5JH2A

Crystal structure of the holo form of akr4c7 from maize
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
283
structure length
257
Chain Sequence
b'ARHFVLNTGAKIPSVGLGSWQSDPGVVGNAVYAAVKAGYRHIDCARVYGNEKEIGLALKKLFEEGVVKREDMFITSKLWNDHHAPEDVPEALNDSLNDLQLEYLDLYLIHWPFFPATWGAMEKLYDAGKARAIGVSNFSSKKLGDLLAVARVPPAVDQVECHPGWQQTKLHSFCQSTGVHLTAYSPLGNVLKEPIIISIAEKLGKTSAQVALRWNIQMGHSVLPKSTNEERIKQNLDVYDWSIPDDLLAKFSEIKQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldose reductase, AKR4C7
publication title A comparative structural analysis reveals distinctive features of co-factor binding and substrate specificity in plant aldo-keto reductases.
pubmed doi rcsb
source organism Zea mays
molecule tags Oxidoreductase
total genus 93
structure length 257
sequence length 283
ec nomenclature
pdb deposition date 2016-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 5jh2A00
3KRBA 4XZHA 3R7MA 1C9WA 1EXBA 1XJBA 2PEVA 1HW6A 5HA7A 1S1PA 2P5NA 4GCAA 3CV6A 2FZ9A 1Q5MA 2VDGA 1RY0A 3M0IA 4YVPA 5DANA 4JIIX 1S2CA 2BGSA 2ISFA 3WBWA 1VP5A 4JTAA 2R9RA 2ALRA 4EXBA 3GUGA 4DZ5A 1AFSA 2DUXA 2FZDA 3V0UA 4ICCX 1J96A 3LBOA 5AZ0A 3P2VA 1MI3A 2PDUA 1SM9A 4XO6A 3CMFA 4FAMA 4PMJA 3LN3A 1K8CA 3VXGA 1MZRA 4LAZA 3UFYA 2PDPA 1QRQA 4JQ4A 1AZ1A 4IGSA 2PDHA 1US0A 1ZQ5A 1AH0A 3GHSA 3LD5A 3GHTA 2PDJA 5LIWX 1GVEA 2R24A 4XZLX 2PDIA 1HQTA 4QXIA 4JQAA 1T41A 4L1WA 4Q7BA 3H7RA 2IKGA 3UG8A 4QBXA 3LNMA 2HEJA 4JTCA 3G5EA 3R8GA 3NTYA 1X96A 1EF3A 1YNQA 3V35A 4H8NA 1PZ0A 1Z8AA 4JIRA 2PDQA 1T40A 4YS1A 3O0KA 3BV7A 1EKOA 4JTDA 4XVDA 4LB3A 3QKZA 2IKHA 5LIYX 3T42A 4LAUA 4Q3MA 4NKCA 4PUUA 4LBSA 4GABA 4FALA 2A79A 2NVDA 1AZ2A 3UYIA 1RALA 4XZNX 5HNUA 2FZBA 2IKJA 1YE6A 4WEVX 2C91A 2IPGA 2ACUA 4EXAA 4XK2A 3ERPA 3BCJA 1YE4A 3C3UA 3LZ3A 1PWMA 1Z3NA 1R38A 4ASTA 3LQGA 4HMNA 4IJCA 4YVVA 1S1RA 3V36A 2HE5A 1RY8A 1ZUAX 2F2KA 3UZXA 2PFHA 1VBJA 4I5XA 4R9OA 4GQ0A 4G5DA 2PDXA 2PDLA 4GACA 2HV5A 2DUZA 4WGHA 3G1RA 3N2TA 4HBKA 2IKIA 4H7CA 1ZSXA 4YVXA 2PZNA 4DBSA 4XAPA 3R94A 3UZZA 2FVLA 2PDFA 2HVOA 2BGQA 4JQ3A 1AH3A 4IJRA 1PWLA 4LBRA 4PRRA 2PDMA 2INEA 3UZWA 4GA8A 1X98A 1A80A 3H7UA 3D3FA 2I17A 3WBXA 3CAQA 4JIHA 2IPJA 2PDGA 3WBYA 2PDYA 3ONCA 2F38A 5LIKX 2HE8A 5LIUX 3BURA 4WDTA 4OTKA 3M4HA 4JTRA 4JQ2A 4F40A 3WG6A 4XZMX 4JTQA 5C7HA 4PR4A 3R43A 1PZ1A 4L1XA 3FJNA 3GHUA 3UP8A 1M9HA 2FZ8A 2IPFA 3LZ5A 2IS7A 3B3DA 2WZMA 1Z9AA 2CLPA 4ZFCA 3LUTA 4FA3A 3V0TA 1XF0A 3MC5A 4WDWA 3V0SA 2PDWA 3M64A 3GHRA 4GQGA 2QXWA 3WCZA 5HNTA 3CASA 3R6IA 1ZGDA 3UZYA 4XO7A 2ACQA 5LIXX 5JH1A 2IPWA 4WRHA 3S3GA 3BUVA 2PD9A 3COTA 1XGDA 1UR3M 4PRTA 3H4GA 1IHIA 3ONBA 4WDUA 3RX3A 1Z89A 3MB9A 4FZIA 3R58A 3DN5A 3UGRA 4PUWA 3N6QA 2J8TA 1YNPA 3LQLA 3Q65A 4GIEA 3O3RA 2PF8A 2FGBA 1JEZA 2ACRA 2INZA 3EB3A 3F7JA 2PDCA 4QX4A 1Q13A 2NVCA 3DOPA 3RX2A 4QR6A 4AUBA 4LB4A 2PDNA 4WDXA 2HDJA 1ADSA 2BP1A 3RX4A 2PD5A 2IQDA 5KETA 5AZ1A 3LEPA 3CAVA 1FRBA 3LENA 2DV0A 4YU1A 2AGTA 3EB4A 4DBUA 1S2AA 1LWIA 3CV7A 4DBWA 1X97A 3UWEA 1EL3A 2I16A 2ACSA 1OG6A 2PDBA 2HVNA 5JH2A 3U2CA 3EAUA 1IEIA 3Q67A 4XZIA 1LQAA 3FX4A 3R8HA 4RPQA 5M2FX 4XVEA 1QWKA 1PYFA 1AH4A 2WZTA 2PDKA 4MHBA 4JQ1A 2IQ0A 1MRQA
chains in the Genus database with same CATH superfamily
2D73A 3WUFA 3EX1A 3KVJA 1UJPA 2VC6A 1FKWA 3U7BA 1UD2A 5HA7A 4UNKA 3ISIX 2BY2A 4GI6A 3A5VA 2FZ9A 4WY0B 4ZE5A 4YVPA 2ISDA 3WQGA 2OFJA 4V33A 4YLWA 4ZMGA 1DVJA 3VINA 4DUVA 3MKVA 4AISA 1XM3A 5E0CA 1JFHA 5G4WA 2R1MA 4O1EA 1PB0A 2ALRA 5MKGB 2XVKA 4P8VA 2GOUA 3H55A 1YPXA 4L9XA 3VU2A 1H3GA 3FHAA 4IPNB 1SZNA 1HL2A 3A23A 1PVNA 2Y7FA 1Y8BA 3HZ3A 4UTTC 3GVGA 2V81A 4D6GA 3WUBA 1XYAA 3QMTA 3GM8A 3PTKA 4HU8A 1JPMA 2B7QA 3L23A 4R33A 2VYOA 3AQUA 4DJDC 1LG2A 4ERAA 1CXEA 1KM1A 2PWGA 3ZFHA 1QRQA 5ABTA 2TYSA 1PXGA 3P82A 3S83A 4O54A 1GVSA 3T2PA 4C5ZA 1E3XA 4TV5A 2QUVA 3VUSA 3GX9A 3W73A 3VNJA 4H6EA 1O95A 3M0MA 1I8JA 1UIOA 2MANA 3DHPA 3KOZA 4Z2HA 2ZE0A 4P8UA 3P14A 1X38A 3JUGA 2DPEA 5EU9A 1QXLA 2PDIA 2EPLX 1R8LA 4JFSA 2V9DA 4DF1A 4GYJA 4GISA 5GNXA 3LCFA 1L8PA 3LRMA 3LSBA 3UEQA 2DIJA 2X41A 4MYXA 1SZEA 4PMZA 2PGEA 1J4EA 3PBMA 1PZ0A 2WKLA 3VKKA 2DZUA 1TYGA 5CBJA 4YS1A 2V5LA 1ZU8A 3VNLA 3ENLA 3L9CA 3BV7A 3KVLA 3GKFA 4GGBA 3NPVA 2C3ZA 1HJQA 5CPOA 1W31A 5LIYX 1BSLA 4KT2A 3P8JA 1LQ2A 4NNCA 5C9UA 3G8EA 4NKCA 1VFMA 2YFOA 1PYMA 4IMGA 4B9ZA 3G3MA 2RJGA 3UVAA 3AZTA 1IIHA 3IIPA 1CLKA 1TPDA 2VELA 1SZRA 2WCAA 2IPGA 5GQBA 4MZ1A 4M24A 1KCXA 4WSKA 4JTLA 3U7VA 3W1QA 1OCJA 1V6XA 4I3GA 3SUUA 3UPWA 1C91A 4I9JA 3BAKA 4CCEA 2P3ZA 3GNDA 2F7FA 3B8SA 3TYZA 1PKYA 1DJIA 4A05A 5JBFA 3I7QA 1EYWA 2CBUA 3ZT5A 2TPSA 4P8WA 3PZTA 4C91A 1YDVA 3NO5A 5BXTA 4AH7A 1NIUA 2CBIA 5A6MA 1YTEA 3LHVA 3FKKA 1XCFA 3VMOA 4MB5A 1HP4A 2DVUA 1N55A 4XAFA 1QHZA 4WHBA 4MJ2A 3R94A 4AEFA 1FH8A 3GDLA 2NUWA 3E0LA 4H9VA 1QT1A 3SB0A 3FY1A 1DWJM 2IQTA 4QDWA 1IEWA 5BOEA 1FCUA 4DF2A 4RE4A 5CGTA 5ABFA 1A80A 3D3FA 3SFKA 4F2TA 4EK7A 5G4HC 3OYXA 4IQLA 2OQLA 4O1AA 2BG5A 3ZVHA 1VBRA 5LIUX 1Q85A 2OZTA 3BURA 1H0IA 2YW4A 4JTFA 4RXGA 4M29A 3T4WA 3GIQA 3P5YA 2BMBA 3LXCA 4RW3A 3MBDA 2P76A 4GO9A 2GUYA 1VEPA 3LMZA 1D3HA 2G3MA 3IVTA 3M64A 1AL7A 1NFBA 2TODA 3WUEA 3NZQA 4ZQPA 4YTUA 