5JRTA

Crystal structure of the human tankyrase 2 (tnks2) sam domain (dh902/924re)
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
64
structure length
64
Chain Sequence
b'VDFSITQFVRNLGLEHLMDIFEREQITLRVLVEMGHKELKEIGINAYGHREKLIKGVERLISGQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tankyrase-2
publication title Tankyrase Requires SAM Domain-Dependent Polymerization to Support Wnt-beta-Catenin Signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 22
structure length 64
sequence length 64
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07647 SAM_2 SAM domain (Sterile alpha motif)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 5jrtA00
1LKYB 1SXDA 1SV4A 1Z1VA 2ESEA 1X40A 2F44A 1OW5A 1UQVA 3BS7A 3K1RB 3TACB 2K60A 4NJ8A 4PZOA 1DXSA 2ES6A 3BQ7A 5JU5A 5JRTA 2YTUA 2KSOA 1SXEA 2E8OA 2D3DA 2E8PA 3TADC 1JI7A 3TADA 1UCVA 2K4PA 2QARB 2Y9UA 1X9XA 2B6GA 1B0XA 1F0MA 1PK3A 1PK1B 2EANA 2KMDA 2F8KA 2QB0A 2E8MA 2LPEA 1WWUA 5F3XB 2L5YA 1LKYA 2F3NA 2KIVA 2KG5A 2DKXA 2FE9A 2KE7A 1B4FA 1V38A 1X66A 1V85A 2EAMA 1SV0C 3HILA 1SV0A 5JTIA 4NL9C 3IDWA 2KSOB 3BS5B 4MHVA 1RG6A 2Y9TA 3SENA 1WWVA 4RQNA 2DL0A 2EAOA 3H8MA 2QARA 2QKQA 2GLEA 2DKZA 2QB1A 1COKA 5J8YC 5J8YA 1KW4A 4IS7A 1PK1A 3SEIA 4RQMA 2QB0B 1OXJA 2EAPA 3BS5A 5KNIA 2E8NA 1SGGA 4NL9A 3KKAC 2D8CA 2LMRA 3KKAA 5L1MA 2JV3A 4PZNA
chains in the Genus database with same CATH superfamily
1BPZA 4KN4A 9ICKA 4RQ3A 5DQGA 9ICVA 5J2AA 2RRDA 4K4HA 2IA6A 1L5UA 8ICRA 3BQ7A 4BX9C 2Q4TA 3ED5A 2HVHA 5J0PA 1X9WA 5KFTA 4YR3A 1NJXA 3OJUA 2KZ3A 5KFIA 4KTQA 4LZDA 5ALEA 2KJ5A 5DGBA 9ICOA 4QWDA 2BDPA 2XY7A 2Y9UA 1XO1A 4ED7A 1Q3VA 4O5EA 4QIWC 1XNSA 1JRPA 2G5HB 4YG2A 3BDPA 2OCEA 2ZJ5A 5JUMA 3CYMA 1N60A 1CUKA 5HMMA 4EENA 3RBDA 3SAHA 4C80A 4PL1A 4TUQA 1ZQAA 8ICXA 4RQ8A 1U4BA 2MU2A 1TFRA 3Q8MA 1J2NA 2ZTDA 2K8CB 3V7KA 1SKWA 4GXKA 3F2CA 3R9KA 4I2CA 4EYHB 4NLGA 4I2GA 3ISDA 4IQUA 5JTIA 3RB4A 2J6SA 4M9LA 2KSOB 2JH7A 1RYSA 3IP4B 3WK5A 1ZQHA 4EZ6A 8ICMA 4PHDA 2RLTA 3RRHA 4O3SA 4IQWA 2HHVA 4RQ1A 4M0AA 4QZDA 4DL4A 5J8YA 1YZ6A 1NZBA 1WCNA 8ICYA 1X9MA 3SAFA 5CHGA 4KX3A 1ZQ1C 3RH4A 2HCFA 3PR4A 4B9LA 9ICSA 4YQWA 5IIMA 2YMPA 4IR1A 5KFGA 3PNCA 2DFLA 3N97B 1ZQIA 2DPJA 2KZMA 3BS7A 1BPEA 3M9MB 5KG4A 4ED8A 1IIPA 3RH5A 4DEZA 5IIOA 2BPFA 2ZJAA 5KFLA 2UVWA 9ICXA 1Q3UA 1S0OA 2FMQA 4C4TA 4B9VA 4NLCA 4NXZA 4JV0A 3D2QA 4BUGA 1X9XA 4R65A 1ZOLA 2VJ4A 3HJEA 4JMUA 4DSKA 2XICA 2KJ9A 2PFNA 4UQGA 4QZEA 1A76A 5KT4A 1TK8A 9ICUA 4FS2A 3TI0A 3ZI4A 2BCQA 4UB2A 3A0HU 3Q8LA 2HBKA 4B9SA 2H5XA 1V38A 1UA0A 4B6JA 3KZIU 1JUDA 3SZ2A 1JX4A 3O0FA 5TZVA 3WKBA 2I5HA 4QNLA 1KL9A 1AQ6A 2Y1IA 3T3FA 1ZQSA 3AUOA 2QB1A 4QWCA 3N7RC 3V6KA 3H40A 1FO4A 4YP3A 4ZOHC 1KW4A 5CR0A 4FE3A 1J2MA 1S77D 3SV3A 4DQIA 1OXJA 2EAPA 4BXOB 2ZIWB 4CF4A 4QIWF 2FPLA 4P0PB 3IRUA 1SXDA 1SV4A 4CRXA 5AKHA 4K4IA 2J6UA 1ZXIA 2AQ0A 4NM1A 4C8LA 4O3QA 9ICFA 4P0QA 3EYZA 2K60A 4ED1A 3RJHA 2PFPA 3OSNA 3RAXA 2YN4A 1ZQXA 5L9XA 5EE1A 5HMLA 2ZUDA 5KL1B 5EWGA 3TANA 1ZJMA 2G5IB 5AI9A 1CEZA 5DB9A 4JV1A 5H2FU 2ZXHA 2W9CA 3PW7A 3TQ1A 2C2DA 4DSIA 2BQUA 4KLEA 3DEEA 2ASJA 5AM4A 3TARA 2IOFK 4QZHA 4F4XA 1NOMA 1F44A 1ZD5A 4J9OA 2NRTA 2KD1A 2IOFA 3GIIA 9ICCA 3C2KA 4FO6A 2JZBA 1ZQDA 4DOAA 3PZPA 3KHLA 2ISOA 2W04A 5AIAA 4O3NA 1WCLA 2I9GA 1RG6A 1NKEA 4IQVA 2F1HA 3SR6A 4X5VA 3H8JA 1NKCA 4JUZA 4KMOB 2YY6A 2JEJA 2QARA 3UMGA 3OGUA 3HP6A 1DGJA 5AM2A 4KLGA 2KNJA 2C28A 5IIIA 2CRXA 2PKEA 8ICWA 4Z6CA 4E0DA 9ICEA 3GV5B 3SEIA 7ICLA 4NLBA 3BS5A 2FLPA 5KNIA 4NY8A 1SGGA 2ZIXB 2R8GA 4DFPA 2WTFA 4PGYA 5KT5A 2Y1JA 3RJFA 7ICFA 5ALLA 3M6KA 4DSLA 3S6JA 2H3FA 2KP7A 3G6VA 3PO5A 5KFSA 1HUZA 2PI4A 2XGPA 3OPXA 2MRLA 5KFCA 4NJ8A 4Y2RA 2AGOA 1SIJA 4PPXA 2G06A 4ED0A 1S9FA 1ZQMA 2NV3A 2D3DA 4I2JA 1MC8A 1JI7A 2MUTB 2K4PA 4UB8U 4QZBA 2V4RA 3Q8SB 2FMPA 5T14A 5DDYA 1U49A 2DPIA 4DSEA 2VJ5A 4RZRA 1QH9A 4YMMA 2A1JA 3I76A 2F8KA 2FJ6A 4M6WB 1JMSA 4EBDA 3H7IA 2XCPA 3UPQA 2XC9A 4J9QA 3NVVA 4F93B 2KG5A 1UT8A 2AU0A 3ZDEA 4M9GA 2M9NA 4I2IA 5K4LA 2BHNA 2P6RA 1S0MA 4CF5A 3PW4A 3CP8A 1PVRA 3IDWA 2AGQA 2F1JA 8ICJA 4DOCA 3C28A 1DGSA 5KG5A 7ICVA 2LI6A 