5K4IA

Crystal structure of erk2 in complex with compound 22
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
350
structure length
336
Chain Sequence
AGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADTRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of (S)-1-(1-(4-Chloro-3-fluorophenyl)-2-hydroxyethyl)-4-(2-((1-methyl-1H-pyrazol-5-yl)amino)pyrimidin-4-yl)pyridin-2(1H)-one (GDC-0994), an Extracellular Signal-Regulated Kinase 1/2 (ERK1/2) Inhibitor in Early Clinical Development.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 1
total genus 116
structure length 336
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2016-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5k4iA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5k4iA01
3R9HA 1T45A 3QXPA 4FG8A 2YM8A 3UIBA 4BI0A 1YWRA 5FEEA 4IDVA 2WAJA 4XMOA 3E7OA 4E5AX 2ETKA 2YIRA 3DXPA 2W1EA 5L2IA 1RQQA 3DBQA 4QYEA 4DLIA 3DJ5A 2UW8A 2X7GA 2VTIA 3NDMA 4IE9A 4NK9A 3LFAA 5LMAA 3TNHA 3MTLA 4A9RA 5IUIA 2PE2A 2WTKB 4MD8E 3WARA 3QRJA 4BL1A 2XKCA 2XA4A 2OWBA 3T8OA 1IRKA 3OT3A 4H3BA 1FMKA 4JRVA 5FUTA 1VYWA 1FINA 4RJ7A 3W2SA 2C3IB 4OTPA 3MBLA 3KF7A 4LQMA 2PMNX 5A4TA 3DQWA 2XM8A 3ACJA 1XH6A 2C6KA 2V22A 2X2MA 3NWWA 2HWOA 3T3VA 4YO6A 4G3DA 2F9GA 2WEIA 4NFMA 4C4IA 4IX4A 3F3UA 5IISA 2F7EE 3KY2A 5HTIA 2OBJA 3LLAA 3N4UA 3GP0A 4PRJA 2PVYA 3O17A 2IPXA 2BILB 4QTCA 4KKHA 5HO7A 1J7IA 5L3AA 3BX5A 2B0QA 4QMOA 3E88A 4IVAA 4PL4A 4XOZA 1XO2B 2R3JA 2CDZA 4MNEA 5CVHA 3RPRA 4BI2A 4F1MA 2JKKA 1PRYA 5HTCA 3H9RA 3NZ0A 3QTQA 4TY1A 4RFZA 3R7VA 2RFSA 3LQ3A 2JITA 3NMUF 3G33A 4DTKA 1M17A 4YUQA 5HX6A 4EZ3A 3EHAA 4IVCA 4IXPA 5CLPA 1P2AA 3SG8A 5IEVA 2OF2A 4J95A 4GFGA 4R7HA 5K0KA 3D83A 3KRWA 3GXLA 2OJ9A 5E8VA 1MRYA 2BTSA 3NGAA 5TR6A 4FEXA 2WMRA 3PLSA 3QGWA 4XS2A 4BBEA 5LMBA 4RX5A 1PMEA 1WBWA 4OTIA 4ZY5A 2W4KA 4ZSEA 4C2VA 4JDKA 4TYHB 3OG7A 2FYSA 3O0GA 3FXZA 1V1KA 5E92A 3TL8A 4ZK5A 