3RN6A 4BI5A 3U3HA 1BG9A 1OY0A 3FIGA 5D09A 2Z2BA 1HZYA 1YLVA 1FOBA 1ZHAA 4DO5A 3UJSA 1XSKA 3VMPA 5JU6A 5I07A 3NQGA 1YQ2A 4Z17A 4W7UA 3PTDA 1MEIA 1M5WA 3SSZA 4DUWA 3AIUA 1PX4A 3WBEA 4JTIA 1JCTA 2FFIA 1DP0A 3LHZA 1Q4WA 3T44A 1BRLB 1VBHA 2ZX6A 1I2NA 4EAMA 4OJYA 4HNCA 2GJNA 2HS8A 4BWLC 2GQAA 4Q8UA 3OTRA 2YIHA 3ABQA 4CNOA 3PZ9A 2WM1A 4LT9A 1JUEA 4DWSC 2UY5A 1IWPA 1KR1A 3NQAA 2AAAA 3SECA 3IJLA 1UWTA 2ANUA 4LB4A 3HV8A 2PPGA 3W26A 2HNHA 4IUGA 3B8UA 5GVJA 5BWAA 3AYSA 2NV1A 2WKJA 3TWAA 2I7GA 1O12A 1VYSX 4XD3A 1P6BA 3CQHA 3SFWA 3CAVA 2OEKA 4LS1A 1DQUA 4GVFA 5E0KA 1UIPA 4LRSA 2PA6A 4P5UA 1UWSA 4NYYA 3B0XA 4M6VA 2Y5SA 3WDHA 5J5DA 4TOQA 1KFJA 4AD0A 1JZ7A 4Y96A 1Q2RA 5E93A 2C14A 1OX4B 2A3HA 3EAUA 3Q67A 4HCLA 3T81A 4PMYA 1YIXA 4CD5A 3H2AA 3NDOA 3VGDA 3KDOA 1QBBA 1X1ZA 3IS4A 1OINA 2NW0A 1ZP4A 3ARRA 1TMLA 3KRBA 4MSSA 1FH9A 4B5UA 4NNAA 2NX3A 1HW6A 4F0HA 2UZ9A 4H1ZA 5HNRA 4AVOA 3G1FA 4GZJA 2WXDM 1R2RA 5K9XA 2J7FA 1RA0A 1KFLA 3G0XA 3W27A 4S3DA 1E43A 5F2LA 3STCA 2BGSA 3QV6A 2JGYA 3K4AA 3M1ZA 2XGZA 3KOWA 3SQLA 2X2YA 4R34A 3CQ0A 3ZJ6A 2PC4A 5D37A 4IFOA 3BJFA 3URBA 3GVVA 1HL8A 1K9FA 3RMJA 3PZMA 7PTDA 3AALA 4XG1A 1FVPA 3VOHA 1QOPA 2PTDA 3L0GA 4REQB 5FL0A 3H26A 4D8ZA 4HP5A 4QM1A 4BQ5A 2QUTA 1MNSA 3FDKA 2QVNA 3WK0A 2VFGA 3AXKA 1H1ZA 2CESA 4ZCWA 2V8ZA 4IL2A 1XFBA 3WZ0E 1LG1A 2WAGA 3ITXA 3OGVA 4JEQA 3DFPA 2DVTA 4D1JA 1M41A 3KTCA 1JGMA 1FDZA 3LD5A 4CVWA 5DFAA 1F6KA 1J2WA 3DCPA 1AW1A 2NSOA 4LS2A 3W7JA 4EX4A 2WQDA 1E1EA 3OBKA 2IW0A 4MWAE 4W7VA 2ISSA 2DP3A 1HL9A 3H7RA 1OADA 4JTCA 1A47A 1UD4A 4NVTA 4KRZA 2G37A 2PI6A 3UCCA 2J6VA 4H8NA 3VE9A 4E4FA 5KTLA 2CXEA 5JMUA 3R8RA 4GUHA 1C7SA 1QNQA 4JN6A 4IQEA 1R2TA 4C6JA 3N1AA 1H7PA 1F3WA 1W1PA 3BWWA 2XG9A 2YBVA 2DT2A 3O6DA 1DQWA 3B40A 2WWCA 4P7QA 2ZRUA 3UZ5A 2O9TA 2BZNA 1B5TA 4LAUA 3WLNA 3VFLA 1Q6RA 1CGXA 1CXKA 2BHYA 1TPC1 3CIWA 1VQTA 4N4QA 3WNKA 2QCGA 2HSAA 4BQ3A 3GU9A 2JEPA 1ENUA 2ATSA 1JYVA 4PFHA 4W4QA 1FQ0A 2E40A 1OYCA 3NQBA 3ITLA 2V6AA 4OIFA 4TV6A 4HA0A 4QP0A 1S1RA 4DHGA 3TN6A 3V18A 4LWWA 1SMDA 1WUFA 4F0RA 1PBGA 3VC6A 3QM3A 2DIKA 4HD5A 1EC8A 4Q8PA 1OFRA 4LCRA 4BZYA 4NRSA 3WK3A 3UVIA 4S3BA 4C6EA 1UWRA 1TTJA 4LAOA 1K8XA 4H7CA 1QR7A 3KL5A 3FNDA 1W9PA 4GYPA 1HJSA 4LX4A 3W84A 2BXVA 4A6GA 4L64A 3DFTA 1SFSA 4XV0A 4UTFA 2PWFA 3DHFA 3WBXA 4O19A 1X7IA 2A5HA 3W9ZA 4NXKA 3WLSA 1P6CA 2F38A 1W8GA 3T2QA 4MWAA 2XHYA 4W5UA 2OZ8A 2CLMA 4JTRA 3WELA 4B5TA 3CV1A 4K1GA 3MDUA 4FOUA 4NAEA 4LOCA 1SFLA 3QFWA 3PJUA 5HR7A 1IZJA 3S2LA 3OZOA 1RA5A 1CYGA 4UQAA 2OKOA 2HVMA 4W87A 4AD1A 4B5VA 3BGGA 1TTQA 4H9ZA 5LNRA 4Q8NA 3L5AA 3VABA 2A7NA 4FNRA 4IXHA 3WF3A 3KTSA 4RDVA 3W24A 2E4TA 3PUOA 4X9SA 4G7EB 3VIJA 4PSPA 3PC0A 1RP9A 3NQ8A 1ZJAA 1RCXB 4TQTA 4MNMA 2GSEA 3UZYA 4FLOA 3PJTA 5I00A 4AXNA 1E6XM 3NVDA 3VIGA 4FLQA 3N34A 1VR6A 3QPEA 3TXVA 2QJMA 3W74A 1B4KA 3W1UA 1V3MA 3OLGA 1Z7AA 4F2UA 4G6CA 4CQBA 2YLLA 4AC1X 1FWNA 4UBPC 3RPMA 4FHAA 3IJ9A 1RJPA 5CJNA 2YSWA 3W37A 3SUSA 1QOXA 4PUWA 4MNLA 3LQLA 2X1RA 3GXDA 1HJXA 2R82A 4FEZA 4US6A 3CPUA 4G1NA 4HJWA 4YXGA 4PMOA 2Z7GA 2ACRA 1FTXA 3RFAA 3NDYA 1WOAA 5HATA 3NL5A 3W2NA 3L5LA 4CNUA 4IWWA 1P6WA 1KXTA 1YXCA 7REQA 4PMNA 2PLCA 2G3IA 2WM0A 4IQJA 1OK4A 2BP1A 4PMVA 4QEEA 3GFXA 2QV4A 3TROA 3BE7A 5I3FA 3CIXA 4LANA 1XYCA 4YHGA 1TMHA 2ZUUA 3EDDA 3W3OA 3AJ7A 3W2KA 2OR2A 3MZ2A 3RG6A 2HXUA 4IHCA 3F5LA 4U2YA 4F8XA 4JL2A 1DXFA 3IUHA 1XYBA 1S5VA 1EIBA 1ZALA 3HOJA 4DLFA 3MSDA 1AG1O 2V2CA 2PDBA 4TO8A 4JHMA 1ZBWA 2QDGA 1US3A 3NZ1A 1WAWA 2NLYA 3LXAA 3LRLA 1UR9A 2Q01A 2ISWA 3MANA 1GOOA 2YX0A 4JZ5A 1UWAA 3ITCA 1J5SA 3Q2DA 4NJHA 1EP2A 1EZWA 4BQ4A 1P0DA 1TRDA 3HGRA 5F4XA 1D7FA 2WMJA 4WZHA 1TV2A 1RVKA 5BW6A 2PEVA 5BMWA 4UNIA 2DSVA 3FOKA 1H11A 1TX0A 4KRUA 2YDRA 1W1IE 3CV6A 4CU6A 4O15A 4D6IA 3PUDA 4GHRA 2IXUA 3S0CA 1REQB 4DAIA 4LEFA 1EDGA 1T8XA 3GC4A 4NUWA 4GVHA 2X42A 2Z2AA 3BMVA 3OGSA 4A22A 4Q8VA 1UKOA 1UWIA 4QISA 5HR6A 3ARPA 1WKDA 1TTPA 4XZBA 4ORMA 3SN4A 2FHBA 1WZKA 4JHOA 1B3WA 5AZ0A 5KSWA 3HTWA 4HOZA 1K8ZA 1WZLA 3CMFA 3LB0A 2XWDA 1VFOA 4DQWA 3M47A 4WOZA 5CGQA 4PMJA 3IIVA 3PZNA 4DI8A 1MZRA 5M5DA 3GG7A 4QQ3A 4M6UA 4LYRA 3B9DA 4Q8WA 1SR0A 1WDWA 3SGUA 4DX3A 5JUVA 4XSMA 5AY7A 1XRVA 5G1TA 1JYWA 1CPUA 2Z27A 3A13A 2Z2UA 1GOKA 3TXZA 3QPYA 1Y5XA 1AMYA 1QW7A 3N15A 2D2JA 3TFXA 4FB7A 5FCZA 3GR4A 4YL2A 3RUBL 2I14A 1TQXA 2VMFA 2GQ3A 3R13A 1LBMA 5I3DA 3F4WA 1V0MA 2EG6A 4PTXA 4LUIA 4W86A 4WKHA 2XFYA 5I24A 1X6UA 2I1OA 1E51A 1CT5A 4UTHA 2ZC1A 4XQ6A 2ZCGA 4TXEA 4BF9A 3ZR4A 3O0KA 5GJPA 1VPXA 5FJTA 1F05A 3SJ3A 1W3KA 3W7EA 3PF3A 4M82A 3E6EA 1ME8A 4ES4A 3VIFA 1KBBA 7TAAA 4LB3A 4NI8A 3JVAA 2X1TA 1DJGA 2A3LA 2YDAA 4G8TA 3RYSA 1V3JA 1VYRA 3UJ2A 2OWWA 3OVRA 3L66A 3AMCA 3THQA 4HPJA 2GJRA 1W5NA 2WVVA 3TNOA 1OCQA 5HNUA 4MIMA 4TTUA 3ID7A 5JIPA 4LU0A 3LPGA 1E0VA 2DZXA 4IPIA 4M0XA 3C3UA 3GLCA 3OEXA 3C52A 3WQCA 1WQ5A 5CSUA 3W4RA 3L4YA 3B4UA 5EY5A 1SO4A 4LTSA 4C60A 3JW7A 2HE5A 3MO7A 4XBSA 4WSJA 3N18A 4HT3A 3AS1A 3I6TA 3NSNA 1F74A 3AO0A 4I9TA 4K68A 3EBVA 3PULA 4C6OA 3TN5A 4GPNA 4J27A 1XLFA 1F73A 4H41A 1YKWA 3V4BA 4Q7IA 2I5QA 3MUXA 3SCQA 1OFEA 4FO4A 5FEXA 3UD6A 1R3SA 5EA9A 4JNZA 1ZAIA 3AZSA 3G18A 1HXJA 1B57A 4GKLA 3HG2A 