2W9BB 3OTQA 5J2CA 2AQ4A 2YX8A 3NASA 3RJIA 2DKZA 4IC9A 4HAIA 3RR8A 2XIDA 2KTQA 1K1QA 4MFCA 1IXRA 2ATLA 2LMRA 1LKYB 3C2LA 5KFWA 5AI5A 1ZRMA 3H0RB 1IG6A 4I27A 1NKBA 4RPYA 3GV7B 4ED2A 5KFMA 5ALRA 2XY6A 4JWNA 4C0ZA 2GWSA 4F5OA 2CN1A 1GO3F 1RXWA 2C2EA 2HHSA 1B43A 4QZAA 1V9PA 4ECRA 4UB6U 3D2SA 5JRTA 3JPNA 3AM9A 1O08A 3GIMA 3HPOA 1ZQYA 5DDMA 1D8BA 1BPBA 4KLTA 3UMCA 1F0MA 5EE3A 5KAFU 4RUAA 4EBCA 1PK1B 4JWMA 4CCHA 5J29A 2LPEA 4CGZA 4KLQA 2W3RA 1U9LA 4RQ6A 2KIVA 4Z6DA 9ICIA 2FE9A 5KG3A 2ODGA 1TK0A 5DB6A 2NRWA 1SV0C 4BJQA 3UXPA 1S97A 1BPYA 3H0LB 4DQPA 2E1EA 1URJA 2K4EA 4TURA 5ALGA 1ZD4A 3AQEA 4OCZA 2JHDA 4RQNA 2F8LA 2DL0A 4UBBA 1KDHA 3T5HA 4MEXA 3THVA 2WAQC 1NK9A 4ECUA 2W11A 1Q8KA 9ICGA 5KFEA 5DG9A 5B5EU 3OSPA 1L8OA 1Z4OA 1VJ5A 2W3SA 5KT6A 1X6IA 3KKAA 3QU9A 5ALYA 4M9HA 3JPOA 4ICAA 3TAQA 1XS9D 5AI8A 2ALZA 1XSNA 9ICBA 4Y2TA 1Z00B 1X2IA 1SWWA 5KFJA 4FFDA 4AP9A 3L3FX 5IIKA 3OHBA 1QQ6A 4BWMA 5DBBA 2F1IA 4KMUA 2XGQA 3KHHA 3NGDA 1ZQGA 4C7YA 1D9DA 5C0YA 5KFFA 2MA1A 4GLXA 1WG8A 3RAQA 8ICLA 5KFXA 5C5JA 2HSZA 3QU5A 1JXLA 3RJEA 4P4PA 3UMBA 4Y2UA 4IR9A 1A77A 3RB6A 3IHQB 2JGAA 2KICA 5ALMA 1J97A 2PXIA 1TK5A 1SWVA 5ALFA 3ZDCA 2JEIA 4I2BA 8ICEA 4DF4A 1NK4A 2R8JA 3ZDDA 3H8SA 4Y2SA 1CRXA 2OWOA 8ICAA 3N28A 5GTHU 1MA7A 1N56A 4ACOA 3MFHA 5J2GA 1L3UA 7ICTA 2H3QA 4OO1J 4YFKA 5J0WA 3QX7A 1UA1A 4I2EA 1ZQCA 2ZTEA 4PH5A 3QEBZ 2E3TA 1KLNA 3GIKA 2BCRA 2C22A 3F5AA 2QKQA 5J0RA 5FP0A 1NK0A 2HHTA 1NZPA 9ICLA 1JIHA 2W54A 4OJLA 3UQ2A 2R8HA 1ZETA 2DWQA 2QB0B 2E8NA 2ZIVB 5ALOA 2HBLA 4Z6FA 3H8WA 3PSIA 7ICMA 3BZCA 3MR3A 5KFQA 1JN3A 1RQNA 3LWMA 5AK5A 2RDIA 3WKCA 1N61A 3KTQA 1MQ2A 4QZIA 4PZOA 1TKDA 7ICPA 5ALKA 3PSTA 3VCBA 4J9KA 1VDVA 4BXOA 2ASLA 2E8PA 5DB8A 4F4ZA 5AM0A 4ELTA 2ZG6A 1D9FA 4KLIA 1S0NA 5AK6A 2JR5A 2ZIUB 1FIQA 2BQ3A 2AGPA 1ZQBA 4PHPA 4M9JA 2KMDA 5KG6A 2WAQF 1QQ5A 5BOLA 4CE6A 2AH5A 5F3XB 4UB5A 4UBCA 2R8IA 4DFMA 2ASDA 3ZDAA 2EDUA 1YZ7A 1QSYA 2K89A 4OD0A 4YXJA 4F91B 5KFAA 4IRCA 1M6YA 2EAMA 4C4SA 5AM3A 4UAUA 3RH6A 2XVTA 3AU2A 1V97A 3QZ8A 2KIWA 5ALWA 5IIJA 2HBJA 1NK5A 1PVQA 3B0YA 4USAA 4RNNA 3SQIA 4I2FA 2OH2A 3A0BU 1L7NA 5ALSA 1BNPA 4O3PA 2ZXIA 3JPSA 3QUQA 3QUCA 2WF8A 2J6TA 2LM1A 5J2IA 1QSSA 2OHFA 2D6FC 3MR5A 9ICJA 5DLGA 1A6SA 2ESEA 3IM1A 1SKSA 1ED1A 2HOQA 1UQVA 1RXVA 4KLLA 8ICSA 4QZFA 2NRXA 4F72A 3LWLA 1FFVA 4XA5A 5ALZA 2YTUA 3HWTA 4A8EA 3CW2C 5KFZA 5AKZA 1L7MA 3E0FA 3ORYA 5GTIU 4GC7A 5BOMA 3AU6A 3N7SC 4RNOA 3ISCA 1MSWD 2E5SA 2RP5A 1QLNA 5AI0A 4DFDA 3WKEA 1ZQEA 1L7PA 1DRGA 5AKGA 2BCVA 1HUOA 1CI4A 8ICCA 3HW8A 5EOZA 2H3ZA 4US8A 8ICUA 9ICWA 4DS4A 2BKEA 2W9MA 5J2DA 3D6JA 4DS5A 1X6JA 2MUTA 5J2BA 5KG7A 4MFAA 5AK4A 4O3RA 4KLMA 3EZ5A 3PX4A 3RBEA 4GC6A 2C2RA 2UVVA 3M6ZA 4RPZA 2LKYA 5KG2A 4C8MA 9ICQA 1ZD3A 4ECSA 1D8YA 7ICUA 2Y0SC 4M6WA 5AKXA 4EZ9A 3FDSA 3NTUA 1QQ7A 2DGZA 3GIJA 4I2AA 9ICPA 4ELVA 4DSJA 1K5OA 4F71A 3K1ZA 5TISU 3PVXA 4YXMA 5AKLA 1YT3A 1COKA 5J8YC 3H4DA 3UQ0A 4AYBC 1N48A 5AKEA 5CWRA 7ICGA 1BNOA 5KT2A 5AKJA 3LVWA 5IINA 4JB3A 3SAGA 3L4PA 4YMOA 1RM6C 5DLFA 1X40A 7ICRA 3G6YA 4J03A 3HKZF 5J2JA 3U26A 2G09A 1U47A 9ICMA 3TACB 4DFKA 2WFAA 3NVZA 9ICAA 4UASA 4I2DA 2JXJA 3F2BA 3RF9A 4KLOA 4RT3A 4TUPA 5G5GA 2IOHA 4TQSA 4YMNA 3J81j 3I1YA 1SXEA 2W43A 1ZQQA 3TADA 1MN8A 2FI1A 8ICPA 1C20A 2LYAA 4DL5A 3TKAA 2OM6A 3ETLA 5DG7A 4BDPA 8ICHA 4NM2A 4DL3A 4QW9A 3V6HA 2FPMA 1BGXT 2WB1C 4ED6A 3CNHA 2EANA 1L3SA 3PSFA 3ZDBA 1T7PA 5KFUA 4CF3A 2I6XA 5CB1A 2VKQA 5J2FA 4CDGA 1NI3A 4TQRA 1XU4A 3H0MB 5E79U 1T94A 1OUQA 3OHAA 1ECWA 2LYBA 2VANA 4WJ3B 4ECVA 2V4QA 1V85A 3GU3A 3C5FA 3HILA 3KOOA 4UB3A 2UVRA 4YVZA 1EXNA 5AKKA 2O6KA 5ALTA 2GOLA 2EQYA 4ECYA 3V7JA 1Z1BA 2EZZA 8ICVA 3C1ZA 1L8LA 2RHFA 7ICEA 1S76D 1NK7A 2XI9A 5ALHA 4RPXA 5DKWA 4RT2A 2HVIA 3SYZA 1ZQKA 4NLZA 4NL9A 3K75D 3Q8RB 3BQ2A 4J9PA 1ZYQA 5DQHA 4G9BA 3PW2A 4GXIA 2HMXA 5ALPA 4F5PA 4DFJA 5ALIA 4DQQA 4US9A 3ONNA 1ZQNA 2ZTCA 3PSPA 4Y2PA 3WK6A 1RYRA 4Q8EA 4KITB 5CRXA 4KN7A 2W7OA 1FFUA 3T5LA 3RJKA 4C8OA 3AL0B 1ZRNA 4R8UA 4FBTA 4F5QA 5HR6A 2DUYA 1AROP 2QARB 4RU9A 2Y0SF 5CP2A 2B6GA 3KZXA 1RYUA 4KLHA 4J9MA 1NNLA 5J0YA 2JEFA 4IRKA 4F3OA 1ZQOA 