3AXWA 3SDJA 4QMZA 4DLJA 4DA5A 2XNPA 3VO3A 3POOA 4IHPA 4AN3A 3ORLA 2E9VA 4PWNA 2JAMA 4GUBA 4RIWB 4U3ZA 4D9TA 4K0YA 3W10A 3BI6A 2ZDUA 2HY81 3HL7A 1UWHA 2PUIA 2GNIA 3ZFXA 4EBVA 4FIGA 1OB3A 5CANA 3KB7A 4AXAA 2AC3A 4GKHA 2PWLA 2PVJA 2XEYA 3T9IA 4RC2A 5HU9A 1OM1A 3BEGA 4QMLA 4F6UA 3WYXA 3LMIA 5LVLA 5JRSA 3RKBA 5L4QA 4R77A 4F70A 4KRDA 3MVHA 5EH0A 3RALA 4TYEA 3EYHA 5E90A 3EL8A 4AQCA 1F3MC 1YQJA 1O9UA 3CTQA 5FLFA 4FGRA 4J97A 3KEXA 4FT9A 3EQGA 4OT5A 5JMSA 4FIJA 4RX9A 2QC6A 2XK3A 2ZM1A 5E8WA 4AZVA 2NP8A 4JDIA 4Y83A 5BVOA 4I23A 4FTRA 1UVRA 4BTKA 1JVPP 4FTIA 3DAJA 4QMYA 5JH6A 3VUMA 4C57A 5AR5A 3OOGA 4FIFA 3KXXA 3FLYA 3PSBA 3AD4A 4F65A 1DM2A 5AP7A 2GHLA 4FV0A 3D7ZA 2BUJA 3C5UA 4CCBA 2J0KA 4QP9A 2GS6A 3GCUA 2E9OA 5HIEA 5J1WA 1U5RA 3FWQA 3LE6A 1APME 2WQEA 4I21A 4I5MA 4XLIA 5IF1A 3HA6A 2RF9A 3TV4A 4NTSA 2IN6A 2QCSA 4AAAA 2V7OA 2IZUA 3U51A 1ZY4A 1Y8YA 4UV0A 5AA8A 2WMWA 4EH5A 4I94A 5FTQA 3OOMA 3BU3A 2G1TA 3DFCB 2Y6OA 4GUEA 2OH0E 2UZEA 4DEGA 4EOQA 3ORNA 2PULA 1O6YA 4NM3A 3WZJA 1OL1A 3MA3A 3HVCA 5CS6A 3P23A 5M55A 2C1BA 5ANGA 1B38A 5AR2A 5DH3A 3LXKA 4CEGA 2R0UA 2WO6A 5LWNA 3UDBA 4JJRA 2WD1A 3PXQA 4L43A 4X2JA 4ZAUA 3CSVA 2PU8A 2JDVA 1WFCA 2VTTA 5CSHA 3ALOA 3RVGA 4C38A 1H1SA 2YM6A 4RIOA 2WXVA 4JR3A 4DGLC 5CTPA 3HKOA 4CFNA 5AR8A 3DTCA 4EH7A 1NY3A 4ITJA 3IW5A 3VIDA 4MEDA 1PKGA 4ANOA 3Q4CA 5EDPA 5L2SA 4Z16A 4AX8A 4O83A 4RVKA 3CGOA 5ANDA 4EZ5A 5DPVA 4F9YA 4L7SA 4UWBA 3DKOA 1DI9A 5DRBA 3UTOA 1L8TA 4P90A 4C62A 1ZOEA 3F69A 5CF5A 5DA3A 4AWIA 2JAVA 3KK8A 4E73A 4II5A 3GCVA 2PL0A 3IK3A 4DEBA 2PMLX 4FTQA 4UY9A 4BDHA 3PP1A 2UW9A 1JBPE 2OF4A 5EDRA 2FH9A 1W7HA 2OJGA 3LOKA 4U42A 3JVSA 4JG6A 3EWHA 2PMOX 4TYIA 4M0ZA 3CIKA 3VBVA 3V01A 4D4YA 1VEBA 4EK8A 3MFSA 4C3FA 4DGGA 3I1AA 3BU6A 4CRLA 4RWIA 2YIXA 2ITNA 3D0EA 1J3HA 4FX3A 3NNVA 4EOSA 3I5ZA 2RKUA 3PIZA 1CM8A 3WBLA 2P33A 4UXLA 3DZQA 4KIPA 4DEEA 4F9WA 4QP4A 4L01A 5B0XA 3GC7A 5AAFA 1CMKE 2GU8A 4X6QC 4RC4A 