3QZ6A 2EBNA 3S5OA 2PDMA 4GA8A 2GDUA 3O63A 4IL0A 5E0FA 1AW2A 3RHGA 4HYRA 4QROA 3NO3A 2O92A 3Q37A 1E73M 4GOAA 4QSFA 3UG3A 3ZZ1A 2VZUA 4WXYA 3TLLA 3OPSA 3L4ZA 1HKIA 1EFZA 1RBLA 1DPMA 1XLGA 1J6PA 3NGJA 1XLHA 2PBGA 1G1YA 4IFKB 4FA3A 1UD8A 1EZ2A 1XIDA 5C54A 1VFHA 3AHTA 3L67A 4NHVA 4R85A 1MRAA 1XBZA 2Q3OA 5HAOA 3H2EA 2Q3RA 1NJJA 3VOGA 3HPSA 2Z1WA 3WCZA 4O17A 3HJZA 1HTIA 1RLCL 3MUIA 4I90A 4O1DA 6REQA 2GUBA 4L80A 5CH9A 2BWGA 1Q2SA 1QDSA 4L5ZA 2BGNE 3ZSSA 3TW7A 2F6KA 4HJFA 3VMNA 4JXCA 2FPYA 5MHBA 2XN1A 1VYPX 2R1PA 2BVTA 3CZJA 2DZBA 3L4VA 3ZJKA 2I5IA 1XH0A 2R6OA 3MKKA 3P5ZA 4HZMA 1OK6A 3EB3A 4XKYA 4E0CA 1W1YA 2FTPA 5AKQA 3GYCA 1TZ7A 2Z29A 3DDMA 1M7OA 3KCJA 4LUTA 3S5NA 1MQRA 3RX4A 3N2BA 1UH3A 4QE1A 5ABFB 4MDOA 3HQPA 4GJIA 1ZTVA 2W66A 1TZZA 1W5PA 3P61A 4MKSA 9XIAA 2AMGA 4M51A 3R79A 3W7RA 3CB8A 5CZ0A 2VL4A 5HANA 3VKAA 2OSXA 4DVOA 5DF0A 3SBFA 1H2JA 4V1XA 2HQAA 3M0YA 4AFYA 3TMQA 1IEIA 3UR8A 4JFVA 5GJMA 4EOUA 3QV8A 1LZOA 8RUCA 1O6IA 3AC0A 5M2FX 4LEQA 1XIJA 3RDKA 2OX1A 2ZX9A 2QCDB 1VB9A 4QITA 2PDKA 5FF2A 1I2RA 4AZHA 3EPMA 1QUMA 1WXJA 3ZSTA 4UIOA 3RILA 1UKQA 4DXXA 1PX8A 3LG3A 1C9WA 1E6SM 2REQA 1A0EA 2P5NA 2GGIA 4O1CA 4I6VA 3OYZA 5U4NA 3N12A 3BARA 3MUZ1 3A4AA 1R86A 1CLXA 5IFTA 4ZFMA 3I7RA 2D69A 2GQ9A 1X7FA 1RLDA 4DZ5A 1HGYA 4B9YA 1H7XA 1FHDA 3LSCA 3MA8A 4D1IA 5ECVA 3LTYA 1R87A 3DFOA 3KRSA 2WSQA 1DXEA 3GFYA 3PBVA 5XINA 4WQ6A 3P2VA 1JDEA 4NILA 1Z41A 4YTRA 4HOXA 2Y61A 3GE7A 1CW2A 3WLTA 3QPZA 3SQSA 1RCQA 5T9BG 3O6YX 2CLKA 2ZADA 3VM7A 1B1YA 1C29A 2ZZ6A 3GTNA 4AX7A 3MI6A 4O4WA 3QGKC 3T0BA 2JE8A 1WYIA 3UQNA 5G5IA 3EDFA 3W1NA 2GQ8A 1A5LC 2UY2A 4H01A 2QS8A 2PDHA 1N8IA 2XFRA 1AH0A 3DENA 1IT7A 1W0MA 1RJQA 1UKTA 3IAPA 1X1OA 2A6NA 4IISA 1G69A 3UXLA 2VJXA 3C0LA 2PC8A 3LGGA 1TTIA 4A3RA 2CZFA 2PRHA 2NV9A 3KBMA 3LGEA 1E1CA 4FXSA 4GFIA 4WK9A 1ITQA 2H9AA 3LLDA 2WC4A 1SJAA 2GWGA 4D71A 1PIIA 3NL3A 4WIWA 4ZBCA 3HGSA 3C2OA 7ENLA 1VPYA 4KF1A 2VOMA 3GYEA 4J40A 1S38A 1VIWA 3S8HA 3AMLA 3QN3A 3WDRA 4XZ9A 1W32A 3URAA 2ABAA 1A5CA 1EF3A 3U9IA 3ABOA 4HN8A 3QOMA 1NTHA 1OFAA 1U5HA 3W07A 1T40A 2BVWA 2CW6A 4QDPA 1IWBA 2XIQA 4OKDA 1GOQA 3GDKA 3W28A 3PWGA 3M0HA 1XCXA 3NL6A 5B7YA 4IIFA 4H8HA 3KBWA 1TJRA 1H7OA 3DG7A 1DWHM 4GUGA 4OE7A 2C0HA 4UTIA 2G41A 3GDTA 3GU1A 4O16A 1XIBA 3BO9A 4MFEA 5L6UA 1YE6A 2GGJA 5FI8A 1LYXA 1YE4A 4Y9AA 1PWMA 1B3OA 2AOSA 3UPBA 2OMAA 3N6HA 3B05A 3OZPA 3UWZA 1OT2A 1XINA 5TIMA 4YN5A 5HMSA 4IMAA 1XYZA 4O4VA 2FYMA 1UB3A 4CNSA 4GXPA 1PEZA 3QVQA 1G5AA 3ALFA 1BQCA 3S6OA 3S5SA 3BW3A 1C7TA 1PUDA 1JCNA 2VO5A 4GGHA 4GQ0A 2WHMA 2PDXA 4LV9A 1G67A 2PDLA 4A4AA 5I0DA 4M80A 5CAHA 1SSDA 1HT6A 1M7PA 3I7SA 2NLIA 3JR2A 2A85A 2NVAA 2Y7GA 4OOUA 3ZM8A 5A6TC 4L1GA 4XAYA 3R2GA 4H6RA 5IOBA 5A8QA 3J7HA 1TQJA 1ISXA 3RCMA 5HWNA 1GOMA 4KCTA 1QI0A 4A21A 4BR1A 1OSEA 3CYVA 2NUYA 3VE7A 4AZCA 3VDHA 3BLFA 1BGGA 1SW7A 2YL8A 3WBYA 1CNVA 2PDYA 1GVQA 4N02A 3VIHA 4PUNA 3RCNA 3L0NA 4XD4A 3W88A 4AWUA 3LM7A 2NWSA 1PTDA 2VZVA 2DZPA 3C2EA 3FJNA 3U5UA 3ARZA 3G3DA 1P7TA 1TJ2A 4Z1AA 4CN6A 4BK9A 4ZFCA 2WBKA 4UOZA 1XF0A 1BYCA 4ICMA 3LHTA 3VNMA 3UNTA 3QC3A 1JQVA 1KRMA 2DT0A 4KCVA 2VEIA 3OJGA 2PDWA 4DELA 3GHRA 1AMKA 3KUMA 3FAWA 1FWJC 5HNTA 3HIJA 2X7WA 4MLJA 3BQ5A 4X63A 1NWRA 1A5AA 4AHPA 3COTA 3F4VA 4MB4A 4D6CA 1CDGA 2ZUNA 3VD7A 1TPEA 4ZB0A 4WDUA 1RCOB 3RX3A 2X1IA 4DWSA 2A3BA 5CZSA 2HRWA 4BQ2A 5JXQA 3E1F1 1XGEA 5E9XA 2EEXA 4Y8EA 2VHLA 4WJ8A 3BW2A 1NDWA 4UUIA 4A3UA 4AXKA 5I3KA 1SO6A 2Y8KA 1E4MM 4C6DA 4E5TA 1XSIA 4HMCA 3VKBA 2CHRA 3PPHA 3L0KA 1E0WA 2PDNA 3FDGA 1W3HA 4G1KA 4WLCA 3T1GA 5FF0A 1L2QA 4ERGA 3S1VA 1U5VA 2EXOA 1IEXA 4AY7A 1UZHA 3ARWA 1EYEA 1PTGA 1YDNA 5CZTA 3MSRA 4OGZA 1A5MC 3FYPA 4PYSA 4DWSD 1CGTA 3P0WA 1L6YA 2H6RA 1ODUA 4N0RA 3KDNA 3CV7A 1WZMA 4W85A 2OGJA 2J13A 1S5NA 4NAEB 4BS0A 5CZKA 1FH7A 4KERA 2E5CA 6XIAA 4UFLA 4Y9OA 3RJYA 2Y89A 3VDGA 4O13A 4UTJA 1SZFA 1E5NA 1EC9A 4L56A 2OLAA 4F0KA 3HURA 4R5EA 4CQ9A 1MQPA 3UR7A 1VD6A 4W8AA 4FNSA 1QNRA 3HPFA 4D6DA 1K70A 1V0LA 4WKFA 2EO7A 4O14A 1AODA 2A0NA 3WDQA 3L4UA 3EWDA 4FLSA 1GQLA 4CCCA 3LOTA 4PTNA 3U5YA 5FL1A 1KGXA 3UG4A 2E7FA 4JTAA 4QSHA 4DM1A 2ZZ2A 3LLXA 3UWYA 3VDCA 4GZEA 2XZ9A 1M7XA 3WYZA 1K3UA 4RJEA 1MW2A 3NQVA 4FIQA 3TE9A 4PC8A 3CGTA 2V3FA 2Y1HA 1BEUA 5HWMA 1TG7A 2G3FA 3W00A 1CWYA 4ICCX 2W91A 4CD7A 3P80A 4S3CA 1OVDA 5DRIA 2BXYA 8CGTA 1F3EA 3K5XA 1ONRA 3LK6A 5CZJA 1A50A 2VR4A 1I45A 5HMFA 3GZ3A 1OX6A 4ZODA 1MZHA 3CK5A 1L6GA 4RZ5A 1LOLA 1NDZA 2CYGA 2QV5A 2C16A 3FYYA 1SVDA 3W2LA 1PSCA 2QUMA 2CU0A 3UFYA 2BSLA 2BV9A 1AVAA 1LORA 3WJYA 1DJZA 4HHPA 1U1JA 2VD8A 3VPLA 3F2BA 4B5WA 4PCSA 1QPKA 5FJOA 4LUYA 1RD5A 1W3IA 2G96A 3EDKA 3VDAA 3E38A 1A5NC 4HK5A 3AWNA 3AXMA 1D3GA 2DZTA 1YBQA 5FJJA 1D7KA 3WD2A 1YNYA 1QHOA 1RSCA 1KBKA 3SI9A 3WDIA 4ZB2A 2QCCA 2OYLA 4MDPA 1PZ3A 3VIMA 2RFGA 3NQCA 3GAYA 3WL1A 3P81A 5HNNA 3VAVA 4RNFA 1NVMA 2OZ0A 2CLOA 3VGEA 1U2YA 3FGCA 2AMXA 1EKOA 1FP9A 4A35A 4JTDA 1BYAA 1TA3B 4LBUA 4AVNA 4UTMA 3GXMA 3N9SA 4PB3A 2F9RA 2PSNA 1UZ1A 3NXFA 4J35A 4IP7A 3KLLA 4A2SA 2WBGA 2V30A 2NVDA 1DL3A 1E56A 4RR4A 4GE8A 4X0NA 1CXIA 4ONVA 4ERIA 2QUUA 2OCZA 3W1RA 2ACUA 4EXAA 2ZQ0A 2VX4A 1XISA 1JAKA 4E2DA 1G4TA 1P0KA 3FN9A 2ZUVA 