4PHEA 1Z00A 2KN7A 3N4MB 4QWEA 5ALVA 4DL6A 2YMMA 5L1LA 4I29A 2YB4A 3QXGA 3NS1A 1WUDA 4U6PA 4DCCA 1SL0A 4AYBF 1LV5A 3ICXA 3FYHA 1S8OA 2F3NA 4RQ7A 3N7PD 2JMGA 4DWIA 1B4FA 2BPCA 4Y2XA 3NVYA 5DBAA 3SI8A 4YN4A 4MF2A 4YD2A 4DSFA 2XCAA 5KFPA 2E1FA 7ICIA 2B0CA 5CJ7A 2MSNA 4RQ5A 2Y9TA 3LDAA 2P66A 3F5EA 1WWVA 2FLNA 2KKVA 5D49A 4P2HA 3MDAA 4XUSA 2GLEA 4PGXA 4CNQA 2GH1A 5KT7A 4P4MA 7ICNA 5J0SA 3OJSA 2AHOB 5B66U 2A1JB 1P7DA 4EX7A 4B9NA 2KFNA 4MFFA 3EW9A 2WB1F 4PZNA 4RQ0A 2W7PA 1IV8A 1XSLA 1Z1VA 2F2AB 3H4BA 7ICKA 4O0IA 8ICNA 3KD3A 5CEHA 3RTVA 4LZGA 7ICJA 2KKPA 3IG5A 4YD1A 2KSOA 3M9OB 3PR5B 1DK2A 3MBYA 1ZQVA 5J0TA 2LHTA 4DQSA 2PFQA 5DQIA 3TFRA 3DDHA 3PV8A 4I2HA 5KFNA 1JALA 2M0NA 4DLGA 2K4HA 2YMQA 4KX5A 4YR0A 4ZH4A 2HHUA 1XC9A 3ZD8A 4KLUA 1NJWA 1S0VA 3PW5A 2KHQA 2BGWA 3QU2A 4Q43A 2L5YA 2B21A 1C7YA 1L7OA 1SZHA 3QEAZ 4NLKA 3MC1A 3M8RA 2BCUA 2BPGA 3BJYA 4F4WA 1QSLA 1F5SA 4FS1A 2RQ5A 4FZNA 4NL9C 5KAIU 3QNMA 2ISPA 4YR2A 3G6XA 1KEJA 1TAQA 3QUBA 2F76X 3DV9A 5A0LA 2HHQA 1NJYA 3PMLA 3HX0A 4QZ8A 1PUZA 4DL7A 7ICQA 3C2MA 3LYSA 2JH1A 3Q8QB 2NYVA 4F4KA 2NO4A 3QE9Y 4RQMA 2F77X 4QZ9A 5HP4A 1ZD2P 4OJ6A 2R8KA 2VIXA 4IQTA 4J9NA 3AN1A 8ICQA 5KFVA 3HRDD 1N5WA 3WKAA 5AIBA 3C5GA 1OW5A 4RQ2A 4QWAA 1COOA 5D4BA 2XO7A 1ZQTA 2NRZA 9ICHA 4GXJA 4F2RA 1ZQJA 7ICSA 4XRHA 2EZYA 2K8BB 2ES6A 4I28A 3C23A 3VC8A 3SD7A 4R66A 1KRPA 1N62A 8ICGA 5DG8A 4F5RA 3TAPA 5F9LA 5AI6A 1N2XA 1UHUA 2A1AA 2FLLA 2OXOA 3MABA 1B0XA 3NUQA 3BQTA 5KFOA 4C8NA 1Z4NA 5IILA 7ICOA 1NK8A 5J0OA 1X42A 2P6UA 1QTMA 2PI5A 2ZIWA 5KL8B 2H3IA 4EYIB 4P0PA 1BPDA 4O3OA 2FDRA 1KQQA 1S5LU 5J2KA 1XWLA 5KFKA 3JPRA 4DOBA 1TE2A 1VLBA 5DGAA 3RJJA 2DF4B 1TAMA 1KKXA 3UXOA 1ZJNA 4MHVA 3HKZC 2N1RA 3LK9A 3UXNA 1B22A 5HNKA 5J0QA 1T8EA 3C1YA 9ICNA 3H8MA 2WF9A 2YB1A 2W55A 2VA8A 1KFTA 1KFDA 5DBCA 1T3QA 3WK4A 4IS7A 4O3MA 1PVPA 1T4GA 3GFKB 4UB1A 1WYGA 1XO0A 3KKAC 4MEYA 2HHXA 2QLTA 3MGIA 4IRDA 2G07A 4U7CA 3BZKA 3MDCA 3ALRA 4ECTA 1ZQZA 4M9NA 4PGQA 4NWIA 3HT3A 4M04A 4PL2A 4J9RA 5EWFA 1XSPA 4O5CA 4KLSA 3Q8PB 3JPTA 3PW0A 1RZTA 2Z7JA 4PHAA 1SKRA 2BZFA 2PMZC 2Q0ZX 5D46A 2K4IA 2AJQA 4FZLA 4BGDA 1HEKA 1ZQPA 3SMVA 5AI4A 1HJPA 2FMSA 3D2NA 5AK3A 2LBOA 3IN5A 1WWUA 2ZIXA 2I1QA 2IMWP 4M47A 4F2SA 4QZCA 1X66A 4QWBA 2UVUA 4UB4A 2HOIA 4IL6U 1SZPA 5EE0A 1H38A 4B9UA 4UAVA 4PJ0U 3QU4A 2KV2A 4J9LA 5J2HA 4GIBA 1Z3EB 2KJ8A 4LVSA 2HDOA 3K4GA 2IHMA 1L6NA 4JV2A 3WU2U 8ICBA 4YCXA 4KLFA 2KOBA 4JK1A 4OJPA 3GQCA 5AICA 1L3VA 2G08A 3PO4A 1LB2B 2LYHA 2PFOA 4NV0A 5AKIA 4XQ8A 1RPLA 3K1RB 8ICKA 3EWAA 3KFUF 2CPRA 1TAUA 4OJ5A 2KEYA 2H3VA 4Q8FA 3PY8A 3MGVA 3FAHA 5HHHA 3L5KA 1KFSA 2BR0A 5KFDA 2KZZA 4C7ZA 3MR2A 2W8LA 2W8KA 1KN5A 2G0AA 2W9BA 3EUB2 4OJOA 2HOFA 1UPHA 4QZGA 4DQRA 3ISBA 3NRWA 5ALUA 1PK3A 2HW3A 3M7DA 1SB3C 4Z6EA 2VA3A 2ZUBA 4ECZA 1FEZA 5F9NA 1LKYA 3WK9A 4MF8A 5BPCA 1Q46A 4O5KA 3UM9A 2IHNA 1K1SA 4Y2QA 1N5XA 1SV0A 3QU7A 5J2EA 4Y2VA 5AM5A 2ZUCA 3E58A 1IM4A 3WK8A 2HBMA 3C21A 3C29A 1TVAA 4DF8A 5KT3A 1MQ3A 3GILA 4FBUA 4P0QB 2IBKA 8ICIA 2BDUA 4KLJA 5J0UA 4G3IA 2PMZF 4R63A 5ALDA 1PK1A 3M8SA 2BQRA 4LJXA 5HHIA 4UAWA 2CXYA 2D8CA 5L1MA 5G5HA 2JV3A 4UAYA 7ICHA 1D8LA 5J0XA 2F44A 4TUSA 4UW9A 1RDFA 2W9AA 4ECWA 1ZQFA 2W9CB 3QYPA 3T5JA 2VA2A 3BQ0A 2HHWA 2OEHA 1Z19A 8ICZA 3RRGA 9ICTA 2E8OA 1DK3A 3F53A 1PZNA 2JZBB 4F50A 1L3TA 3EPIA 1NK6A 3B9JA 1KSPA 3V72A 1TV9A 2BCSA 8ICOA 5AM1A 3WKDA 1ZQWA 4F5NA 5L1KA 4EEKA 2KFZA 3NRZA 4J9SA 3M1YA 3RFAA 4K4GA 4NLNA 3AEVA 4ECXA 3Q8KA 3I28A 2YQEA 3IV6A 2V9WA 2EH9A 2NO5A 1S10A 4HYKA 4F4YA 3NVWA 2A19A 2KE7A 2YMLA 1QCKA 1DOQA 4O9MA 4QJFB 2WF7A 2KHVA 2XY5A 2JEGA 5KFYA 3RB0A 3V6JA 4EELA 3BS5B 1JXEA 8ICTA 3KHGA 1ZQUA 1U48A 1T3NA 5L1IA 3SV4A 1HIWA 3E2EA 2EAOA 1NJZA 3GZFA 2KVCA 1Y88A 3RJGA 2DBYA 4P4OA 1UT5A 5EWEA 3RB3A 3QZ7A 4UATA 2ZJ8A 2EZXA 3CRXA 2WHEA 1SL2A 4C4RA 3QUTA 4UAZA 4EX6A 2FPKA 2P35A 3B0XA 4ECQA 2K8AA 3KHRA 5KG0A 5AHXA 4C8KA 3MR6A 4EEYA 2KVSA 5L1JA 5KFHA 3FC4A 1ZQRA 1DXSA 3M9NB 5JU5A 2WF6A 1U45A 5ALQA 1SL1A 2OYYA 4ED3A 2W03A 3TADC 4DO9A 4RQ4A 1UCVA 3BQ1A 4EBEA 4DL2A 3PMNA 5KFRA 4KLDA 3PX6A 2MAXA 4QW8A 3ZD9A 3T79A 3IG8A 3ETRA 5ALJA 4DLEA 5DB7A 3WK7A 3AQFA 4Y2YA 2QB0A 2E8MA 4F8RA 3T5KA 2ZIVA 3F2DA 4GFJA 2KK0A 1N63A 3KBBA 3GDXA 3MGHA 2A3VA 2AXTU 4R64A 2HI0A 2DKXA 4Q44A 4RNMA 1BPXA 2R18A 2LM4A 2GO7A 2RDJA 3PX0A 1ZQLA 2WF5A 4ELUA 4Q45A 3FM9A 4RUCA 4R8UB 4B9MA 5ALNA 4FZMA 3LVVA 3EPGA 4BWJA 5KG1A 1O03A 5ALXA 4UARA 3SENA 2JRZA 4M2YA 1LVHA 3AMZA 3MFIA 4B9TA 3RR7A 5HR7A 1A0PA 1X9SA 5EE9A 2ZIUA 5AKYA 5KTQA 1KBUA 1KTQA 5CA7A 3V7LA 9ICRA 3JPQA 2DQNB 1JROA 2NRVA 3TFSA 3GV8B 4Y2JA 1BVSA 1RQLA 5KFBA 4F92B 3JPPA 8ICFA