4IZYA 4AUAA 1OUYA 4R3RA 3IKAA 4N70A 4ALUA 2QOCA 1GIIA 4GV1A 4UWCA 4X6RA 3F2AA 4JBPA 3TKUA 4DGOA 2GS7A 3R04A 4E4MA 4M67A 4OW8A 4DHFA 3NNUA 3RPYA 5M44A 4IJPA 1VZOA 5DGZA 1LEWA 1WVWA 4Y72A 3CJGA 3QHWA 2B9FA 2IZSA 3MYGA 4FSNA 1FGIA 3CBLA 1LR4A 3OXTA 4Y73A 3JVRA 4QMXA 5CI6A 4RSSA 5ANOA 3M42A 3A99A 2XIXA 3GB2A 5J9ZA 2OGVA 3CGFA 5AP6A 3GOKA 4D4VA 2VWVA 2BCJA 4UZHA 1FMOE 5HE2A 3OTUA 4U41A 3VVHA 4EHVA 5H8EA 4O7TA 2UVYA 2XUUA 2ONLA 3I0OA 2PTKA 3GU8A 1R0EA 4F9AA 1XQZA 4ZMEA 3UZRA 4QYFA 2Y4PA 2YCSA 4BN1A 4O7VA 4ZTSA 1YOLA 3BWJA 1KE8A 4YU2A 2VGPA 3PJCA 2C4GA 5CU0A 2X8DA 1UU8A 3VRYA 4CFUA 3GCQA 1FGKA 4PF4A 3WF9A 4BZDA 4UMUA 2ESMA 3II5A 3PPJA 4D58A 5EKNA 3RAKA 5EM5A 5D41A 2ZMDA 3LCDA 3MH3A 5L6WL 3DAKA 3QQLA 4APPA 4EEVA 3E93A 2GS2A 3M2WA 4FBXA 5IA5A 3QRUA 1Q5KA 5EHOA 5ACKA 3D5WA 2CLXA 3KGAA 3SRVA 3HX4A 5BUEA 2O0UA 3Q9YA 4UXQA 5DEYA 2KULA 3MVJA 3RPSA 3PVGA 1CSNA 2W17A 4EH6A 5DMZA 4FZAB 1VJYA 5M57A 4IAAA 5HKMA 5CAVA 4RBLA 1Q8YA 1NVRA 4YPDA 2WGJA 4AW5A 3UP7A 3BYVA 3GEQA 1GAGA 2BHHA 2XBAA 3VQUA 2F7ZE 3DB8A 2IVTA 3TIYA 5FQDC 3DJ7A 3LCOA 3QD4A 3V5QA 4N57A 2HWPA 3VULA 4YZCA 3L1SA 3CCNA 4YO4A 4AGCA 3U55A 1F5QA 3ZO1A 4IZ7A 2R3LA 3DY7A 3NYXA 1URCA 2HAKA 2XYUA 1WBVA 3HMOA 1W0XC 4U6RA 4FV9A 5FTOA 3R9DA 4DINA 2PZPA 3R1QA 3T9TA 4YJUA 4C4EA 2RL5A 4HYIA 4EOLA 5HCYA 3NX8A 4NJDA 1BMKA 1DS5A 4YHJA 3ZEPA 4WNPA 3KXMA 5AV4A 4JAJA 2IWIA 4LGDA 2I0YA 5FEDA 3AMBA 2BFYA 4IWOA 5KHXA 2E9NA 4U3YA 2GMXA 1Q99A 4ANSA 4LV5A 2P2HA 2FA2A 5L8LA 1IG1A 5AUTA 3P7AA 4GEOA 1XH8A 1QMZA 4H1JA 4E20A 4J96A 3NYVA 4KBKA 3ZM4A 3LIJA 1PKDA 5AV2A 3PXZA 5HZNA 1F0QA 5LJJA 2OU7A 5CXZA 4K33A 3IW4A 4PTEA 5C4LA 3HP2A 2VWZA 2HZ4A 3FC1X 4B6LA 1V0OA 2ZM4A 3LAUA 4F6WA 4TN6A 2B54A 2HZNA 3IPHA 3TNPC 3UIMA 3O96A 3VS4A 3KRRA 5KMNA 4USEA 3FMKA 1Z57A 5EK7A 5ETCA 2FB8A 4DBNA 4G3GA 4HGTA 4QO9A 2QG7A 4BY9E 3R7IA 2YWVA 2PSQA 4D1XA 4DG3E 4AGUA 2PVFA 4U81A 4J8MA 1I44A 4UYNA 3ZLYA 4NEUA 3DLZA 