5C71A 3GVWA 3CL6A 3NSXA 1VEMA 1KFEA 3TN3A 4AD4A 3H12A 4CCDA 5C2XA 1OZMA 5FJPA 3OG3A 3D6NA 3NZPA 2QNEA 2ZTJA 4PMQA 1VEOA 3FAXA 4V15A 4AIOA 5A2CA 3TC3A 2B0MA 4DZHA 3WQOA 2FB3A 3IJ6A 2W79A 3M5YA 3G1RA 5A6KA 2VQUA 4EF8A 2YGYA 1UUOA 4URIA 4F4RA 1P0BA 3SN0A 7XIMA 4QG8A 3BLKA 1W8SA 1GUVA 4BEQA 3O9NA 2YZRA 4LVFA 4AYSA 1XYFA 1KLYA 3D3AA 5AECA 3TMLA 1X98A 4YWIA 3H7UA 4YCPA 4S1FA 2I17A 2VURA 5ENLA 3N6JA 2ICSA 4H7ZA 4OV9A 4GK8A 3FFSA 4JTTA 4S2BA 4MFDA 3LI1A 3PBGA 5M3WA 2HE8A 3L7RA 1IE7C 3MVIA 2I5GA 4PR4A 1GYLA 1O5QA 2PWDA 1EJVC 4BA0A 3JU2A 3NDZA 1JZ2A 1W91A 3WLRA 5HXMA 2WVVB 4UQ9A 3GNNA 3T07A 2P88A 2CFFA 1UH4A 2Y6ZA 1CX9A 4NP7A 3PJXA 1FBAA 3YPIA 4P7LA 4ZOCA 4J3XA 2EKGA 3NIYA 2CZVA 1KFCA 1FFRA 3B8DA 1UQZA 2QCHA 2J79A 3E74A 4D2JA 2Z4GA 4ZQOA 3NPWA 5FA5A 4ENLA 2VD9A 4M6PA 1MUWA 3INPA 3VZXA 4LUSA 1K1DA 3NOYA 1P0EA 1UCWA 3OVPA 3R1ZA 4CNNA 2W3ZA 8XIAA 2J8TA 5HPCA 1YNPA 3T4CA 3EXSA 4EWJA 4KWOA 3THCA 2J8FA 2ZZ7A 3U57A 3EDEA 5FESA 5C2CA 1S46A 1VFFA 2POZA 4A29A 1TVNA 2FHFA 3B9OA 2NX1A 3ARTA 2LLEA 2O7QA 1YTKA 4MPKA 3FSTA 1SU5A 1DOSA 4ZSUA 3E0WA 4FIRA 5DBTA 4LSBA 3WF2A 1VFSA 3WQPA 3KVKA 3AROA 5CJMA 2HK1A 3SCNA 4R88A 2WPGA 2HJPA 2VC9A 1TPB1 3FS2A 4FPSA 3I3BA 1V6WA 2NZLA 1FRBA 4BY3A 4PUEA 1NOUA 1A4LA 4V28A 4Z2KA 1W17A 1G7UA 3IANA 4GI8A 3W53A 4PUJA 2GJPA 1TV4A 2I16A 5KEZA 1RXOB 5JH2A 5G1MA 4DYEA 3ZLGA 3BMXA 2P10A 1JD9A 4G2DA 4QLKA 2PGRA 3OGRA 1AJ0A 2QEZA 3UWVA 3LXBA 2FB2A 1KD0A 3SIZA 4NYUA 3G0UA 1E6PA 2J8GA 2NT0A 1FHUA 1XHGA 2R8WA 4NQ1A 3N4AA 1VFLA 5C2GA 3M16A 1E5JA 4GCAA 2VT0A 1WOBA 1K7XA 1UR0A 3QR3A 3WD1A 3M0KA 4HHHA 3R10A 4M7SA 2CITA 3EKLA 5D9MA 1LDCA 4GVGA 1HIZA 3QSTA 1VP5A 3MYOA 3FSUA 3WJXA 1PAMA 3QYQA 2OYMA 4RDYA 3TTSA 3O15A 3G24A 4K2SA 4Q4SA 3EWCA 3N2XA 3ARUA 4MY8A 3PPCA 4WSHA 3M6DA 2ON3A 4HPXA 3TV8A 2E6YA 1FWWA 3BTNA 2FDSA 4LYKA 3AXHA 4ZO8A 2GJXB 1MI3A 5DMLA 2JIWA 1OJXA 5FACA 1KRBC 1AD4A 1W3NA 2X30A 1JUBA 1PIFA 4X3ZA 1AQMA 3QTPA 4LUTB 1CXHA 3LN3A 5I09A 3BAYA 2PODA 2WJDA 4R27A 2PGWA 1SO5A 1A49A 4JL1A 1RUSA 2VC5A 3S6DA 1B3YA 3IARA 4I9MA 4HYVA 4JNYA 1PE1A 5HJLA 3E12A 3VNIA 5EMLA 3DESA 4IF2A 4XX6A 3VCNA 3C6CA 3E2SA 1B4EA 3QZAA 3AWOA 5HJXA 4A8IA 3BZJA 2OEJA 1DJNA 4LS0A 4S3GA 3CWHA 1ISYA 3IIXA 4MJZA 3W87A 1T8QA 3CLMA 1J0KA 3H4XA 3R0KA 4AEOA 4L1WA 4W5ZA 4ADTA 2V82A 3BSHA 4F9JA 3UG8A 3THDA 2B7NA 1F8IA 1LL7A 3GW3A 3VX1A 3NOEA 4O10A 1YNQA 1QCWA 1NFGA 3BLOA 4TVUA 3FYOA 1FCVA 3FJ6A 3SRKA 2VNCA 3I3EA 1JQXA 4PBFA 3THAA 1ZBCA 3LLFA 1J12A 1OCNA 3V75A 1BG4A 1VHCA 3CZKA 1V51A 3G22A 5IBXA 3OHMB 3F2CA 2G0WA 4Z1BA 2DORA 4UFMA 1GKRA 4GQBA 3KWSA 3GXNA 2VWSA 2OPJA 1TUXA 4LBSA 2A79A 1EP1A 4P8XA 1TWSA 1Z44A 3KE0A 3MI3A 3ZT6A 2PTZA 3PZIA 4R53A 2J47A 4B15A 1GQKA 3MO4A 3WK2A 1V7AA 1HJWA 4XK2A 5CPNA 3ERPA 2CHOA 3DIPA 4FNUA 1TV3A 3N2OA 3GBDA 1KXQA 3XISA 1G9HA 4H2CA 1UPMB 2R1NA 4DJFC 2R91A 2HPMA 5GNZA 3ZVIA 1I9CB 3ANVA 3GDRA 3PTQA 3R4IA 1VBJA 1OC6A 2J7DA 2Y8UA 2ADAA 4DJEC 3BLDA 4DYJA 1ZB5A 5LNWA 2GPTA 4DIAA 3NYZA 3W7KA 5LGZA 4PMUA 2HV5A 4WGHA 1E1CB 4QG9A 3WQ5A 3ZMRA 3PZGA 1ZAJA 5GPRA 3STPA 4F48A 3WFZA 1TWDA 3CQJA 1HJVA 3TZNA 4US5A 3N19B 1ZCOA 2HPIA 4LBRA 3BL3A 2D3NA 4Y9PA 3TUUA 2P8BA 1Q7QA 2FMNA 1VCFA 4W84A 4Z2GA 4WD0A 3LU2A 4XBKA 1VRXA 3LERA 2PDGA 3RRAA 4EPDC 1HG3A 4MY9A 2ZZ3A 3S9IA 3ORWA 2C6QA 4B5SA 1EPXA 3O7UA 4JQ2A 1GTHA 4C6LA 1B9BA 1FCBA 1A5OC 1XSJA 1Y5VA 3UP8A 2D24A 2FZ8A 4E8GA 3NL2A 1SMAA 4Q8OA 4LF2A 4ZQCA 4AF0A 1OGBA 4MPQA 1JIBA 3TAKA 2RGLA 3DI1A 4US5D 3TAOA 4OBRA 3CPRA 4HTYA 4E2VA 1KLZA 1X6LA 3SRFA 3VKDA 1R7OA 5IXEA 1NFPA 1XLCA 1KQZA 3P6LA 2WMKA 1QW9A 5EL1A 4CD6A 2QDEA 4N9EA 1PCKA 4M8UA 2YCLA 3G8RA 1T6MA 1RR2A 1IHIA 1ECQA 1KCLA 1H41A 1OX5A 3BW4A 3MW7A 1VCGA 2J88A 2PP1A 1XRTA 2GVGA 3N6QA 3KAOA 4XAZA 4M81A 5D05A 5EMMA 1XS2A 1R46A 1TPH1 1FWBC 5JVLA 2W67A 3V5CA 2C19A 1VAHA 4TVCA 3CV2A 3QOKA 3GXIA 2NVCA 4P2VA 1HJUA 1XDJA 3W2JA 4K8EA 1XYLA 3O06A 1AK5A 4O0QA 3PBUA 3AICA 4GC4A 3E96A 4HA1A 3PAOA 2OX4A 2DJXA 3GG0A 3SIMA 3I3DA 4CNTA 1LWJA 4K1WA 5AZ1A 1QNOA 4G9PA 4DN1A 3PUGA 4EPEC 1FWGC 2G3JA 2J24A 4YU1A 1LWIA 3B97A 4Q6XA 5BU6A 1X8CA 1RQEA 1HN1A 1OGGA 3WNMA 5FSDC 4LC6A 3O05A 2KX9A 3DZ1A 2NV2A 4Q33A 1ZS2A 2WSRA 1P7TB 3WL0A 4XZIA 4UB9A 2V3GA 4XUGA 3PUEA 2YYUA 1R0MA 3WDPP 4CD8A 1ITCA 1FCQA 2WJFA 1NF7A 3L68A 5F4WA 4X60A 2WV8A 2ALDA 4JIEA 3MT1A 4HGXA 2VFFA 3PM6A 2DSZA 2ZA2A 2WO5A 3OZMA 1BYBA 1UR4A 3REQB 1UP2A 5CPSA 3PG9A 3NM3A 2QIWA 4K39A 2E6FA 3IK2A 4WF7A 4UMCA 4HNNA 4IJBA 1UD3A 3NZGA 8A3HA 3TCSA 4LYQA 1EF2A 2Y24A 2GGEA 4TMCA 2FHCA 3MY9A 3MP4A 4GINA 1TPVA 2VDHA 2HBVA 1H60A 2EG8A 4JX4A 4GUJA 3C0JA 3DG3A 1F61A 1J96A 3LDVA 3CM4A 1HX0A 3NPXA 3SURA 2F2HA 2RGMA 3MI2A 4EPBC 1ELSA 2CLIA 4K6AA 4MADA 3M0LA 3VA8A 1K8CA 2Y0FA 5FF3A 1JDAA 2WOQA 1K6WA 1KTBA 2OO6A 3M43A 1QI5A 1T96A 4Z2JA 3LRKA 3CYJA 1WV2A 3CHVA 3A12A 2PDPA 4Y9MA 4LFYA 2PF0A 1JCMP 1G4EA 3NCOA 3PP7A 1WKFA 1CZ1A 4L4OA 2A3EA 2XGIA 5HULA 4U3AA 3NPUA 1TR9A 2UY3A 4LCQA 5C9WA 5DQPA 4GX8A 3W02A 4GBDA 3QJAA 2OU4A 1GW9A 2PMQA 3T0CA 3HB9A 4DI9A 4JQAA 4PTVA 1T41A 4X0VA 4ROPA 3GY1A 3UCDA 4QJ5B 3ZLHA 1EDQA 1XW8A 5FJIA 2XIBA 3EKGA 4J4KA 3KRZA 5JBEA 4M3PA 1W9XA 1GVFA 4AQLA 3JRKA 3V35A 3GO2A 