chains in the Genus database with same CATH topology
1LKYB 1SXDA 1SV4A 1Z1VA 2ESEA 1X40A 2F44A 1OW5A 1UQVA 3BS7A 3K1RB 3TACB 2K60A 4NJ8A 4PZOA 1DXSA 2ES6A 3BQ7A 5JU5A 5JRTA 2YTUA 2KSOA 1SXEA 2E8OA 2D3DA 2E8PA 3TADC 1JI7A 3TADA 1UCVA 2K4PA 2QARB 2Y9UA 1X9XA 2B6GA 1B0XA 1F0MA 1PK3A 1PK1B 2EANA 2KMDA 2F8KA 2QB0A 2E8MA 2LPEA 1WWUA 5F3XB 2L5YA 1LKYA 2F3NA 2KIVA 2KG5A 2DKXA 2FE9A 2KE7A 1B4FA 1V38A 1X66A 1V85A 2EAMA 1SV0C 3HILA 1SV0A 5JTIA 4NL9C 3IDWA 2KSOB 3BS5B 4MHVA 1RG6A 2Y9TA 3SENA 1WWVA 4RQNA 2DL0A 2EAOA 3H8MA 2QARA 2QKQA 2GLEA 2DKZA 2QB1A 1COKA 5J8YC 5J8YA 1KW4A 4IS7A 1PK1A 3SEIA 4RQMA 2QB0B 1OXJA 2EAPA 3BS5A 5KNIA 2E8NA 1SGGA 4NL9A 3KKAC 2D8CA 2LMRA 3KKAA 5L1MA 2JV3A 4PZNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LKY B;  1SXD A;  1SV4 A;  1Z1V A;  2ESE A;  1X40 A;  2F44 A;  1OW5 A;  1UQV A;  3BS7 A;  3K1R B;  3TAC B;  2K60 A;  4NJ8 A;  4PZO A;  1DXS A;  2ES6 A;  3BQ7 A;  5JU5 A;  5JRT A;  2YTU A;  2KSO A;  1SXE A;  2E8O A;  2D3D A;  2E8P A;  3TAD C;  1JI7 A;  3TAD A;  1UCV A;  2K4P A;  2QAR B;  2Y9U A;  1X9X A;  2B6G A;  1B0X A;  1F0M A;  1PK3 A;  1PK1 B;  2EAN A;  2KMD A;  2F8K A;  2QB0 A;  2E8M A;  2LPE A;  1WWU A;  5F3X B;  2L5Y A;  1LKY A;  2F3N A;  2KIV A;  2KG5 A;  2DKX A;  2FE9 A;  2KE7 A;  1B4F A;  1V38 A;  1X66 A;  1V85 A;  2EAM A;  1SV0 C;  3HIL A;  1SV0 A;  5JTI A;  4NL9 C;  3IDW A;  2KSO B;  3BS5 B;  4MHV A;  1RG6 A;  2Y9T A;  3SEN A;  1WWV A;  4RQN A;  2DL0 A;  2EAO A;  3H8M A;  2QAR A;  2QKQ A;  2GLE A;  2DKZ A;  2QB1 A;  1COK A;  5J8Y C;  5J8Y A;  1KW4 A;  4IS7 A;  1PK1 A;  3SEI A;  4RQM A;  2QB0 B;  1OXJ A;  2EAP A;  3BS5 A;  5KNI A;  2E8N A;  1SGG A;  4NL9 A;  3KKA C;  2D8C A;  2LMR A;  3KKA A;  5L1M A;  2JV3 A;  4PZN A; 
#chains in the Genus database with same CATH topology
 1BPZ A;  4KN4 A;  9ICK A;  4RQ3 A;  5DQG A;  9ICV A;  5J2A A;  2RRD A;  4K4H A;  2IA6 A;  1L5U A;  8ICR A;  3BQ7 A;  4BX9 C;  2Q4T A;  3ED5 A;  2HVH A;  5J0P A;  1X9W A;  5KFT A;  4YR3 A;  1NJX A;  3OJU A;  2KZ3 A;  5KFI A;  4KTQ A;  4LZD A;  5ALE A;  2KJ5 A;  5DGB A;  9ICO A;  4QWD A;  2BDP A;  2XY7 A;  2Y9U A;  1XO1 A;  4ED7 A;  1Q3V A;  4O5E A;  4QIW C;  1XNS A;  1JRP A;  2G5H B;  4YG2 A;  3BDP A;  2OCE A;  2ZJ5 A;  5JUM A;  3CYM A;  1N60 A;  1CUK A;  5HMM A;  4EEN A;  3RBD A;  3SAH A;  4C80 A;  4PL1 A;  4TUQ A;  1ZQA A;  8ICX A;  4RQ8 A;  1U4B A;  2MU2 A;  1TFR A;  3Q8M A;  1J2N A;  2ZTD A;  2K8C B;  3V7K A;  1SKW A;  4GXK A;  3F2C A;  3R9K A;  4I2C A;  4EYH B;  4NLG A;  4I2G A;  3ISD A;  4IQU A;  5JTI A;  3RB4 A;  2J6S A;  4M9L A;  2KSO B;  2JH7 A;  1RYS A;  3IP4 B;  3WK5 A;  1ZQH A;  4EZ6 A;  8ICM A;  4PHD A;  2RLT A;  3RRH A;  4O3S A;  4IQW A;  2HHV A;  4RQ1 A;  4M0A A;  4QZD A;  4DL4 A;  5J8Y A;  1YZ6 A;  1NZB A;  1WCN A;  8ICY A;  1X9M A;  3SAF A;  5CHG A;  4KX3 A;  1ZQ1 C;  3RH4 A;  2HCF A;  3PR4 A;  4B9L A;  9ICS A;  4YQW A;  5IIM A;  2YMP A;  4IR1 A;  5KFG A;  3PNC A;  2DFL A;  3N97 B;  1ZQI A;  2DPJ A;  2KZM A;  3BS7 A;  1BPE A;  3M9M B;  5KG4 A;  4ED8 A;  1IIP A;  3RH5 A;  4DEZ A;  5IIO A;  2BPF A;  2ZJA A;  5KFL A;  2UVW A;  9ICX A;  1Q3U A;  1S0O A;  2FMQ A;  4C4T A;  4B9V A;  4NLC A;  4NXZ A;  4JV0 A;  3D2Q A;  4BUG A;  1X9X A;  4R65 A;  1ZOL A;  2VJ4 A;  3HJE A;  4JMU A;  4DSK A;  2XIC A;  2KJ9 A;  2PFN A;  4UQG A;  4QZE A;  1A76 A;  5KT4 A;  1TK8 A;  9ICU A;  4FS2 A;  3TI0 A;  3ZI4 A;  2BCQ A;  4UB2 A;  3A0H U;  3Q8L A;  2HBK A;  4B9S A;  2H5X A;  1V38 A;  1UA0 A;  4B6J A;  3KZI U;  1JUD A;  3SZ2 A;  1JX4 A;  3O0F A;  5TZV A;  