5JSBB

Crystal structure of mcl1-inhibitor complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
116
structure length
116
Chain Sequence
b'DPKKVLDKAKDQAENRVRELKQVLEELYKEARKLDLTQEMRKKLIERYAAAIIRAIGDINNAIYQAKQEAEKLKKAGLVNSQQLDELLRRLDELQKEASRKANEYGREFELKLEYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Induced myeloid leukemia cell differentiation protein Mcl-1
publication title Computationally designed high specificity inhibitors delineate the roles of BCL2 family proteins in cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein/inhibitor
total genus 50
structure length 116
sequence length 116
chains with identical sequence D, F, H, J, L
ec nomenclature
pdb deposition date 2016-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.20 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 5jsbB00
1EK8A 1ISEA 1IS1A 4KC6A 1WQGA 4KAWX 1WQHA 4KDDA 4OYDB 4KB2A 1EH1A 4JLRC 3LHPS 1Y698 3LF9A 1WQFA 4GFQA 1DD5A 5JSNB 5JSBB 1GE9A 5MLC9 4L8IA 4KB4A
chains in the Genus database with same CATH superfamily
2YU9A 3GTJA 1TWFA 1EJ9A 3GTLA 1A35A 3GTOA 2R4GA 4O26A 2BE5D 1TWHA 3LHPS 1Y698 1Q8IA 2A6HD 4NOMA 3P9AA 4D3ZA 4QIWA 1SFOA 5C9HA 4D3YA 4QCLA 1K4TA 1Y1VA 3GTKA 4FYDA 1EK8A 4F3EA 3K5LA 2R7ZA 4NOKA 1WQGA 3HKZA 1R49A 2O5JD 1WQHA 2A68D 2NVYA 4OYDB 1NH3A 3GTGA 2A6ED 1SEUA 1DD5A 4AYBA 1T8IA 1IW7D 4IP9A 2WAQA 5JSBB 1TWGA 1SC7A 1RR8C 4Q5VA 1GE9A 4NOLA 3SJRA 4KB4A 3DU5A 1WCMA 5MLC9 3GTPA 3MAQA 2JA5A 4H3TA 1TWAA 4Q5GA 3DU6A 3K58A 4KAWX 2VUMA 3K5OA 1V9MA 2A69D 1TL8A 3IAYA 4AN8A 4JLRC 1K83A 3WVOA 4GFQA 1SMYD 3M4AA 1R9TA 1ZYRD 2E2IA 3GTMA 4FGUA 3CQZA 2WB1A 1I6VD 5JSNB 2JA7A 4IP8A 1K4SA 1MIUA 1RRJA 3K57A 2B9SB 2PMZA 1TWCA 2R92A 4L8IA 2Y0SA 1A36A 1YNJD 1ISEA 3KYLA 3GTQA 2R93A 1IS1A 4LMOA 4KC6A 1LPQA 4EJ3A 1HQMD 4KB2A 1EH1A 3H0GA 4FXDA 3LF9A 1WQFA 1I50A 5CQGA 1R5ZA 3K59A 4C2MA 3FKIA 3K5NA 3K5MA 4AHCA 1A31A 1TGOA 1I3QA 2B63A 2E2HA 2NVXA 1Y1WA 1YNND 4KDDA 2JA6A 2F4QA 2CW0D
chains in the Genus database with same CATH topology
2YU9A 3GTJA 1TWFA 1EJ9A 3GTLA 1A35A 3GTOA 2R4GA 4O26A 2BE5D 1TWHA 3LHPS 1Y698 1Q8IA 2A6HD 4NOMA 3P9AA 4D3ZA 4QIWA 1SFOA 5C9HA 4D3YA 4QCLA 1K4TA 1Y1VA 3GTKA 4FYDA 1EK8A 4F3EA 3K5LA 2R7ZA 4NOKA 1WQGA 3HKZA 1R49A 2O5JD 1WQHA 2A68D 2NVYA 4OYDB 1NH3A 3GTGA 2A6ED 1SEUA 1DD5A 4AYBA 1T8IA 1IW7D 4IP9A 2WAQA 5JSBB 1TWGA 1SC7A 1RR8C 4Q5VA 1GE9A 4NOLA 3SJRA 4KB4A 3DU5A 1WCMA 5MLC9 3GTPA 3MAQA 2JA5A 4H3TA 1TWAA 4Q5GA 3DU6A 3K58A 4KAWX 2VUMA 3K5OA 1V9MA 2A69D 1TL8A 3IAYA 4AN8A 4JLRC 1K83A 3WVOA 4GFQA 1SMYD 3M4AA 1R9TA 1ZYRD 2E2IA 3GTMA 4FGUA 3CQZA 2WB1A 1I6VD 5JSNB 2JA7A 4IP8A 1K4SA 1MIUA 1RRJA 3K57A 2B9SB 2PMZA 1TWCA 2R92A 4L8IA 2Y0SA 1A36A 1YNJD 1ISEA 3KYLA 3GTQA 2R93A 1IS1A 4LMOA 4KC6A 1LPQA 4EJ3A 1HQMD 4KB2A 1EH1A 3H0GA 4FXDA 3LF9A 1WQFA 1I50A 5CQGA 1R5ZA 3K59A 4C2MA 3FKIA 3K5NA 3K5MA 4AHCA 1A31A 1TGOA 1I3QA 2B63A 2E2HA 2NVXA 1Y1WA 1YNND 4KDDA 2JA6A 2F4QA 2CW0D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EK8 A;  1ISE A;  1IS1 A;  4KC6 A;  1WQG A;  4KAW X;  1WQH A;  4KDD A;  4OYD B;  4KB2 A;  1EH1 A;  4JLR C;  3LHP S;  1Y69 8;  3LF9 A;  1WQF A;  4GFQ A;  1DD5 A;  5JSN B;  5JSB B;  1GE9 A;  5MLC 9;  4L8I A;  4KB4 A; 