4FK9A 1CENA 3BANA 2PTYA 4NAFA 1Z6KA 1JJKA 4NASA 3ZS4A 2W0UA 1VBGA 3S5YA 3CUHA 3TQPA 5LNUA 2HROA 1QFEA 3AHVA 1LBLA 3WMBA 3ZYZA 3RXZA 2ZWYA 4JHZA 5CSSA 2Y7DA 2D0HA 1UJQA 3HPXA 2J9ZA 4Q3MA 4XWUA 2YXXA 3WIJA 2XVNA 2DQXA 1AZ2A 1RALA 5FAJA 1L9WA 3GR8A 1J6OA 3W76A 2FZBA 4IMDA 1TR1A 4AX6A 4B3LA 4MAVA 4Z1YA 1W5OA 2CNCA 5CC7A 3E02A 2J7GA 1Z48A 5CLTA 3P74A 1QNSA 1ZJIA 4MKNA 2F2KA 4Q4MA 4JPGA 1D2KA 1BAGA 4O8AA 4UTLA 5D8WA 4F0MA 3AOFA 3ZJ7A 2H3BA 1MFUA 4KFNA 5KITA 3W23A 4JGDA 1OG0A 3P7YA 3RM9A 4DXVA 4PL1A 2W6RA 4ORIA 3GD6A 1F7BA 3JZEA 4L9ZA 2F6UA 4UOJA 2BGQA 1FY6A 2JKEA 1POKA 1EDTA 3U2EA 1EJSC 3E5PA 2QULA 5I6SA 3AHXA 2TAAA 4UOQA 3EA2A 4DLMA 3PN8A 4DBEA 3IUIA 4E3VA 3ME3A 4ECLA 3WD0A 3FGCB 3ARXA 4ADUA 4F40A 3EOEA 4GJJA 2ZXQA 1OF8A 4L1XA 1WAUA 1QK0A 1O1ZA 3EWBX 4ZTYA 3B3DA 4K37A 1Y7VA 2B4GA 5ABGA 1TO3A 1DWGM 3DHDA 4UZUA 2DDXA 1KFKA 1O94A 4OU1A 4BKNA 4KH2A 3UG5A 3W81A 4W93A 3CAWA 1TJ0A 4N7QA 3VTRA 2V0TA 1QU4A 1F8MA 3EMQA 3UXDA 4FSAA 4ZR8A 2QXWA 3BK0A 4MZ8A 3GS6A 3QXBA 3WO8A 4Q32A 7ODCA 3D46A 2WVUA 3BUVA 5TBOA 1SR9A 3TYEA 1SW3A 4CN1A 4NZCA 4AC7C 4F79A 3UT0A 3OA3A 1R9YA 1Z89A 3MB9A 1UZDA 4QLJA 2JEQA 1E70M 3D5HA 1EWDA 4RDZA 1TUFA 1AL8A 3W82A 5KZDA 1SJCA 3E0IA 4H04A 1JPHA 4JBRA 1E0UA 4LVAA 1QI4A 1EXPA 3H8AA 3OIXA 5K2ZA 3HG3A 4K8GA 3QR0A 1GKQA 1CLVA 4UQDA 3M7WA 3IUDA 2V3EA 4QAWA 3SUWA 3O07A 4OBTA 4MUPA 1QAPA 1W3TA 3M41A 1MDLA 3SGGA 3RMEA 4X22A 1VKFA 2BHUA 4HCDA 3R0UA 4DNMA 4DBUA 4IIDA 4OUIA 1W56A 1A4MA 2GZXA 4GG9A 3PBWA 4KFPA 1BYDA 1EL3A 2JKAA 4GO8A 4QTGA 1RQHA 2E5BA 4EANA 3G77A 1LM1A 2YA1A 4MG4A 2EQDA 2HS6A 3U2CA 4KGJA 1GPFA 3FX4A 3II1A 3MBFA 3RRXA 3T0TA 3PSWA 4C1KA 2X1UA 4RPQA 2WVTA 3MU7A 4Z42C 3K1GA 2YCJA 2X0HA 3ICJA 2I9EA 4A8NA 1AH4A 1E1FA 3GR7A 3APTA 4M1BA 2Z0IA 1BF6A 3N17A 5FEZA 5B80A 3CMGA 2XISA 3L2MA 1CGWA 4B5NA 4MYAA 4B91A 5A1AA 3RK8A 4AEEA 5CPQA 5HMDA 3B0YA 2QMJA 3WY1A 2Y62A 2C7FA 4CVUA 4J3ZA 2R9RA 4LUSB 3BGAA 1TV7A 4WY0A 1K9EA 1KGUA 2O55A 3EWYA 1KM4A 1ZJBA 3L65A 4C7FA 1POJA 1PX3A 2J66A 4PH6A 4QJ4B 1XIGA 1FWRA 3V0UA 2NX9A 2XUCA 4DO4A 3LBOA 5F4SA 1XCWA 2V5KA 1SM9A 4KEUA 2AAMA 1WNOA 2OKTA 1DIEA 4JCLA 1W37A 3QC0A 3RR1A 2EPHA 1FDYA 1EWEA 2CZDA 1DIKA 4UCGA 3VOFA 3DX5A 3MMDA 3WF4A 1KM3A 3WKZA 2QCNA 1ZBVA 3VFCA 3M5XA 1J93A 3QFEA 1JAEA 4JQ4A 2ZVIA 4IGSA 2CWXA 1DTNA 3W1PA 1FWSA 2VFHA 1EA9C 3AMKA 5PTDA 1FHVA 1Q6LA 4ACYA 3PNUA 5DN1A 1TWIA 5E09A 1H62A 4QAIA 4I8DA 1E0XA 5DEZA 2BY0A 4Q4RA 3QGVA 3WH5A 1K7EA 1QWGA 1ITUA 1NP0A 5BZAA 1IXOA 1EP3A 3GTXA 1OFBA 4IP5A 3BH4A 3Q4DA 4KBXA 3WUGA 1DQXA 2HXTA 1MW3A 3A3WA 3C4UA 4MB3A 1JNEA 4B2DA 4I5RA 6ENLA 1R3YA 3QZEA 3DBPA 1UKPA 2WB5A 2J75A 3M9YA 1GVIA 3QKZA 5A6BA 3FXGA 2PWEA 1EO7A 1KXHA 1R9ZA 1IXNA 4C90A 4AAJA 5EFDA 2V38A 2VGBA 4OZOA 1XLEA 4YYFA 1C8XA 1E6ZA 5H8MA 1U30A 3W2MA 2PU0A 4P7OA 1EGZA 3UETA 1CCWB 3MWCA 3AU6A 2J77A 2BDQA 3W1AA 4B2DD 1NOWA 4NIRA 3P62A 1RY8A 5F1VA 2V5JA 2PCEA 4A2RA 3T78A 2DIEA 1UP3A 3GNOA 3C0QA 2HBXA 1IF2A 4I9AA 5A6BD 3TTOA 2FLIA 3H54A 2PE4A 2ZA1A 1QHPA 3K46A 4GY0A 4O1BA 4OVXA 3WD4A 4XTIA 3BGJA 3RLGA 4U5IA 1WPCA 5D8ZA 5HJYA 2NQHA 3E5BA 3T40A 2ZXBA 3CL7A 3SCRA 3LPPA 1W1B1 3PPGA 4AZIA 3EWUA 1R5YA 2QPUA 4UQBA 3N9KA 3TSMA 3PWAA 5LA0A 5BMXA 3H22A 1XRSA 2RDWA 3AIQA 1VCVA 1Q6QA 1F3TA 3VDBA 1S2VA 1S39A 1KWKA 2I56A 1E9YB 3WJZA 2XH4A 4CU7A 1K4GA 2HTMA 4PB4A 4WY0F 3SY8A 3IJQA 4IPLA 1XG4A 4O12A 3B0VC 4P7NA 4OTKA 1GVYA 1F9CA 2J6XA 3A21A 3WQFA 4JICA 1WP6A 3GDMA 2RHGA 1JGIA 2VRKA 1PZ1A 3E0FA 2WC7A 1JG9A 2OSWA 3ALGA 1TCDA 3IAQA 4AY1A 4NJJA 1BVNP 2YW3A 5CQ1A 1Q4NX 4EIVA 1D9EA 3V0TA 1QATA 7A3HA 2BS9A 1Q8AA 2PTXA 3V3WA 4NZ1A 5M03A 5CXPA 1XLIA 1TREA 3HMCA 2OZ3A 4IX0A 3STGA 2XVGA 2XM2A 3ABSA 4YWSA 4DRSA 4GVIA 3RCYA 3E2QA 1F6PA 3M5ZA 1NWTA 4FF5A 4JFUA 3GVQA 3BVJA 3CB3A 1DHPA 5LIXX 4C65A 3EPOA 2J74A 2PLKA 1PKMA 3AI0A 1SW0A 3S1GA 1UD6A 3F4NA 2TMDA 4S2CA 4AHOA 1Q45A 4FI4A 3THUA 2CHNA 1HKWA 2GVJA 3DN5A 3BOXA 3K13A 3CNYA 3UGRA 2WZHA 1ZY9A 2V3DA 2NQ5A 4J2MA 3G6LA 2Z1XA 2VC7A 3CWOX 4HQVA 3LY0A 1OB0A 1JZ8A 2XPKA 1RPKA 5AHEA 3IIZA 4DNHA 1KNWA 2HZGA 2VZSA 3R0DA 4B90A 3WNNA 2DY3A 4UQEA 1W5QA 3MUY1 5CAKA 3S46A 5HK4A 1T0OA 4UR8A 3QLLA 3LPFA 4PUDA 4R7JA 4RE3A 3PR2A 1NSJA 3W1TA 4IH3A 1HVXA 5T8GA 3NNTA 1F4HA 2CKRA 4LVDA 2VCBA 3LHYA 2PTWA 2WMHA 1QASA 2ZZ5A 2E3ZA 2VEMA 3A6OA 3KZSA 2PCQA 1KM5A 1TPUA 2BXZA 4I7VA 1GKPA 5DRCA 1EHAA 3EMZA 3HV9A 4AF0B 3EB2A 2YDQA 3K2GA 4MJ4A 4PUMA 1H7WA 4NJKA 2ZWZA 1SFJA 4XVEA 1OX4A 3Q58A 3TDFA 2PP0A 4FX6M 2Z1BA 3HGJA 3POHA 4O0ZA 2ACQA 1C8VA 2EAWA 5M17A 3PWIA 4OHQA 1DWFM 1WB0A 1XJBA 2E0PA 2W63A 1R3QA 1S1PA 4H7VA 4PSRA 4AYGA 2CZ5A 4D8LA 2QMKA 2BHZA 4HNUA 4ZEPA 3ZJ8A 4C1NB 1QPQA 1JXKA 3W1MA 1GOXA 1GVRA 5D32A 1J11A 3V1HA 2BOEX 3GUGA 1QJWA 1DJWA 1NEYA 3OIHA 1LT7A 2PU1A 3LTSA 1UUQA 3W83A 2FZDA 4AHQA 1K8YA 4U33A 3VOIA 3O8AA 4XO6A 2VGIA 1JNDA 1BKHA 4IP4A 4XTDA 1OD0A 3BLPX 4FAMA 4XIMA 1E4NA 1L8NA 4REQA 4INFA 2Z7KA 1ONXA 3V1PA 2CIPA 1LL4A 2XWEA 3PG8A 1E4LA 1V0KA 2VGGA 3WENA 3TA9A 3F03K 1J5TA 3L21A 3KOXA 2E9LA 3CUJA 1N8WA 2WHLA 1ICSA 4OBSA 3DGRA 1GEHA 2C15A 1SUXA 5JBDA 3T6CA 2ZZ1A 3CMJA 3TC6A 2CCRA 3QHMA 2ZA3A 4M5PA 2YYTA 2WMIA 2ZDRA 3HMJG 1V7YA 2QDHA 2BVDA 