3WKB A;  2I5H A;  4QNL A;  1KL9 A;  1AQ6 A;  2Y1I A;  3T3F A;  1ZQS A;  3AUO A;  2QB1 A;  4QWC A;  3N7R C;  3V6K A;  3H40 A;  1FO4 A;  4YP3 A;  4ZOH C;  1KW4 A;  5CR0 A;  4FE3 A;  1J2M A;  1S77 D;  3SV3 A;  4DQI A;  1OXJ A;  2EAP A;  4BXO B;  2ZIW B;  4CF4 A;  4QIW F;  2FPL A;  4P0P B;  3IRU A;  1SXD A;  1SV4 A;  4CRX A;  5AKH A;  4K4I A;  2J6U A;  1ZXI A;  2AQ0 A;  4NM1 A;  4C8L A;  4O3Q A;  9ICF A;  4P0Q A;  3EYZ A;  2K60 A;  4ED1 A;  3RJH A;  2PFP A;  3OSN A;  3RAX A;  2YN4 A;  1ZQX A;  5L9X A;  5EE1 A;  5HML A;  2ZUD A;  5KL1 B;  5EWG A;  3TAN A;  1ZJM A;  2G5I B;  5AI9 A;  1CEZ A;  5DB9 A;  4JV1 A;  5H2F U;  2ZXH A;  2W9C A;  3PW7 A;  3TQ1 A;  2C2D A;  4DSI A;  2BQU A;  4KLE A;  3DEE A;  2ASJ A;  5AM4 A;  3TAR A;  2IOF K;  4QZH A;  4F4X A;  1NOM A;  1F44 A;  1ZD5 A;  4J9O A;  2NRT A;  2KD1 A;  2IOF A;  3GII A;  9ICC A;  3C2K A;  4FO6 A;  2JZB A;  1ZQD A;  4DOA A;  3PZP A;  3KHL A;  2ISO A;  2W04 A;  5AIA A;  4O3N A;  1WCL A;  2I9G A;  1RG6 A;  1NKE A;  4IQV A;  2F1H A;  3SR6 A;  4X5V A;  3H8J A;  1NKC A;  4JUZ A;  4KMO B;  2YY6 A;  2JEJ A;  2QAR A;  3UMG A;  3OGU A;  3HP6 A;  1DGJ A;  5AM2 A;  4KLG A;  2KNJ A;  2C28 A;  5III A;  2CRX A;  2PKE A;  8ICW A;  4Z6C A;  4E0D A;  9ICE A;  3GV5 B;  3SEI A;  7ICL A;  4NLB A;  3BS5 A;  2FLP A;  5KNI A;  4NY8 A;  1SGG A;  2ZIX B;  2R8G A;  4DFP A;  2WTF A;  4PGY A;  5KT5 A;  2Y1J A;  3RJF A;  7ICF A;  5ALL A;  3M6K A;  4DSL A;  3S6J A;  2H3F A;  2KP7 A;  3G6V A;  3PO5 A;  5KFS A;  1HUZ A;  2PI4 A;  2XGP A;  3OPX A;  2MRL A;  5KFC A;  4NJ8 A;  4Y2R A;  2AGO A;  1SIJ A;  4PPX A;  2G06 A;  4ED0 A;  1S9F A;  1ZQM A;  2NV3 A;  2D3D A;  4I2J A;  1MC8 A;  1JI7 A;  2MUT B;  2K4P A;  4UB8 U;  4QZB A;  2V4R A;  3Q8S B;  2FMP A;  5T14 A;  5DDY A;  1U49 A;  2DPI A;  4DSE A;  2VJ5 A;  4RZR A;  1QH9 A;  4YMM A;  2A1J A;  3I76 A;  2F8K A;  2FJ6 A;  4M6W B;  1JMS A;  4EBD A;  3H7I A;  2XCP A;  3UPQ A;  2XC9 A;  4J9Q A;  3NVV A;  4F93 B;  2KG5 A;  1UT8 A;  2AU0 A;  3ZDE A;  4M9G A;  2M9N A;  4I2I A;  5K4L A;  2BHN A;  2P6R A;  1S0M A;  4CF5 A;  3PW4 A;  3CP8 A;  1PVR A;  3IDW A;  2AGQ A;  2F1J A;  8ICJ A;  4DOC A;  3C28 A;  1DGS A;  5KG5 A;  7ICV A;  2LI6 A;  2W9B B;  3OTQ A;  5J2C A;  2AQ4 A;  2YX8 A;  3NAS A;  3RJI A;  2DKZ A;  4IC9 A;  4HAI A;  3RR8 A;  2XID A;  2KTQ A;  1K1Q A;  4MFC A;  1IXR A;  2ATL A;  2LMR A;  1LKY B;  3C2L A;  5KFW A;  5AI5 A;  1ZRM A;  3H0R B;  1IG6 A;  4I27 A;  1NKB A;  4RPY A;  3GV7 B;  4ED2 A;  5KFM A;  5ALR A;  2XY6 A;  4JWN A;  4C0Z A;  2GWS A;  4F5O A;  2CN1 A;  1GO3 F;  1RXW A;  2C2E A;  2HHS A;  1B43 A;  4QZA A;  1V9P A;  4ECR A;  4UB6 U;  3D2S A;  5JRT A;  3JPN A;  3AM9 A;  1O08 A;  3GIM A;  3HPO A;  1ZQY A;  5DDM A;  1D8B A;  1BPB A;  4KLT A;  3UMC A;  1F0M A;  5EE3 A;  5KAF U;  4RUA A;  4EBC A;  1PK1 B;  4JWM A;  4CCH A;  5J29 A;  2LPE A;  4CGZ A;  4KLQ A;  2W3R A;  1U9L A;  4RQ6 A;  2KIV A;  4Z6D A;  9ICI A;  2FE9 A;  5KG3 A;  2ODG A;  1TK0 A;  5DB6 A;  2NRW A;  1SV0 C;  4BJQ A;  3UXP A;  1S97 A;  1BPY A;  3H0L B;  4DQP A;  2E1E A;  1URJ A;  2K4E A;  4TUR A;  5ALG A;  1ZD4 A;  3AQE A;  4OCZ A;  2JHD A;  4RQN A;  2F8L A;  2DL0 A;  4UBB A;  1KDH A;  3T5H A;  4MEX A;  3THV A;  2WAQ C;  1NK9 A;  4ECU A;  2W11 A;  1Q8K A;  9ICG A;  5KFE A;  5DG9 A;  5B5E U;  3OSP A;  1L8O A;  1Z4O A;  1VJ5 A;  2W3S A;  5KT6 A;  1X6I A;  3KKA A;  3QU9 A;  5ALY A;  4M9H A;  3JPO A;  4ICA A;  3TAQ A;  1XS9 D;  5AI8 A;  2ALZ A;  1XSN A;  9ICB A;  4Y2T A;  1Z00 B;  1X2I A;  1SWW A;  5KFJ A;  4FFD A;  4AP9 A;  3L3F X;  5IIK A;  3OHB A;  1QQ6 A;  4BWM A;  5DBB A;  2F1I A;  4KMU A;  2XGQ A;  3KHH A;  3NGD A;  1ZQG A;  4C7Y A;  1D9D A;  5C0Y A;  5KFF A;  2MA1 A;  4GLX A;  1WG8 A;  3RAQ A;  8ICL A;  5KFX A;  5C5J A;  2HSZ A;  3QU5 A;  1JXL A;  3RJE A;  4P4P A;  3UMB A;  4Y2U A;  4IR9 A;  1A77 A;  3RB6 A;  3IHQ B;  2JGA A;  2KIC A;  5ALM A;  1J97 A;  2PXI A;  1TK5 A;  1SWV A;  5ALF A;  3ZDC A;  2JEI A;  4I2B A;  8ICE A;  4DF4 A;  1NK4 A;  2R8J A;  3ZDD A;  3H8S A;  4Y2S A;  1CRX