#chains in the Genus database with same CATH topology
 2YU9 A;  3GTJ A;  1TWF A;  1EJ9 A;  3GTL A;  1A35 A;  3GTO A;  2R4G A;  4O26 A;  2BE5 D;  1TWH A;  3LHP S;  1Y69 8;  1Q8I A;  2A6H D;  4NOM A;  3P9A A;  4D3Z A;  4QIW A;  1SFO A;  5C9H A;  4D3Y A;  4QCL A;  1K4T A;  1Y1V A;  3GTK A;  4FYD A;  1EK8 A;  4F3E A;  3K5L A;  2R7Z A;  4NOK A;  1WQG A;  3HKZ A;  1R49 A;  2O5J D;  1WQH A;  2A68 D;  2NVY A;  4OYD B;  1NH3 A;  3GTG A;  2A6E D;  1SEU A;  1DD5 A;  4AYB A;  1T8I A;  1IW7 D;  4IP9 A;  2WAQ A;  5JSB B;  1TWG A;  1SC7 A;  1RR8 C;  4Q5V A;  1GE9 A;  4NOL A;  3SJR A;  4KB4 A;  3DU5 A;  1WCM A;  5MLC 9;  3GTP A;  3MAQ A;  2JA5 A;  4H3T A;  1TWA A;  4Q5G A;  3DU6 A;  3K58 A;  4KAW X;  2VUM A;  3K5O A;  1V9M A;  2A69 D;  1TL8 A;  3IAY A;  4AN8 A;  4JLR C;  1K83 A;  3WVO A;  4GFQ A;  1SMY D;  3M4A A;  1R9T A;  1ZYR D;  2E2I A;  3GTM A;  4FGU A;  3CQZ A;  2WB1 A;  1I6V D;  5JSN B;  2JA7 A;  4IP8 A;  1K4S A;  1MIU A;  1RRJ A;  3K57 A;  2B9S B;  2PMZ A;  1TWC A;  2R92 A;  4L8I A;  2Y0S A;  1A36 A;  1YNJ D;  1ISE A;  3KYL A;  3GTQ A;  2R93 A;  1IS1 A;  4LMO A;  4KC6 A;  1LPQ A;  4EJ3 A;  1HQM D;  4KB2 A;  1EH1 A;  3H0G A;  4FXD A;  3LF9 A;  1WQF A;  1I50 A;  5CQG A;  1R5Z A;  3K59 A;  4C2M A;  3FKI A;  3K5N A;  3K5M A;  4AHC A;  1A31 A;  1TGO A;  1I3Q A;  2B63 A;  2E2H A;  2NVX A;  1Y1W A;  1YNN D;  4KDD A;  2JA6 A;  2F4Q A;  2CW0 D; 
#chains in the Genus database with same CATH homology
 2YU9 A;  3GTJ A;  1TWF A;  1EJ9 A;  3GTL A;  1A35 A;  3GTO A;  2R4G A;  4O26 A;  2BE5 D;  1TWH A;  3LHP S;  1Y69 8;  1Q8I A;  2A6H D;  4NOM A;  3P9A A;  4D3Z A;  4QIW A;  1SFO A;  5C9H A;  4D3Y A;  4QCL A;  1K4T A;  1Y1V A;  3GTK A;  4FYD A;  1EK8 A;  4F3E A;  3K5L A;  2R7Z A;  4NOK A;  1WQG A;  3HKZ A;  1R49 A;  2O5J D;  1WQH A;  2A68 D;  2NVY A;  4OYD B;  1NH3 A;  3GTG A;  2A6E D;  1SEU A;  1DD5 A;  4AYB A;  1T8I A;  1IW7 D;  4IP9 A;  2WAQ A;  5JSB B;  1TWG A;  1SC7 A;  1RR8 C;  4Q5V A;  1GE9 A;  4NOL A;  3SJR A;  4KB4 A;  3DU5 A;  1WCM A;  5MLC 9;  3GTP A;  3MAQ A;  2JA5 A;  4H3T A;  1TWA A;  4Q5G A;  3DU6 A;  3K58 A;  4KAW X;  2VUM A;  3K5O A;  1V9M A;  2A69 D;  1TL8 A;  3IAY A;  4AN8 A;  4JLR C;  1K83 A;  3WVO A;  4GFQ A;  1SMY D;  3M4A A;  1R9T A;  1ZYR D;  2E2I A;  3GTM A;  4FGU A;  3CQZ A;  2WB1 A;  1I6V D;  5JSN B;  2JA7 A;  4IP8 A;  1K4S A;  1MIU A;  1RRJ A;  3K57 A;  2B9S B;  2PMZ A;  1TWC A;  2R92 A;  4L8I A;  2Y0S A;  1A36 A;  1YNJ D;  1ISE A;  3KYL A;  3GTQ A;  2R93 A;  1IS1 A;  4LMO A;  4KC6 A;  1LPQ A;  4EJ3 A;  1HQM D;  4KB2 A;  1EH1 A;  3H0G A;  4FXD A;  3LF9 A;  1WQF A;  1I50 A;  5CQG A;  1R5Z A;  3K59 A;  4C2M A;  3FKI A;  3K5N A;  3K5M A;  4AHC A;  1A31 A;  1TGO A;  1I3Q A;  2B63 A;  2E2H A;  2NVX A;  1Y1W A;  1YNN D;  4KDD A;  2JA6 A;  2F4Q A;  2CW0 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...