3BG3A 4QBXA 3LNMA 2BFGA 3IVSA 3R8GA 1P0NA 2ZC8A 1ZL1A 1YRRA 3S2CA 1O7AA 1X96A 2D20A 2E77A 3CEPA 2ZRYA 1JRCA 3G1SA 3VNZA 1EX5A 2QZRA 3EX2A 3TCEA 3N73A 1AJ2A 2XVPA 1BHGA 1UZ4A 1HF6A 3WH9A 4GIRA 3PZQA 4GZIA 3XIMA 4B3ZA 1M1BA 1RQBA 3QSRA 5AYIA 4D6JA 4L7ZA 3DGBA 1C93A 2GSJA 3MCOA 3OB8A 5T91A 1K02A 1QI3A 2W9MA 1LF1A 1XPYA 5XIAA 2IUZA 3LGDA 3LCLA 3UYCA 1KO0A 2FH8A 2GSHA 3UYIA 1W9BM 2UV8G 4IMFA 5AYZA 4XB3A 1G94A 4XZNX 3VNKA 3KBVA 5FKYA 4WEVX 2P1FA 1GYMA 5HINA 1PO9A 1BXNA 4ML4A 3BCJA 3H4WA 4QLLA 4MWAD 3PB2A 3CLWA 2YB1A 4DUXA 3TQ0A 4GFSA 4HA3A 2GFTA 1GJUA 3E9AA 3U4AA 2X40A 4JS3A 3P60A 1OABA 1Y0EA 2Y4SA 2ZE3A 3EOSA 3EWZA 2ZX5A 1EGVA 3NWRA 2ABBA 4D8AA 3F4CA 1TPFA 3L2IA 1LQ0A 5C9RA 1VLIA 2INFA 4HNOA 3H2MA 2VZOA 3ZIZA 2Z26A 5TF0A 3SW6A 3UZZA 1XXXA 1EO5A 4B4HA 1FXPA 3VNYA 3B06A 5HDRA 4C7GA 2V67A 3H24A 4Q4PA 1ZFJA 3NUKA 3C5QA 3ES8A 1TVLA 3VCRA 2AKZA 4Q6JA 1DEDA 3I68A 1T5AA 1TWZA 3C2YA 4J3SA 1FWCC 5C9ZA 2PRMA 3M4HA 4E4UA 4X2PA 3N2MA 3EA1A 3R5EA 3VD4A 1ZCCA 2VR5A 1J0YA 3W86A 5DY2A 3GHUA 1HVQA 7TIMA 4HOWA 2V68A 5CG0A 5CKSA 4ADSA 1B90A 1A5SA 2Y63A 1DV7A 3E2RA 4N9DA 1HKKA 2QJGA 3V0SA 1OYBA 3I10A 3ANUA 3IGHX 3DH7A 4Q4KA 2OOFA 2PLJA 4TX8A 1K9DA 5EPDA 2P50A 4Q8TA 5HMEA 3AYTA 5HBFA 4JNMA 1IT0A 4ZB5A 1IGWA 1O1HA 1U33A 3T2OA 4U28A 1UR3M 4J2PA 2QVHA 4RE0A 3ZR5A 1UWQA 4M56A 2DSWA 4K7VA 2E25A 3HG5A 4K7YA 1E6QM 3EDJA 3O2LA 6CGTA 3OBEA 3OW1A 3BOLA 4C6IA 5A3HA 3NFUA 3AU2A 2AL1A 3TK7A 1S2UA 3VK5A 3QLDA 3GQYA 2VZTA 5D9OA 4J3WA 3QR1A 3STEA 2PDCA 1L6SA 4QX4A 2JGQA 1KXVA 4RDWA 3MCNA 3CUGA 3KOFA 4E3TA 2HDJA 3AHZA 1E6RA 3UR5A 5DT7A 3MUCA 4HPGA 3I6RA 1J0IA 1MXSA 3LHUA 2VCCA 3NYDA 1C90A 3AS3A 2AQVA 2QUNA 5EMUA 1UBSA 1VRDA 1YDOA 3UWEA 3G1DA 3URQA 5C55A 5D9NA 3T7VA 4MVAA 3BJSA 3W01A 1X8FA 3M0XA 2VM8A 4JX6A 3JZUA 1LQAA 3KFTA 5CC6A 4WUIA 3HU7A 5D38A 3TJXA 3A9BA 5IHRA 3AMGA 3IJIA 4N6FA 3G1AA 3MCMA 3KW3A 1C9DA 2DZWA 3H4GA 2IQ0A 1I2OA 4AZBA 1XUZA 3UJFA 5I23A 1OF6A 4LXFA 3WLKX 1UROA 4PMXA 4TMBA 3SADA 2VDGA 3ITGA 2NQJA 3CZEA 3SCTA 1XPGA 3A47A 1LWHA 1ICPA 1W1TA 1REQA 4IMEA 2RDTA 3A5FA 3LCXA 2NXGA 3R11A 4JKMA 1FWIC 3G0SA 1OHLA 1BXCA 1FWHC 3ARQA 1KV8A 3M0VA 4DXKA 1B54A 3SCPA 3UESA 4PMRA 3WD3A 1GONA 4TVDA 1TJ1A 2A4AA 4JTJA 4X61A 3OZYA 4KW2A 5LNVA 4FOKA 1I1WA 1XQKA 2BY3A 3ZR6A 3W7QA 1XLAA 1GK8A 1IR2A 1O5XA 4LNYA 2AQWA 2QW5A 3G1VA 3F2DA 4MB1A 4Z1DA 1WCGA 2YL6A 3FXYA 3LS9A 1W1VA 1LTDA 1FP8A 1TCMA 2PUZA 1M03A 3QGAC 3K1DA 1RBOB 4CLMA 1EUNA 3DKLA 1DORA 3P67A 2BASA 3TU9A 1XD1A 1F5ZA 5AOUA 3FCPA 4DBDA 2BTMA 4IICA 1TWWA 4ILSA 1O5KA 2WK2A 2XSAA 2B7PA 1OEPA 2DT3A 3GAKA 2FKPA 4WCJA 2PDQA 1O5RA 4NL1A 3S2JA 2V69A 3S1WA 3OA5A 1ISWA 1LRQA 1MQQA 1VFTA 5TD4A 5AYBA 1V08A 1GZ1A 4XVDA 4LNCA 4KEMA 4QHRA 3BQ6A 4H9YA 5DY3A 3SDOA 1UOZA 4QFUA 3NQMA 2E28A 3RPDA 1DJQA 3W1XA 2VUNA 4WXZA 1EQCA 2FQIA 2FVMA 4AU0A 4JIPA 3MUAA 1TV5A 1CTNA 1VLWA 1PHWA 3GXFA 1GYNA 1NH6A 5LSMA 4O53A 4AIBA 1Z3NA 5HPOA 3GNPA 3IK4A 3TR2A 1LRTA 4EVZA 4YIWA 1HKJA 4YVVA 5I06A 1A5KC 2E9MA 3M46A 2VWTA 1R3WA 4ICNA 1OWQA 4HSNA 3NO1A 4MTVA 1YEYA 1PZ2A 4QGCA 4I5XA 3LYEA 4WR3A 3DC0A 2FMOA 2G8ZA 2QJJA 4GACA 3DFYA 3W70A 3O0FA 1XLMA 4ZE4A 4KIRA 4MJMA 1ZJHA 1K7FA 2QCEA 1FUYA 3N04A 1JDFA 2FVLA 5KMYA 2XIOA 3WX7A 2F84A 4JQ3A 5DELA 3KZPA 3A4XA 2C71A 3VIKA 3CO8A 3WJWA 4RZBA 3UZWA 1S2TA 1BLIA 3ZVHB 4H83A 1JVNA 3R25A 9CGTA 3LBCA 3CL8A 3CAQA 4OFCA 3CZLA 4IGHA 4LGXA 2OT0A 3BG5A 4V2XA 2O0TA 1M01A 2QIIA 4TUFA 5CBIA 3WG6A 2WJZA 4JTQA 3ZQ9A 2Z25A 1IQ8A 1XUUA 3NJ3A 4GQQA 1J79A 4K36A 3UY7A 4JDBA 2IPFA 2FZNA 1OFOA 3TW9A 2QF7A 3KWXA 3W7IA 1V5XA 3AMDA 1QNPA 4DF0A 2FPVA 3CUXA 3P93A 4PB5A 3S9YA 3UXAA 1FWFC 3GH7A 1GZGA 2YDSA 4MOZA 1IXPA 4ZGYA 2RDUA 3NXLA 4IFKA 2FFCA 3BAJA 1WDQA 3N29A 1DTUA 2RDXA 2OT1A 2E68A 1SFTA 1Q6DA 2PB1A 1HO4A 3EPNA 4UTTA 1WO2A 3W1LA 4F2BA 3NQFA 4PRTA 1MSSA 1R3VA 4HNLA 3WQ8A 3WLHA 3TOYA 5BXRA 4HIBA 1PIGA 4H4IA 1SJBA 1KTCA 4GIEA 1R9XA 3R89A 2PF8A 2O56A 5AVNA 3TVAA 4DJDA 1FWDC 1P1XA 5F2IA 4MGGA 3I6EA 2R14A 3SCOA 4ACZA 2A6LA 2DZAA 3FJ4A 4JYDA 1MNZA 5AYXA 1R7AA 1XI3A 4QR6A 5DLCA 1H51A 1DWIM 1R30A 2C1GA 3KCLA 1U83A 2VEFA 3DBNA 3OODA 1G7VA 4JAWA 3DC8A 4RNJA 2IQDA 1IWAA 1KKRA 2QLYA 1M04A 5A8OA 2OO0A 3WEZA 4CCZA 3GNXA 4JYEA 6TIMA 5I77A 3SZ8A 2D0GA 1GQIA 4GZ7A 3LENA 5BXSA 1XRFA 4WGXA 2AGTA 4MMWA 4IPJA 1GJWA 2FJKA 3MJMA 4OQVA 1B3VA 1E9LA 1VFUA 2FTWA 2WANA 2VFIA 3N14A 4PEEA 3TSBA 2D1ZA 5DO8A 1OG6A 4HPNA 4DJDD 2HVNA 1S3TC 2RAGA 3U2ZA 3CU2A 1XDLA 1CEOA 1WDPA 4HVXA 3KXQA 4B16A 4IIEA 5CBBA 4W7WA 5BRPA 2CERA 3PBYA 3BPWA 2BX7A 1RK5A 5H91A 5D9PA 2GVEA 4NJIA 5CCZA 3BLEA 3WH6A 4FOJA 4M19A 4XZHA 1EH9A 2HWGA 2J25A 2XH7A 1BFNA 1NDYA 2QCDA 2I57A 3RITA 4XIAA 4H9MA 3MP5A 1OC5A 3WLLA 4GUIA 4TX9A 4YJ5A 4S3AA 5B7ZA 2VXNA 3F5KA 2WMGA 4J1OA 3RJXA 5CSYA 2NQLA 1ME7A 4GI4A 1KCZA 5FD0A 4JFWA 2W4XA 4LUJA 4XD5A 4A8LA 5HUPA 4F0SA 3VD9A 1LCOA 2DH3A 5K4XA 3RPTA 1X1NA 1NF0A 2PDUA 2WMFA 3WLMA 1I6NA 1R85A 1VZWA 2WJEA 2VCAA 5DX7A 8XIMA 3VXGA 3OBAA 3XINA 5T26A 5J5RA 3CTTA 5D30A 3ATYA 1YDYA 1XYMA 2R94A 5H2ZA 4LY4A 4KCUA 4LVGA 4NX5A 1DHKA 3VZZA 3UJEA 1JZ5A 3H2NA 1W6TA 3UA3A 2QYGA 2CKSA 1BWLA 3HM7A 2BNJA 3SEPA 2YL9A 2J9XA 5H1WA 3GHTA 4LQ1A 