A;  2OWO A;  8ICA A;  3N28 A;  5GTH U;  1MA7 A;  1N56 A;  4ACO A;  3MFH A;  5J2G A;  1L3U A;  7ICT A;  2H3Q A;  4OO1 J;  4YFK A;  5J0W A;  3QX7 A;  1UA1 A;  4I2E A;  1ZQC A;  2ZTE A;  4PH5 A;  3QEB Z;  2E3T A;  1KLN A;  3GIK A;  2BCR A;  2C22 A;  3F5A A;  2QKQ A;  5J0R A;  5FP0 A;  1NK0 A;  2HHT A;  1NZP A;  9ICL A;  1JIH A;  2W54 A;  4OJL A;  3UQ2 A;  2R8H A;  1ZET A;  2DWQ A;  2QB0 B;  2E8N A;  2ZIV B;  5ALO A;  2HBL A;  4Z6F A;  3H8W A;  3PSI A;  7ICM A;  3BZC A;  3MR3 A;  5KFQ A;  1JN3 A;  1RQN A;  3LWM A;  5AK5 A;  2RDI A;  3WKC A;  1N61 A;  3KTQ A;  1MQ2 A;  4QZI A;  4PZO A;  1TKD A;  7ICP A;  5ALK A;  3PST A;  3VCB A;  4J9K A;  1VDV A;  4BXO A;  2ASL A;  2E8P A;  5DB8 A;  4F4Z A;  5AM0 A;  4ELT A;  2ZG6 A;  1D9F A;  4KLI A;  1S0N A;  5AK6 A;  2JR5 A;  2ZIU B;  1FIQ A;  2BQ3 A;  2AGP A;  1ZQB A;  4PHP A;  4M9J A;  2KMD A;  5KG6 A;  2WAQ F;  1QQ5 A;  5BOL A;  4CE6 A;  2AH5 A;  5F3X B;  4UB5 A;  4UBC A;  2R8I A;  4DFM A;  2ASD A;  3ZDA A;  2EDU A;  1YZ7 A;  1QSY A;  2K89 A;  4OD0 A;  4YXJ A;  4F91 B;  5KFA A;  4IRC A;  1M6Y A;  2EAM A;  4C4S A;  5AM3 A;  4UAU A;  3RH6 A;  2XVT A;  3AU2 A;  1V97 A;  3QZ8 A;  2KIW A;  5ALW A;  5IIJ A;  2HBJ A;  1NK5 A;  1PVQ A;  3B0Y A;  4USA A;  4RNN A;  3SQI A;  4I2F A;  2OH2 A;  3A0B U;  1L7N A;  5ALS A;  1BNP A;  4O3P A;  2ZXI A;  3JPS A;  3QUQ A;  3QUC A;  2WF8 A;  2J6T A;  2LM1 A;  5J2I A;  1QSS A;  2OHF A;  2D6F C;  3MR5 A;  9ICJ A;  5DLG A;  1A6S A;  2ESE A;  3IM1 A;  1SKS A;  1ED1 A;  2HOQ A;  1UQV A;  1RXV A;  4KLL A;  8ICS A;  4QZF A;  2NRX A;  4F72 A;  3LWL A;  1FFV A;  4XA5 A;  5ALZ A;  2YTU A;  3HWT A;  4A8E A;  3CW2 C;  5KFZ A;  5AKZ A;  1L7M A;  3E0F A;  3ORY A;  5GTI U;  4GC7 A;  5BOM A;  3AU6 A;  3N7S C;  4RNO A;  3ISC A;  1MSW D;  2E5S A;  2RP5 A;  1QLN A;  5AI0 A;  4DFD A;  3WKE A;  1ZQE A;  1L7P A;  1DRG A;  5AKG A;  2BCV A;  1HUO A;  1CI4 A;  8ICC A;  3HW8 A;  5EOZ A;  2H3Z A;  4US8 A;  8ICU A;  9ICW A;  4DS4 A;  2BKE A;  2W9M A;  5J2D A;  3D6J A;  4DS5 A;  1X6J A;  2MUT A;  5J2B A;  5KG7 A;  4MFA A;  5AK4 A;  4O3R A;  4KLM A;  3EZ5 A;  3PX4 A;  3RBE A;  4GC6 A;  2C2R A;  2UVV A;  3M6Z A;  4RPZ A;  2LKY A;  5KG2 A;  4C8M A;  9ICQ A;  1ZD3 A;  4ECS A;  1D8Y A;  7ICU A;  2Y0S C;  4M6W A;  5AKX A;  4EZ9 A;  3FDS A;  3NTU A;  1QQ7 A;  2DGZ A;  3GIJ A;  4I2A A;  9ICP A;  4ELV A;  4DSJ A;  1K5O A;  4F71 A;  3K1Z A;  5TIS U;  3PVX A;  4YXM A;  5AKL A;  1YT3 A;  1COK A;  5J8Y C;  3H4D A;  3UQ0 A;  4AYB C;  1N48 A;  5AKE A;  5CWR A;  7ICG A;  1BNO A;  5KT2 A;  5AKJ A;  3LVW A;  5IIN A;  4JB3 A;  3SAG A;  3L4P A;  4YMO A;  1RM6 C;  5DLF A;  1X40 A;  7ICR A;  3G6Y A;  4J03 A;  3HKZ F;  5J2J A;  3U26 A;  2G09 A;  1U47 A;  9ICM A;  3TAC B;  4DFK A;  2WFA A;  3NVZ A;  9ICA A;  4UAS A;  4I2D A;  2JXJ A;  3F2B A;  3RF9 A;  4KLO A;  4RT3 A;  4TUP A;  5G5G A;  2IOH A;  4TQS A;  4YMN A;  3J81 j;  3I1Y A;  1SXE A;  2W43 A;  1ZQQ A;  3TAD A;  1MN8 A;  2FI1 A;  8ICP A;  1C20 A;  2LYA A;  4DL5 A;  3TKA A;  2OM6 A;  3ETL A;  5DG7 A;  4BDP A;  8ICH A;  4NM2 A;  4DL3 A;  4QW9 A;  3V6H A;  2FPM A;  1BGX T;  2WB1 C;  4ED6 A;  3CNH A;  2EAN A;  1L3S A;  3PSF A;  3ZDB A;  1T7P A;  5KFU A;  4CF3 A;  2I6X A;  5CB1 A;  2VKQ A;  5J2F A;  4CDG A;  1NI3 A;  4TQR A;  1XU4 A;  3H0M B;  5E79 U;  1T94 A;  1OUQ A;  3OHA A;  1ECW A;  2LYB A;  2VAN A;  4WJ3 B;  4ECV A;  2V4Q A;  1V85 A;  3GU3 A;  3C5F A;  3HIL A;  3KOO A;  4UB3 A;  2UVR A;  4YVZ A;  1EXN A;  5AKK A;  2O6K A;  5ALT A;  2GOL A;  2EQY A;  4ECY A;  3V7J A;  1Z1B A;  2EZZ A;  8ICV A;  3C1Z A;  1L8L A;  2RHF A;  7ICE A;  1S76 D;  1NK7 A;  2XI9 A;  5ALH A;  4RPX A;  5DKW A;  4RT2 A;  2HVI A;  3SYZ A;  1ZQK A;  4NLZ A;  4NL9 A;  3K75 D;  3Q8R B;  3BQ2 A;  4J9P A;  1ZYQ A;  5DQH A;  4G9B A;  3PW2 A;  4GXI A;  2HMX A;  5ALP A;  4F5P A;  4DFJ A;  5ALI A;  4DQQ A;  4US9 A;  3ONN A;  1ZQN A;  2ZTC A;  3PSP A;  4Y2P A;  3WK6 A;  1RYR A;  4Q8E A;  4KIT B;  5CRX A;  4KN7 A;  2W7O A;  1FFU A;  3T5L A;  3RJK A;  4C8O A;  3AL0 B;  1ZRN A;  4R8U A;  