99 A;  2QJ0 A;  4UP5 A;  2YW8 A;  5KH9 A;  2D8S A;  3KV5 A;  2VP7 A;  3N9P A;  2HYE D;  3ASL A;  4LKA A;  4GB0 A;  3M63 A;  1FBV A;  4AYC A;  3VK6 A;  4R8P K;  5EYA F;  4NN2 A;  2VJE A;  4LLB A;  4V3L C;  1V87 A;  2FSA A;  2NAA A;  2H0D A;  3NG2 A;  4LAD B;  4S3O B;  5C11 A;  2YT5 A;  2M6M A;  2F6J A;  1VYX A;  3SOW A;  3N9N A;  5AIU A;  4YBS A;  3M62 A;  2E6S A;  5D1M B;  4ZQL A;  5LCW B;  1CHC A;  1X4U A;  2YSM A;  2RSD A;  1WEO A;  5H1T A;  1WFK A;  5TRB A;  4L58 A;  3C6W A;  3T7L A;  4XI1 A;  2L0B A;  1F62 A;  2VPD A;  4B86 C;  1X4I A;  3EB5 A;  4PTB A;  5D1L B;  2YU4 A;  2QIZ A;  3L11 A;  3U5M A;  2YHN A;  2FUI A;  1WIM A;  2LGL A;  2MNY A;  4CCG X;  4BHW A;  2K16 A;  5B8D A;  1MM2 A;  4GND A;  2K4D A;  3PUR A;  4Q6F A;  2PUY A;  4I7D A;  1T1H A;  2KWK A;  2JRJ A;  2KWN A;  5G0F A;  2RI7 A;  3ZNI A;  3HTK C;  2EOD A;  2JMD A;  3U5O A;  3ZPV 1;  5C13 A;  4C9Z A;  3RPG B;  1WEW A;  4A0C D;  5TAB A;  2KGG A;  3N9Q A;  4ZUX U;  1JOC A;  2MD7 B;  2M1R A;  5H1V A;  3SOX A;  2DX8 A;  3L1X A;  3KV6 A;  2VJF B;  2CKL B;  4AYC B;  4P5O B;  4YAT A;  1WE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...