3LM3A 4NX0A 1N7KA 6XIMA 4GXMA 2C79A 1MWOA 4PTDA 4QNEA 4A3QA 1TIWA 3HQ1A 4KGLA 3M0JA 5K3VA 3UWWA 2YCEA 1AJZA 4AB4A 3EX4A 1XIEA 5LHEA 2ONEA 1S2WA 3UNDA 4RCXA 3I4KA 3NEVA 3NTYA 4H6QA 2VFEA 1CIUA 2YLAA 1JPIA 4JIRA 3WK1A 3C8FA 1SQ7A 2ZDSA 4ZENA 3WQEA 1KBJA 5E9AA 3LV6A 2XIMA 2MUCA 1E3ZA 5D2VA 1N82A 3M7SA 4HMDA 1HNYA 1RHCA 4R7OA 2EG7A 3BXWA 4PODA 3UZJA 4NZJA 4UTUA 5DCBA 1GG1A 4W8BA 3BAWA 4TR9A 2FIQA 3W7GA 3UCQA 3PS7A 1V6TA 5CC3A 1BVZA 1O68A 4UTKA 2ZRWA 4QRNA 5AHFA 4BWLA 1K6AA 3LQGA 3HA1A 2W61A 4KEZA 4Z08A 1J0HA 4ALDA 4YYCA 3NGFA 3OHIA 3ZWSA 2GDVA 5AC6A 1ZUAX 1EBHA 2PLMA 3UZXA 4BJHA 5J04A 2PFHA 4GD0A 3FJLA 4DYKA 2PWUA 1XLDA 3U8GA 1DJHA 3R12A 2ZUWA 1IV8A 3C56A 3T0DA 3DHUA 3QQ0A 4M6QA 1KM2A 1UR8A 3TTEA 1J9YA 1LLWA 1OT1A 2DW6A 4HYWA 4QIUA 1TPWA 1G4SA 2J7BA 4YTTA 3DEQA 3QKEA 3MS8A 4XAPA 5CJ5A 1DJXA 2WLZA 2WMIB 4N42A 2HVOA 1GTEA 1WE5A 3WFLA 1FA2A 3K8MA 1I0DA 2ZRXA 3USZA 4J3TA 3WF1A 4MWAB 3VIOA 4BHYA 1GPWA 4NSBA 4MLRA 1V3IA 1TSIA 3TJ4A 4Q7NA 3IPWA 3VM5A 3H70A 3ZT7A 2XSXA 4O50A 5CPTA 3IV8A 2V2DA 3ABRA 4CUCA 2OLSA 1QNVA 1LRNA 1GCYA 5A8NA 3F5JA 1GOIA 4FNPA 4LH8A 1Z9AA 4MNKA 5EKYA 3LUTA 3PTMA 3B8VA 2QJHA 1VGAA 4RNIA 3G2GA 4B3KA 1WBJA 2CLLA 5XIMA 3WLQA 1RH9A 3ZOAA 1JCXA 1V6VA 3ITOA 2PBOA 5FF7A 5I5RA 4GQGA 3CT7A 1NWUA 1A3XA 2A2IA 1L0PA 2IMRA 4HNVA 1BWVA 2W92A 1NARA 1XH2A 3UGVA 4NZFA 3TKFA 3WMSA 3AJXA 3EGJA 4WKAA 3KX6A 4FX8A 3V5FA 1KRAC 3EMCA 4G56A 4RZ4A 5C6MA 1ONWA 4GNKB 1ZLPA 2Z6IA 5BCAA 1JZ4A 3HQNA 1WDDA 5CEWA 4QG6A 1HP5A 4DUOA 1JEZA 3N4FA 7REQB 5CG7A 3WQVA 4UNLA 3MPGA 3QW4B 1UP0A 3RX2A 3TYAA 1JUKA 3V5OA 1YXYA 1W2PA 2WPBA 1LROA 6PTDA 3N13A 4GH3A 1WKYA 1TX2A 5JQ9A 4E8CA 3EB4A 5LNSA 3BCFA 4LPCA 4IIGA 3OQ8A 3WLPA 1EOMA 4JTKA 3AUJA 3CAKA 5D4YA 3FKRA 1C8QA 3CQIA 3AXIA 3K4WA 1AUSL 3CPGA 3OO2A 4O28A 4L6OA 4C6PA 3IWPA 1P4CA 1KA9F 2JF6A 2XFFA 3AHYA 1XLLA 2X09A 2FGZA 1OD8A 1JPDX 2XINA 3M0ZA 3ITYA 5K4ZA 3TH6A 4BEUA 4J5NA 5A5WA 1XLKA 3ZLFA 1L2UA 4UC5A 3PSVA 3E0VA 1TMQA 2RJHA 5JIWA 4HHMA 2HK0A 1OGSA 4O1FA 4HNTA 3NVTA 1Q7MA 2EPMX 3CH9A 4GRSA 5E6ZA 2GWNA 4AD2A 1Q5MA 4OV4A 5DANA 3TTQA 1XDMA 5D33A 1Q6GA 2VEPA 1EJ7L 2OOGA 2YKKA 4AZ6A 3BLIA 3TP4A 3LMYA 5K7JA 1XIHA 4PA8A 3AIVA 3CBWA 2DSKA 2Q71A 1VS1A 3RU6A 4O0KA 1QW8A 4IT1A 2E1WA 3VKJA 3QTGA 2NQZA 5EB8A 4D9PA 3PB0A 1GZJA 1WUEA 2VX6A 1EPVA 1EA0A 3N25A 1VPQA 2H8ZA 4DB7A 4MNJA 4HU4A 3H2FA 3OVQA 2SFPA 5TQLA 1GOWA 3GVRA 2MNRA 2V63A 2HMCA 3GKAA 3ABZA 4XSLA 4D72A 3PK7A 2JBMA 2AKMA 3LCHA 3LTPA 4GBUA 1US0A 4FXJA 4ZXLA 4UTWC 3CHDA 1I0BA 1MMFA 4C6QA 2HNEA 2WLYA 3B9AA 4ZQNA 4CU8A 2E6AA 4W8LA 5D2WA 1I4NA 1K4HA 1VHNA 3KOYA 1C3FA 1DWAM 2WNQA 3KVMA 3MSYA 5IFPA 5A6LA 2BLEA 1QO2A 2Q8LA 5ECUA 3APGA 2VI0A 4E2OA 1ZPTA 2EGZA 1EJRC 2G4FA 2ZIDA 1ECEA 1Z8AA 1KR0A 1WX0A 4W89A 3RO6A 1XLJA 4JOMA 4H8UA 3AIRA 4JTEA 2XTKA 2BB0A 2H90A 3AS2A 1XIIA 3KBJA 3BICA 3W7DA 2TSYA 3AFBA 2QGHA 4CGTA 3SN1A 1MXGA 5F2MA 2VX7A 4YNGA 4Z2IA 4L4PA 5L9FA 1HFBA 3GWQA 4CQDA 4YPJA 3C61A 4HZ7A 1TA3A 2O9OA 2A21A 3KEHA 3FHQA 5EMYA 4HSHA 3KHJA 4GMEA 3NG3A 1AQHA 1CI1A 4L61A 4LVBA 3C2FA 2IKJA 4FNQA 4HSOA 1GHRA 1B9ZA 4ATWA 2C91A 3B4YA 4YTQA 3BAIA 1VC4A 2J78A 1H49A 1ZBKA 2DW7A 3PZUA 3LCWA 3SY1A 2C8NA 2D2GA 3ES7A 4JX5A 1U22A 3ELFA 2E8ZA 2RKXA 3S1UA 1G0CA 4BCEA 4H2HA 4JN8A 1ZRQA 4RE2A 1F3XA 1CGVA 1BD0A 3W7OA 2VQTA 1QBAA 3W7HA 2TRSA 3C0SA 1UQYA 1MYRA 4EKJA 2PWVA 1FHLA 2Z24A 2JK2A 1Y65A 4QE4A 1B30A 4D6FA 4G7FA 2Y5EA 2CETA 5BYWA 1KFWA 1VJSA 2G3NA 4ZQRA 4E8DA 3D47A 1BSIA 2PDFA 3VO0A 3IGXA 3O6CA 1LOSA 1UPPA 5J8LA 3RAOA 1S3HA 3LV5A 2VENA 4IJRA 2KAUC 2X8RA 4BF5A 4PULA 3BV4A 1N2VA 3GK0A 1M3UA 3H53A 4E6MA 1NELA 1JD7A 5FIPA 2E8YA 4P7RA 5I3JA 2GL5A 4U31A 2F61A 2WNZA 1GWJA 3QRHA 5F7UA 3GG1A 4JTGA 3RR4A 1W3JA 3OQEA 3LPOA 4JTHA 4H8VA 2G5WA 4C6BA 3KCOA 1D8CA 3N2CA 2JKPA 1XFCA 1JL8A 3L2LA 1KFBA 1KRCC 2YL5A 4Y2WA 1KV5A 6REQB 2WSYA 2Y5JA 5DXYA 5IBXC 2OB3A 3PVFA 4WRHA 3PFRA 2VGFA 3QY6A 5CPMA 1EJUC 4EWND 3TFCA 3TW6A 2J9YA 1PDYA 2VFDA 7CGTA 4QEHA 2DUAA 3TOPA 4XKYB 2X16A 2YR1A 1LL6A 3W75A 3O3RA 2ZUSA 2JALA 3KS6A 3VC5A 3WH7A 2OSYA 5BXPA 1UMYA 1A0DA 3M5VA 3KTXA 1MFVA 3CZGA 1DKWA 4ZA0A 1AQ0A 5FF4A 1Q13A 2VR2A 4HU0A 4AUBA 3VIIA 1I2PA 2W5FA 2NWRA 2Q09A 4RZ6A 5T9CE 1JRBA 1EX1A 3P8IA 2GDQA 1RVGA 6A3HA 3T0AA 3OVGA 1XIMA 1XC4A 1KCKA 2DV0A 1XLBA 3NQDA 1WXZA 2C1IA 5D04C 4LV4A 3N11A 1OYAA 2V2HA 3WH8A 3KHDA 4PCPA 4Q4QA 3B04A 3TQVA 3I4EA 3V7PA 1Q6EA 3POCA 1BXBA 2E9BA 1KM6A 2ZRZA 4S38A 3WQ6A 3G1XA 3FA3A 4HTBA 5HOSA 2P3EA 2XH2A 5A6AA 1IZCA 5H6HA 2CLHA 1QWKA 1TKKA 1PYFA 4J7RA 2WCGA 2EPKX 2REQB 4MHBA 1NP2A 1MVYA 3A9IA 2YA2A 1XG3A 3CQKA 3HO8A 3K8KA 5DXXA 2WQPA 5DMMA 1EC7A 5BRQA 1RV8A 1XKJA 2W27A 4XBJA 2I9UA 4MM1A 3RLUA 1QTWA 4FP1A 4NNBA 3UU0A 3UA4A 5I3HA 3CIVA 4LCSA 2ISFA 5I78A 5A94A 4LALA 4J28A 4L65A 2JIEA 3IEBA 1SGJA 1U1HA 3WEOA 3HF3A 1TZ9A 4A3HA 3TONA 3PHAA 3DYPA 4NI3A 1K03A 3RM4A 4AZ7A 3KLKA 3TX9A 4ACZB 1MW1A 1RBAA 3GDBA 1J01A 2Y2WA 2AL2A 5LZLA 3AS0A 2AGKA 3GTHA 1FXQA 4POCA 3IJ7A 3LCGA 5G2IA 1PKNA 3SCVA 3W25A 4K8HA 3EXRA 1EEXA 2OQYA 4O8RA 5I02A 2GJXA 5DCDA 2ZUMA 1BPLB 3DYMA 5BWFA 2Y70A 3MTWA 2GVLA 3GIYA 1CB7B 5G1YA 5I2UA 1B2YA 3N4EA 4JYFA 1ISVA 3T05A 4AMCA 3GHSA 