4FBT A;  4F5Q A;  5HR6 A;  2DUY A;  1ARO P;  2QAR B;  4RU9 A;  2Y0S F;  5CP2 A;  2B6G A;  3KZX A;  1RYU A;  4KLH A;  4J9M A;  1NNL A;  5J0Y A;  2JEF A;  4IRK A;  4F3O A;  1ZQO A;  4PHE A;  1Z00 A;  2KN7 A;  3N4M B;  4QWE A;  5ALV A;  4DL6 A;  2YMM A;  5L1L A;  4I29 A;  2YB4 A;  3QXG A;  3NS1 A;  1WUD A;  4U6P A;  4DCC A;  1SL0 A;  4AYB F;  1LV5 A;  3ICX A;  3FYH A;  1S8O A;  2F3N A;  4RQ7 A;  3N7P D;  2JMG A;  4DWI A;  1B4F A;  2BPC A;  4Y2X A;  3NVY A;  5DBA A;  3SI8 A;  4YN4 A;  4MF2 A;  4YD2 A;  4DSF A;  2XCA A;  5KFP A;  2E1F A;  7ICI A;  2B0C A;  5CJ7 A;  2MSN A;  4RQ5 A;  2Y9T A;  3LDA A;  2P66 A;  3F5E A;  1WWV A;  2FLN A;  2KKV A;  5D49 A;  4P2H A;  3MDA A;  4XUS A;  2GLE A;  4PGX A;  4CNQ A;  2GH1 A;  5KT7 A;  4P4M A;  7ICN A;  5J0S A;  3OJS A;  2AHO B;  5B66 U;  2A1J B;  1P7D A;  4EX7 A;  4B9N A;  2KFN A;  4MFF A;  3EW9 A;  2WB1 F;  4PZN A;  4RQ0 A;  2W7P A;  1IV8 A;  1XSL A;  1Z1V A;  2F2A B;  3H4B A;  7ICK A;  4O0I A;  8ICN A;  3KD3 A;  5CEH A;  3RTV A;  4LZG A;  7ICJ A;  2KKP A;  3IG5 A;  4YD1 A;  2KSO A;  3M9O B;  3PR5 B;  1DK2 A;  3MBY A;  1ZQV A;  5J0T A;  2LHT A;  4DQS A;  2PFQ A;  5DQI A;  3TFR A;  3DDH A;  3PV8 A;  4I2H A;  5KFN A;  1JAL A;  2M0N A;  4DLG A;  2K4H A;  2YMQ A;  4KX5 A;  4YR0 A;  4ZH4 A;  2HHU A;  1XC9 A;  3ZD8 A;  4KLU A;  1NJW A;  1S0V A;  3PW5 A;  2KHQ A;  2BGW A;  3QU2 A;  4Q43 A;  2L5Y A;  2B21 A;  1C7Y A;  1L7O A;  1SZH A;  3QEA Z;  4NLK A;  3MC1 A;  3M8R A;  2BCU A;  2BPG A;  3BJY A;  4F4W A;  1QSL A;  1F5S A;  4FS1 A;  2RQ5 A;  4FZN A;  4NL9 C;  5KAI U;  3QNM A;  2ISP A;  4YR2 A;  3G6X A;  1KEJ A;  1TAQ A;  3QUB A;  2F76 X;  3DV9 A;  5A0L A;  2HHQ A;  1NJY A;  3PML A;  3HX0 A;  4QZ8 A;  1PUZ A;  4DL7 A;  7ICQ A;  3C2M A;  3LYS A;  2JH1 A;  3Q8Q B;  2NYV A;  4F4K A;  2NO4 A;  3QE9 Y;  4RQM A;  2F77 X;  4QZ9 A;  5HP4 A;  1ZD2 P;  4OJ6 A;  2R8K A;  2VIX A;  4IQT A;  4J9N A;  3AN1 A;  8ICQ A;  5KFV A;  3HRD D;  1N5W A;  3WKA A;  5AIB A;  3C5G A;  1OW5 A;  4RQ2 A;  4QWA A;  1COO A;  5D4B A;  2XO7 A;  1ZQT A;  2NRZ A;  9ICH A;  4GXJ A;  4F2R A;  1ZQJ A;  7ICS A;  4XRH A;  2EZY A;  2K8B B;  2ES6 A;  4I28 A;  3C23 A;  3VC8 A;  3SD7 A;  4R66 A;  1KRP A;  1N62 A;  8ICG A;  5DG8 A;  4F5R A;  3TAP A;  5F9L A;  5AI6 A;  1N2X A;  1UHU A;  2A1A A;  2FLL A;  2OXO A;  3MAB A;  1B0X A;  3NUQ A;  3BQT A;  5KFO A;  4C8N A;  1Z4N A;  5IIL A;  7ICO A;  1NK8 A;  5J0O A;  1X42 A;  2P6U A;  1QTM A;  2PI5 A;  2ZIW A;  5KL8 B;  2H3I A;  4EYI B;  4P0P A;  1BPD A;  4O3O A;  2FDR A;  1KQQ A;  1S5L U;  5J2K A;  1XWL A;  5KFK A;  3JPR A;  4DOB A;  1TE2 A;  1VLB A;  5DGA A;  3RJJ A;  2DF4 B;  1TAM A;  1KKX A;  3UXO A;  1ZJN A;  4MHV A;  3HKZ C;  2N1R A;  3LK9 A;  3UXN A;  1B22 A;  5HNK A;  5J0Q A;  1T8E A;  3C1Y A;  9ICN A;  3H8M A;  2WF9 A;  2YB1 A;  2W55 A;  2VA8 A;  1KFT A;  1KFD A;  5DBC A;  1T3Q A;  3WK4 A;  4IS7 A;  4O3M A;  1PVP A;  1T4G A;  3GFK B;  4UB1 A;  1WYG A;  1XO0 A;  3KKA C;  4MEY A;  2HHX A;  2QLT A;  3MGI A;  4IRD A;  2G07 A;  4U7C A;  3BZK A;  3MDC A;  3ALR A;  4ECT A;  1ZQZ A;  4M9N A;  4PGQ A;  4NWI A;  3HT3 A;  4M04 A;  4PL2 A;  4J9R A;  5EWF A;  1XSP A;  4O5C A;  4KLS A;  3Q8P B;  3JPT A;  3PW0 A;  1RZT A;  2Z7J A;  4PHA A;  1SKR A;  2BZF A;  2PMZ C;  2Q0Z X;  5D46 A;  2K4I A;  2AJQ A;  4FZL A;  4BGD A;  1HEK A;  1ZQP A;  3SMV A;  5AI4 A;  1HJP A;  2FMS A;  3D2N A;  5AK3 A;  2LBO A;  3IN5 A;  1WWU A;  2ZIX A;  2I1Q A;  2IMW P;  4M47 A;  4F2S A;  4QZC A;  1X66 A;  4QWB A;  2UVU A;  4UB4 A;  2HOI A;  4IL6 U;  1SZP A;  5EE0 A;  1H38 A;  4B9U A;  4UAV A;  4PJ0 U;  3QU4 A;  2KV2 A;  4J9L A;  5J2H A;  4GIB A;  1Z3E B;  2KJ8 A;  4LVS A;  2HDO A;  3K4G A;  2IHM A;  1L6N A;  4JV2 A;  3WU2 U;  8ICB A;  4YCX A;  4KLF A;  2KOB A;  4JK1 A;  4OJP A;  3GQC A;  5AIC A;  1L3V A;  2G08 A;  3PO4 A;  1LB2 B;  2LYH A;  2PFO A;  4NV0 A;  5AKI A;  4XQ8 A;  1RPL A;  3K1R B;  8ICK A;  3EWA A;  3KFU F;  2CPR A;  1TAU A;  4OJ5 A;  2KEY A;  2H3V A;  4Q8F A;  3PY8 A;  3MGV A;  3FAH A;  5HHH A;  3L5K A;  1KFS