2CKPA 1YDRE 4U80A 4B99A 1ZZ2A 4A07A 4ACHA 3N51A 4BTMA 3PJ2A 3MB6A 2XNBA 2BDWA 2VTAA 4JS8A 5B7VA 1OPLA 5AJQA 4CV8A 3SA0A 4X21A 5AX9A 4GIIA 4IW0A 4YC6A 5HVKA 4F09A 3DK7A 1PXLA 2JDOA 3GU5A 1PYXA 1PMVA 2XK6A 3ZFMA 4HVHA 4FG9A 4JBVA 4G6LA 3KN5A 1U46A 2VWBA 3R1YA 1YXTA 2HW6A 4KIKB 2VV9A 3QAME 5KMIA 3DNEA 5KKRC 4USFA 1KV2A 5KMKA 3MGYA 4F63A 1ZOHA 3W2PA 2RFEA 4E6DA 1WBSA 3LJ0A 5EM6A 3R8VA 4CGAA 4IC7A 4FTJA 1ZWSA 3IW8A 4MX9A 4MXAA 2UVXA 3ULIA 3FY0A 1H0WA 4Q5HA 1JSVA 2R3MA 4FKIA 3PFQA 5IQFA 2EWAA 4FKWA 3JXWA 4MD9E 3ZXTA 5K4JA 3RZBA 1R1WA 1HCLA 4D4SA 2VRXA 3OD6X 2JFLA 3I6WA 4O7LA 4BCQA 4Q9ZA 3FMDA 4EK6A 2AC5A 2H9VA 3OCSA 2WB8A 3V6RA 4FZ6A 4TYHA 4S32A 2GPHA 2VN9A 2CNVA 2ERZE 2RIOA 3ROCA 2ETRA 2OO8X 5I3OA 4IX5A 1R0PA 1S9JA 1W8CA 4FIIA 4G9RA 3QD0A 3IS5A 3FLWA 5CF8A 1J1BA 2VD5A 4TWCA 2Z8CA 3DDQA 3ALNA 3CS9A 3A4PA 3TTIA 3OCGA 2VAGA 5CALA 4FV7A 2C6EA 3MH1A 3P86A 4KSPA 2GNGA 3G2FA 4L67A 5HBEA 1NT2A 3OP5A 3OUKA 3TEIA 2VWUA 1CKJA 4DH5A 2CKEA 5A4QA 4DT8A 1MUOA 5HORA 4BGGA 5H8GA 3F5PA 2JEDA 3C51A 3KA0A 4OBQA 2YIQA 3EFLA 4FNXA 5JKGA 3RJCA 2UW0A 4ZTNA 2C68A 1OI9A 4I41A 4CFWA 3RGFA 2JIIA 4XX9A 1JSTA 3NUPA 4AT5A 3VAPA 4FUXA 4XG8A 4OAVB 3W18A 4YJNA 1A06A 1FVTA 3IOKA 4XG3A 5L2TA 2VWYA 2R5TA 4DYMA 2BDJA 3TIZA 2QODA 5DT0A 3ID6C 2ZB1A 3R1NA 4S30A 3UOHA 3AG9A 3LXLA 3QRTA 2WELA 2XNEA 2RG5A 3ORZA 4FTAA 4YPSA 3UVPA 2JGZA 4IWDA 3E63A 4IH8A 4QP7A 4C4FA 5FTGA 1YOJA 1H08A 2XK4A 4RJ4A 4FEVA 1UU9A 2GQGA 4S2ZA 3R6XA 1M14A 2R3NA 3H0YA 4NU1A 2ZMCA 2BR1A 4W4WA 4A9YA 3JY9A 4NT4A 4KINA 2JFMA 4ANBA 2DWBA 4IVBA 3BQCA 2GHGA 5AADA 3TNWA 1GY3A 4N6ZA 1U54A 3RCDA 3F9NA 3NNWA 3SVVA 2CN5A 3LCKA 3G0EA 1TQPA 4O6LA 4AA5A 3HRFA 3BV3A 4AG8A 5CSPA 2F7XE 3NUNA 4L68A 4YNOA 5GJGA 3QTWA 4W8DA 2HXLA 3R2YA 2YDKA 2WEVA 5M4FA 4W4XA 3Q2JA 3MH0A 1JNKA 3MFUA 4YR8A 4E7WA 2IVVA 2I0VA 3WE8A 4CNHA 2ZVAA 1H26A 5LWMA 5M53A 4IAYA 4F0GA 5KE0A 3G90X 3UQGA 3ORIA 2C0OA 3C4ZA 3FV8A 3FXWA 4GJ3A 