2H9AB 4ATLA 4AD3A 2D23A 4EPKA 3CXOA 3SRHA 3DFHA 4NZ4A 5FEPA 1LBFA 1O60A 5I79A 1VJIA 4XZLX 4IPPA 1HQTA 4XD6A 4Z0JA 4IX2A 2Q02A 3STFA 3BDKA 3NA8A 3BC9A 3T8QA 4V1YA 1IR1A 1A3HA 1GNXA 4N9BA 2CLFA 5DMYA 1HKMA 5C70A 1JF6A 1PJ9A 4C1LA 3UJRA 3ZO9A 4IXXA 4UWMA 2A1YA 3DFSA 1US2A 2GGHA 1V6YA 1JPKA 3QQWA 4S3KA 1T7LA 1I2QA 3FEMA 4JFTA 4LRTA 3N3MA 1H09A 3IRSA 5ABEA 1W9VA 5LXEA 1V3HA 3S42A 1R3TA 2E6DA 3CC1A 4RW5A 4C6MA 3RO8A 4OUEA 4AZ5A 4NJGA 5AYYA 4EP8C 4KKXA 1YHTA 4FLRA 3P0XA 4LY8A 4GABA 1IYXA 1SZGA 4S23A 3PFMA 3KBSA 4F3HA 2Z1SA 4CKQA 2DVXA 4HPHA 3DFQA 3TR9A 3UWQA 4KS0A 1U5JA 1EOKA 1RD6A 3B9EA 3O1NA 4GWEA 3IJDA 3U0HA 1QPRA 2YZ5A 1R38A 1J18A 1H1YA 3HGOA 1WA3A 2Z00A 3APYA 1BTMA 1HO1A 2D0FA 4I5UA 4R9XA 3GTFA 1KW1A 2C0AA 2YJQA 2DT1A 1KGWA 4Q8MA 4U5KA 5CC5A 2ATMA 4IGMA 3EWXA 2BOGX 3CJPA 3DERA 4PCNA 4G5DA 4DM2A 3TYCA 2OQHA 3PY2A 4H6KA 1CBGA 4HCHA 4JN7A 1BF2A 3N2TA 1E40A 2IKIA 3DFNA 3HFTA 2XZ7A 1S5MA 2PZNA 1S5TA 4HHLA 3HG4A 3WQWA 5AHNA 1XBXA 4AZCB 3W7NA 3ARSA 2WWDA 3B8IA 3O6AA 1B3ZA 5KZEA 3AISA 4JIHA 3NSMA 4QQUA 2IPJA 1ITXA 1LUCA 3HN3A 1DXIA 5GNYA 1H7NA 4WDTA 2QJNA 1V02E 1Q6CA 1WZAA 4KWWA 3U48A 1PDZA 1M9HA 4KETA 3LZ5A 4J9JA 2WZMA 4ZL1A 1LLOA 3VYLA 3G6MA 4IZGA 1D8WA 5C0QA 3MC5A 3VVGA 3GH5A 4N2YA 4WDWA 3TYBA 2QQ6A 4FF7A 4RX0A 3TNBA 4GX9A 4CEXC 1MW0A 5A6JA 1TB3A 3KBNA 1ZGDA 4GY7A 4OWGA 5BRBA 3LCIA 4DWSB 1KBIA 4LF1A 4EXQA 4KFOA 2BY1A 4V27A 4JY9A 3QEZA 4N6EA 2JQXA 1PS9A 3TJLA 3W29A 2HISA 3MWAA 2BVYA 2X0YA 1M65A 5D03A 4HU3A 1I75A 3RF9A 3H2CA 3Q65A 4UCFA 1DE5A 2XDFA 3WNPA 3SCUA 1Z32X 4QNWA 4S3JA 1ML1A 3L4TA 3OLIA 1F2JA 3F7JA 3IGSA 2AQOA 2DQWA 4QS6A 1XD0A 2P0OA 3VX0A 2DH2A 4JCMA 3GIPA 4PBEA 4N9CA 4UXDA 2VOTA 4HN4A 5FEWA 2PD5A 3TTYA 1BQGA 3L4XA 4ZSTA 5KETA 3C8NA 4YMZA 3MV01 3UXKA 4CQCA 2ZKMX 1EJWC 1NQKA 4C6FA 1U1UA 1Q66A 2ZTKA 2WSPA 5AVHA 3CO4A 2YFNA 2O9PA 5IM51 2YCKX 1JDDA 2OEMA 3G1HA 1MEWA 3W7PA 3GZAA 4HKPA 3UPMA 1OM0A 4JR5A 3URNA 2ODOA 3MV11 2QR6A 1UW9A 5IDIA 4FXFA 3G1YA 4L6DA 1MRQA 2VX5A 4MY1A 5H8UA 4WJEA 1V02A 1FFQA 2VVSA 3BG9A 1EXBA 5C7VA 3VOJA 4QCEA 1UR1A 3A4JA 4H19A 1UC5A 3PNZA 5BROA 2YBTA 3REQA 2EPOA 5KZMA 4LJ3A 3MMWA 1AA1B 2QJIA 1RY0A 1V0NA 4A8RA 5LKYA 5KINA 4NF7A 4AW7A 4HZ6A 5FSEC 1S2CA 2Y8VA 2DZVA 2BODX 1RJRA 4AY8A 1RZMA 3B8TA 2DZSA 1SJDA 2BBFA 3VUPA 1K77A 3WMCA 5IDZA 4RNHA 2PZ0A 5C9XA 3HJEA 3QH2A 5D02A 1EQPA 3B8WA 1EIXA 1SYTA 1LLZA 5F2GA 2NXHA 5D2YA 4L4MA 1NOFA 3OP2A 5CGMA 4AWEA 2XN2A 4BFAA 2Y85A 5FJUA 2ZRVA 1A3WA 5BNKA 4GNVA 3SUVA 4I7WA 3RIKA 3Q45A 5A2BA 4LAZA 5K9CA 1QOQA 3K4DA 3PANA 3EOLA 1QVBA 1XIFA 1L6FA 2QT3A 3FA5A 2XVLA 4CD4A 3IACA 4NY2A 2YXGA 3UXIA 3CHCA 1IZKA 1YBQB 3FV9A 1G6CA 5EYWA 3CT2A 3UBPC 4ZOEA 3M6YA 5REQA 3RLHA 4YCOA 4FMVA 4GNJA 2GUUA 2WKGA 2Z1KA 3DG6A 1J0ZA 3SY5A 3T9PA 2OODA 1NAL1 1UASA 1TVPA 1XBVA 4FS9A 5AHMA 3RLVA 3I65A 1TELA 1E71M 4DZAA 1XV8A 2YOCA 4AIEA 1ADOA 3RNDA 3EX6A 4KEVA 4XISA 2DEPA 3WLOA 1UG6A 3H7VA 3EA3A 3MHUA 3NQ7A 4B5XA 1QI2A 3CZ8A 2NUXA 1H7RA 4A3YA 1P1MA 1O66A 4F66A 3A64A 1CGYA 1XX1A 2ZXAA 4Q8QA 1Q7ZA 1V79A 2FDMA 5D2TA 3T42A 5EBUA 1UR2A 3BSGA 3VI2A 1W9DM 5K9DA 1XGZA 4OT7A 4FALA 1P43A 4IG2A 3WF0A 5C5YA 2VVNA 2EKCA 2Y88A 5FAGA 1J10A 5IHSA 2HCVA 4M7TA 1GQNA 3HQOA 3W7MA 2OVLA 4IGNA 3PAJA 4UR7A 4I7UA 2WNNA 4S3EA 2WZEA 3LZ3A 3UWUA 1UOKA 2XIJA 1FDJA 3A22A 3BCDA 2CXGA 1H63A 3OLDA 4DPQA 2NSXA 5DT5A 3U4FA 4IJCA 2R1KA 1TE6A 1JCLA 1S5WA 4PL2A 3D0CA 3FVMA 1VF8A 1OCBA 1VJZA 4R3UA 3GG8A 3S5ZA 2YCIX 1X6NA 2PRLA 1K9TA 1UH2A 3DAQA 3DKJA 2GVYA 3IIOA 4RL3A 4FX7A 2WYSA 3GUWA 3VZYA 3DXIA 2OWCA 1QMLA 4QJ3B 1PCWA 4C6CA 3TEVA 2XGBA 4DBSA 3MQTA 1OC7A 3AYRA 2OYKA 1H5VA 4LAMA 4XKMA 3MVTA 1J2BA 1JI1A 1ZP3A 3LHWA 4QCFA 2X1SA 1AH3A 3C86A 2ZOXA 1PWLA 4TU1A 5G2HA 1YPFA 4U2ZA 1LJYA 1A5UA 2QHAA 3GFZA 2GK1A 2INEA 2JFEX 4W88A 3ARYA 5BU9A 1FWAC 1V6UA 1Y5WA 1IT8A 2G95A 3TYDA 4GIAA 3ONCA 1CB2A 3P84A 6TAAA 3SQMA 1JDCA 1YW1A 8TIMA 3EEGA 4ML9A 4XZMX 5AB3A 3B0UX 6ALDA 2E1DA 4O18A 3S47A 4ZOAA 2G50A 1ISZA 2C18A 3WQ4A 3K8LA 4I8YA 3LA4A 4HK7A 2Z6JA 5U7SA 1ALDA 2CLPA 2PGFA 4JTUA 4KQNA 3VD3A 4K38A 2YPIA 1E0TA 1IIGA 3LI0A 4WVXA 1EGMA 3T08A 3TA6A 3SRDA 4BF7A 3NQ6A 1AD1A 3F1QA 1H61A 3R6IA 1QPNA 4NZ5A 1DIOA 1A53A 1NWSA 1KQYA 3B9NA 4DEFA 3CHFA 2PP3A 3TIMA 2WHJA 2YA0A 3S3GA 3ZXWA 1XGDA 3CUZA 3GC5A 2VEGA 3TC7A 4LAKA 3HPZA 2VRJA 9XIMA 3R58A 5DCEA 1ZNNA 1H1NA 4KCWA 5GJNA 1V3KA 5MKGA 4DO6A 1TFVA 4JDYA 4Y8FA 3SGZA 3F4DA 1J8VA 2P8CA 5A95A 2ESCA 1YX1A 5AN7A 1V03A 2O9RA 1YYAA 2OG9A 1E55A 4HA4A 1W1A1 3RU8X 1UUMA 4DO7A 3SCSA 5DMNA 3KP0A 4H9TA 5A6SA 2DJLA 2X05A 4CNPA 4WDXA 1TV8A 2XU2A 4O11A 1ADSA 2BOFX 1HKVA 5H8PA 4AZGA 1VENA 4QS5A 4NZ3A 3SO7A 4PBGA 4GCXA 3RGTA 3OU8A 3NQ2A 2QCFA 3E49A 3VGFA 3VKCA 4AG0A 1W9UA 3W7CA 4MZYA 2ZX7A 3UY8A 5HQEA 2ZXDA 2WSKA 1UA3A 1JI2A 3TJIA 1HUVA 1KKOA 1YXDA 1P48A 1R3RA 2WC3A 2OWXA 3R8HA 2UBPC 2WVSA 3IRDA 2CZEA 5AC8A 4I6KA 2PWHA 1R47A 1DE6A 3S2NA 1OZQA 4Y7EA 1WDSA 1OBAA 3R7MA 3PZVA 3WDJA 2PURA 3NR0A 3W38A 2VEKA 3CTLA 2Q8ZA 2A3AA 4E4PA 5FJRA 3W72A 3ATZA 1UHVA 1Z69A 3M0IA 2NQ9A 1FWTA 3Q94A 3GU2A 4GY1A 3TWBA 1JZ3A 5D2XA 3WBWA 4E2BA 1CECA 1ODZA 5EGRA 1PTAA 3M07A 3MDWA 4H9XA 1W5MA 1AFSA 1GHSA 2V5DA