5JM1A

Structure of tetrameric jacalin complexed with a trisaccharide, gal alpha-(1,3) gal beta-(1,4) gal
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
133
structure length
133
Chain Sequence
GKAFDDGAFTGIREINLSYNKETAIGDFQVVYDLNGSPYVGQNHKSFITGFTPVKISLDFPSEYIMEVSGYTGNVSGYVVVRSLTFKTNKKTYGPYGVTSGTPFNLPIENGLIVGFKGSIGYWLDYFSMYLSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Effect of linkage on the location of reducing and nonreducing sugars bound to jacalin.
pubmed doi rcsb
molecule keywords Agglutinin alpha chain
molecule tags Sugar binding protein
total genus 29
structure length 133
sequence length 133
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2016-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01419 Jacalin Jacalin-like lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.100.10.30 Mainly Beta Aligned Prism Vitelline Membrane Outer Layer Protein I, subunit A Jacalin-like lectin domain 5jm1A00
2GUXA 3R51A 5EXGA 2BN0A 1KUJA 3MITA 4GX7A 2HYQA 4AKBA 3R50A 1C3MA 2JZ4A 4PIFA 1UGWC 3VZEA 5J4TA 5BN6E 2NU5A 5J51A 1UGYC 3LLYA 4R6NA 3WOBA 1JOTA 1UH0A 1C3NA 1C3KA 1WS4C 5AV7A 4AKDA 1M26A 1J4TA 5JM1A 3VZGA 3LL2A 1TOQA 2GUEA 1J4UA 3APAA 4PIKA 1XXRA 1WS5A 2HYRA 3WOCA 3MIVA 4DDNA 4AK4A 3VY6A 1ZGSA 1XXQA 3LLZA 3LM1A 3AQGA 1X1VA 2GUDA 3O44A 4R6PA 4PITA 3P8SA 1KU8A 1PXDA 1OUWA 4PIUA 1TP8A 4R6OA 4WOGA 3VZFA 2GUCA 3VY7A 5J50A 2NUOA 2GTYA 1VBOA 1ZGRA 1UH1A 1J4SA 1UGXA 3LL1A 5J4XA 1VBPA 4R6RA 1WS4A 3LKYA 3LL0A 1UGYA 3MIUA 1JACA 1XEZA 1UGWA 2BMZA 4R6QA 1WS5C 4MQ0A 2BMYA 3R52A 4AKCA
chains in the Genus database with same CATH superfamily
2GUXA 3R51A 5EXGA 4D8MA 2BN0A 1KUJA 3MITA 4QX0A 4GX7A 2HYQA 4AKBA 1W99A 3R50A 1C3MA 4QX1A 1JI6A 2JZ4A 4PIFA 1UGWC 3VZEA 4ARYA 5J4TA 5BN6E 2NU5A 4AKCA 5J51A 1UGYC 3LLYA 4R6NA 1I5PA 3WOBA 1JOTA 1UH0A 4QX3A 1C3NA 1C3KA 1WS4C 5AV7A 4AKDA 1M26A 1J4TA 5JM1A 3VZGA 3LL2A 1TOQA 2GUEA 1J4UA 3APAA 4PIKA 1XXRA 1WS5A 2HYRA 3WOCA 3MIVA 4DDNA 4AK4A 3VY6A 1ZGSA 1XXQA 3LLZA 3LM1A 3TOWA 3AQGA 1X1VA 2GUDA 3O44A 4R6PA 4PITA 3P8SA 1KU8A 1PXDA 1OUWA 4PIUA 1TP8A 4R6OA 2C9KA 4WOGA 3VZFA 2GUCA 3VY7A 5J50A 2NUOA 2GTYA 4QX2A 1VBOA 1ZGRA 2QP2A 1UH1A 1J4SA 1UGXA 3LL1A 5J4XA 1CIYA 1VBPA 1VMOA 4R6RA 4MOAA 1WS4A 3LKYA 3LL0A 1UGYA 4ARXA 3MIUA 1JACA 1XEZA 1DLCA 1UGWA 2BMZA 4R6QA 1WS5C 4W8JA 4MQ0A 2BMYA 3R52A 3EB7A
chains in the Genus database with same CATH topology
2GUXA 3R51A 5EXGA 2BN0A 1KUJA 3MITA 4GX7A 2HYQA 4AKBA 3R50A 1C3MA 2JZ4A 4PIFA 1UGWC 3VZEA 5J4TA 5BN6E 2NU5A 5J51A 1UGYC 3LLYA 4R6NA 3WOBA 1JOTA 1UH0A 1C3NA 1C3KA 1WS4C 5AV7A 4AKDA 1M26A 1J4TA 5JM1A 3VZGA 3LL2A 1TOQA 2GUEA 1J4UA 3APAA 4PIKA 1XXRA 1WS5A 2HYRA 3WOCA 3MIVA 4DDNA 4AK4A 3VY6A 1ZGSA 1XXQA 3LLZA 3LM1A 3AQGA 1X1VA 2GUDA 3O44A 4R6PA 4PITA 3P8SA 1KU8A 1PXDA 1OUWA 4PIUA 1TP8A 4R6OA 4WOGA 3VZFA 2GUCA 3VY7A 5J50A 2NUOA 2GTYA 1VBOA 1ZGRA 1UH1A 1J4SA 1UGXA 3LL1A 5J4XA 1VBPA 4R6RA 1WS4A 3LKYA 3LL0A 1UGYA 3MIUA 1JACA 1XEZA 1UGWA 2BMZA 4R6QA 1WS5C 4MQ0A 2BMYA 3R52A 4AKCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GUX