A;  2BR0 A;  5KFD A;  2KZZ A;  4C7Z A;  3MR2 A;  2W8L A;  2W8K A;  1KN5 A;  2G0A A;  2W9B A;  3EUB 2;  4OJO A;  2HOF A;  1UPH A;  4QZG A;  4DQR A;  3ISB A;  3NRW A;  5ALU A;  1PK3 A;  2HW3 A;  3M7D A;  1SB3 C;  4Z6E A;  2VA3 A;  2ZUB A;  4ECZ A;  1FEZ A;  5F9N A;  1LKY A;  3WK9 A;  4MF8 A;  5BPC A;  1Q46 A;  4O5K A;  3UM9 A;  2IHN A;  1K1S A;  4Y2Q A;  1N5X A;  1SV0 A;  3QU7 A;  5J2E A;  4Y2V A;  5AM5 A;  2ZUC A;  3E58 A;  1IM4 A;  3WK8 A;  2HBM A;  3C21 A;  3C29 A;  1TVA A;  4DF8 A;  5KT3 A;  1MQ3 A;  3GIL A;  4FBU A;  4P0Q B;  2IBK A;  8ICI A;  2BDU A;  4KLJ A;  5J0U A;  4G3I A;  2PMZ F;  4R63 A;  5ALD A;  1PK1 A;  3M8S A;  2BQR A;  4LJX A;  5HHI A;  4UAW A;  2CXY A;  2D8C A;  5L1M A;  5G5H A;  2JV3 A;  4UAY A;  7ICH A;  1D8L A;  5J0X A;  2F44 A;  4TUS A;  4UW9 A;  1RDF A;  2W9A A;  4ECW A;  1ZQF A;  2W9C B;  3QYP A;  3T5J A;  2VA2 A;  3BQ0 A;  2HHW A;  2OEH A;  1Z19 A;  8ICZ A;  3RRG A;  9ICT A;  2E8O A;  1DK3 A;  3F53 A;  1PZN A;  2JZB B;  4F50 A;  1L3T A;  3EPI A;  1NK6 A;  3B9J A;  1KSP A;  3V72 A;  1TV9 A;  2BCS A;  8ICO A;  5AM1 A;  3WKD A;  1ZQW A;  4F5N A;  5L1K A;  4EEK A;  2KFZ A;  3NRZ A;  4J9S A;  3M1Y A;  3RFA A;  4K4G A;  4NLN A;  3AEV A;  4ECX A;  3Q8K A;  3I28 A;  2YQE A;  3IV6 A;  2V9W A;  2EH9 A;  2NO5 A;  1S10 A;  4HYK A;  4F4Y A;  3NVW A;  2A19 A;  2KE7 A;  2YML A;  1QCK A;  1DOQ A;  4O9M A;  4QJF B;  2WF7 A;  2KHV A;  2XY5 A;  2JEG A;  5KFY A;  3RB0 A;  3V6J A;  4EEL A;  3BS5 B;  1JXE A;  8ICT A;  3KHG A;  1ZQU A;  1U48 A;  1T3N A;  5L1I A;  3SV4 A;  1HIW A;  3E2E A;  2EAO A;  1NJZ A;  3GZF A;  2KVC A;  1Y88 A;  3RJG A;  2DBY A;  4P4O A;  1UT5 A;  5EWE A;  3RB3 A;  3QZ7 A;  4UAT A;  2ZJ8 A;  2EZX A;  3CRX A;  2WHE A;  1SL2 A;  4C4R A;  3QUT A;  4UAZ A;  4EX6 A;  2FPK A;  2P35 A;  3B0X A;  4ECQ A;  2K8A A;  3KHR A;  5KG0 A;  5AHX A;  4C8K A;  3MR6 A;  4EEY A;  2KVS A;  5L1J A;  5KFH A;  3FC4 A;  1ZQR A;  1DXS A;  3M9N B;  5JU5 A;  2WF6 A;  1U45 A;  5ALQ A;  1SL1 A;  2OYY A;  4ED3 A;  2W03 A;  3TAD C;  4DO9 A;  4RQ4 A;  1UCV A;  3BQ1 A;  4EBE A;  4DL2 A;  3PMN A;  5KFR A;  4KLD A;  3PX6 A;  2MAX A;  4QW8 A;  3ZD9 A;  3T79 A;  3IG8 A;  3ETR A;  5ALJ A;  4DLE A;  5DB7 A;  3WK7 A;  3AQF A;  4Y2Y A;  2QB0 A;  2E8M A;  4F8R A;  3T5K A;  2ZIV A;  3F2D A;  4GFJ A;  2KK0 A;  1N63 A;  3KBB A;  3GDX A;  3MGH A;  2A3V A;  2AXT U;  4R64 A;  2HI0 A;  2DKX A;  4Q44 A;  4RNM A;  1BPX A;  2R18 A;  2LM4 A;  2GO7 A;  2RDJ A;  3PX0 A;  1ZQL A;  2WF5 A;  4ELU A;  4Q45 A;  3FM9 A;  4RUC A;  4R8U B;  4B9M A;  5ALN A;  4FZM A;  3LVV A;  3EPG A;  4BWJ A;  5KG1 A;  1O03 A;  5ALX A;  4UAR A;  3SEN A;  2JRZ A;  4M2Y A;  1LVH A;  3AMZ A;  3MFI A;  4B9T A;  3RR7 A;  5HR7 A;  1A0P A;  1X9S A;  5EE9 A;  2ZIU A;  5AKY A;  5KTQ A;  1KBU A;  1KTQ A;  5CA7 A;  3V7L A;  9ICR A;  3JPQ A;  2DQN B;  1JRO A;  2NRV A;  3TFS A;  3GV8 B;  4Y2J A;  1BVS A;  1RQL A;  5KFB A;  4F92 B;  3JPP A;  8ICF A; 
#chains in the Genus database with same CATH homology
 1LKY B;  1SXD A;  1SV4 A;  1Z1V A;  2ESE A;  1X40 A;  2F44 A;  1OW5 A;  1UQV A;  3BS7 A;  3K1R B;  3TAC B;  2K60 A;  4NJ8 A;  4PZO A;  1DXS A;  2ES6 A;  3BQ7 A;  5JU5 A;  5JRT A;  2YTU A;  2KSO A;  1SXE A;  2E8O A;  2D3D A;  2E8P A;  3TAD C;  1JI7 A;  3TAD A;  1UCV A;  2K4P A;  2QAR B;  2Y9U A;  1X9X A;  2B6G A;  1B0X A;  1F0M A;  1PK3 A;  1PK1 B;  2EAN A;  2KMD A;  2F8K A;  2QB0 A;  2E8M A;  2LPE A;  1WWU A;  5F3X B;  2L5Y A;  1LKY A;  2F3N A;  2KIV A;  2KG5 A;  2DKX A;  2FE9 A;  2KE7 A;  1B4F A;  1V38 A;  1X66 A;  1V85 A;  2EAM A;  1SV0 C;  3HIL A;  1SV0 A;  5JTI A;  4NL9 C;  3IDW A;  2KSO B;  3BS5 B;  4MHV A;  1RG6 A;  2Y9T A;  3SEN A;  1WWV A;  4RQN A;  2DL0 A;  2EAO A;  3H8M A;  2QAR A;  2QKQ A;  2GLE A;  2DKZ A;  2QB1 A;  1COK A;  5J8Y C;  5J8Y A;  1KW4 A;  4IS7 A;  1PK1 A;  3SEI A;  4RQM A;  2QB0 B;  1OXJ A;  2EAP A;  3BS5 A;  5KNI A;  2E8N A;  1SGG A;  4NL9 A;  3KKA C;  2D8C A;  2LMR A;  3KKA A;  5L1M A;  2JV3 A;  4PZN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...