A;  3R51 A;  5EXG A;  2BN0 A;  1KUJ A;  3MIT A;  4GX7 A;  2HYQ A;  4AKB A;  3R50 A;  1C3M A;  2JZ4 A;  4PIF A;  1UGW C;  3VZE A;  5J4T A;  5BN6 E;  2NU5 A;  5J51 A;  1UGY C;  3LLY A;  4R6N A;  3WOB A;  1JOT A;  1UH0 A;  1C3N A;  1C3K A;  1WS4 C;  5AV7 A;  4AKD A;  1M26 A;  1J4T A;  5JM1 A;  3VZG A;  3LL2 A;  1TOQ A;  2GUE A;  1J4U A;  3APA A;  4PIK A;  1XXR A;  1WS5 A;  2HYR A;  3WOC A;  3MIV A;  4DDN A;  4AK4 A;  3VY6 A;  1ZGS A;  1XXQ A;  3LLZ A;  3LM1 A;  3AQG A;  1X1V A;  2GUD A;  3O44 A;  4R6P A;  4PIT A;  3P8S A;  1KU8 A;  1PXD A;  1OUW A;  4PIU A;  1TP8 A;  4R6O A;  4WOG A;  3VZF A;  2GUC A;  3VY7 A;  5J50 A;  2NUO A;  2GTY A;  1VBO A;  1ZGR A;  1UH1 A;  1J4S A;  1UGX A;  3LL1 A;  5J4X A;  1VBP A;  4R6R A;  1WS4 A;  3LKY A;  3LL0 A;  1UGY A;  3MIU A;  1JAC A;  1XEZ A;  1UGW A;  2BMZ A;  4R6Q A;  1WS5 C;  4MQ0 A;  2BMY A;  3R52 A;  4AKC A; 
#chains in the Genus database with same CATH topology
 2GUX A;  3R51 A;  5EXG A;  4D8M A;  2BN0 A;  1KUJ A;  3MIT A;  4QX0 A;  4GX7 A;  2HYQ A;  4AKB A;  1W99 A;  3R50 A;  1C3M A;  4QX1 A;  1JI6 A;  2JZ4 A;  4PIF A;  1UGW C;  3VZE A;  4ARY A;  5J4T A;  5BN6 E;  2NU5 A;  4AKC A;  5J51 A;  1UGY C;  3LLY A;  4R6N A;  1I5P A;  3WOB A;  1JOT A;  1UH0 A;  4QX3 A;  1C3N A;  1C3K A;  1WS4 C;  5AV7 A;  4AKD A;  1M26 A;  1J4T A;  5JM1 A;  3VZG A;  3LL2 A;  1TOQ A;  2GUE A;  1J4U A;  3APA A;  4PIK A;  1XXR A;  1WS5 A;  2HYR A;  3WOC A;  3MIV A;  4DDN A;  4AK4 A;  3VY6 A;  1ZGS A;  1XXQ A;  3LLZ A;  3LM1 A;  3TOW A;  3AQG A;  1X1V A;  2GUD A;  3O44 A;  4R6P A;  4PIT A;  3P8S A;  1KU8 A;  1PXD A;  1OUW A;  4PIU A;  1TP8 A;  4R6O A;  2C9K A;  4WOG A;  3VZF A;  2GUC A;  3VY7 A;  5J50 A;  2NUO A;  2GTY A;  4QX2 A;  1VBO A;  1ZGR A;  2QP2 A;  1UH1 A;  1J4S A;  1UGX A;  3LL1 A;  5J4X A;  1CIY A;  1VBP A;  1VMO A;  4R6R A;  4MOA A;  1WS4 A;  3LKY A;  3LL0 A;  1UGY A;  4ARX A;  3MIU A;  1JAC A;  1XEZ A;  1DLC A;  1UGW A;  2BMZ A;  4R6Q A;  1WS5 C;  4W8J A;  4MQ0 A;  2BMY A;  3R52 A;  3EB7 A; 
#chains in the Genus database with same CATH homology
 2GUX A;  3R51 A;  5EXG A;  2BN0 A;  1KUJ A;  3MIT A;  4GX7 A;  2HYQ A;  4AKB A;  3R50 A;  1C3M A;  2JZ4 A;  4PIF A;  1UGW C;  3VZE A;  5J4T A;  5BN6 E;  2NU5 A;  5J51 A;  1UGY C;  3LLY A;  4R6N A;  3WOB A;  1JOT A;  1UH0 A;  1C3N A;  1C3K A;  1WS4 C;  5AV7 A;  4AKD A;  1M26 A;  1J4T A;  5JM1 A;  3VZG A;  3LL2 A;  1TOQ A;  2GUE A;  1J4U A;  3APA A;  4PIK A;  1XXR A;  1WS5 A;  2HYR A;  3WOC A;  3MIV A;  4DDN A;  4AK4 A;  3VY6 A;  1ZGS A;  1XXQ A;  3LLZ A;  3LM1 A;  3AQG A;  1X1V A;  2GUD A;  3O44 A;  4R6P A;  4PIT A;  3P8S A;  1KU8 A;  1PXD A;  1OUW A;  4PIU A;  1TP8 A;  4R6O A;  4WOG A;  3VZF A;  2GUC A;  3VY7 A;  5J50 A;  2NUO A;  2GTY A;  1VBO A;  1ZGR A;  1UH1 A;  1J4S A;  1UGX A;  3LL1 A;  5J4X A;  1VBP A;  4R6R A;  1WS4 A;  3LKY A;  3LL0 A;  1UGY A;  3MIU A;  1JAC A;  1XEZ A;  1UGW A;  2BMZ A;  4R6Q A;  1WS5 C;  4MQ0 A;  2BMY A;  3R52 A;  4AKC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...