4YP8A 4HJOA 4YJQA 5CU3A 4I6QA 4FSTA 3VF9A 1QPEA 1SZMA 3FZTA 3ZUTA 1SYKA 3DBEA 4LV8A 4M84A 4MVFA 3ORXA 1T46A 1P4FA 3OWJA 1YWNA 4QP1A 3F82A 2H6DA 1XHAA 5DYJA 1BUHA 3M1SA 2OXDA 4E3CA 3VS2A 1XH4A 2R3GA 4FL3A 4XG2A 1ZXEA 3NNXA 1SNUA 4O0WA 1Q3WA 2QOFA 1OL6A 3KL8A 3KMUA 4I6HA 4UMQA 2NRUA 4KD1A 4XJ0A 3VC4A 3WF6A 2PPQA 2X9EA 3FQHA 2OJIA 4DEAA 4FL2A 4AZEA 1JQHA 4I6FA 4ZTLA 3ZSGA 4APCA 3VUTA 5J9LA 2C6MA 4QYHA 3R0TA 5EM7A 5KO1A 5I4NA 3FJQE 4EYJA 3ATTA 5EYKA 2HOGA 3QTUA 4WG5A 2YM3A 2YJRA 3W1FA 3ET7A 1PXOA 4ZZNA 5J95A 2YZLA 1UNLA 1OL7A 4FV5A 3U9NA 3EZRA 2C0TA 3TG1A 3TXOA 4CKIA 3LZBA 1HOWA 3HZTA 3BU5A 4M0YA 2XIRA 4CCUA 5EM8A 3QRKA 4LRJA 3ANRA 4G5JA 3LXNA 3SD0A 3VS5A 2CSNA 3ORMA 3V8SA 4MXCA 2YHVA 5G1XA 5AMNA 5HCZA 2VNYA 3OZ6A 1YDSE 3FMLA 4D2PA 3W8QA 1OBGA 4ZSLA 3MVMA 3TV6A 2WPAA 3FI2A 2E2BA 3FI4A 4FA2A 4FUYA 3WF8A 3N4TA 4E4LA 3OEFX 2QOQA 5J5TA 1PXIA 1H24A 3L8SA 4EOPA 3BGZA 4IM0A 4E26A 3BZ3A 3ZOSA 3ZDUA 5CU6A 3P08A 4C4JA 3PVWA 4XRLA 5CAUA 2QLQA 5AP4A 2X6EA 4ASEA 1IA9A 2V55A 3C1XA 4JVGA 3LMHA 4L3PA 4P4CA 2VWXA 1XBAA 4IMYA 4FSRA 4I5CA 2XP2A 3A2CA 1ZARA 2W4OA 4RC3A 3I7BA 4QP2A 1GOLA 4XOYA 5DOSA 4FR4A 4ZJIA 3UOKA 3CXWA 4AT4A 1U54B 4DG2E 4BWPA 4WNMA 2OZAA 3NAXA 4AT3A 4GVJA 4AU8A 2IG7A 4XNEA 5FP5A 3TTJA 4KS8A 4X3FB 3R21A 5C4KA 3PVUA 2GQSA 5CSXA 5IA4A 1XBCA 4PY1A 2BAJA 4I5HA 2QNJA 2X4ZA 2UW7A 3DQXA 3BYMA 1XJDA 3CTJA 4IQ6A 4J71A 4ANLA 4LM5A 4FKVA 3FSFA 3A8XA 2J50A 1MRUA 4R7IA 3U9CA 4EWQA 2C6TA 3PRIA 4FZDB 3PE2A 3A8WA 4RGJA 3Q04A 4NSTA 4Z55A 4E6CA 3KF4A 2W7XA 1Z9XA 1BLXA 4NWMA 4X2NA 3UC4A 4I20A 3G6GA 4AN2A 3DPKA 4E5BA 4D1SA 1IR3A 4J99A 3LFCA 5IQGA 3KXHA 1OKVA 2V62A 5HGIA 2BZJA 2R7IA 2W1IA 3G0FA 5H9BA 3BBWA 3GUBA 2OFVA 3ZLSA 4FKPA 2YITA 3OXIA 3P78A 2QU6A 3QTIA 3VHKA 4JQ7A 2A0CX 3LCTA 3D7TA 5IH6A 4CG8A 5IKWA 4X3JA 2WU6A 5B2KA 4FT0A 4EHGA 3P0MA 4U45A 5CQUA 1PYEA 4G34A 3C0HA 4PPCA 3BLRA 4H39A 1UA2A 1YRPA 3MWUA 4NIFB 4QPAA 4XG7A 5D9HA 4H1MA 5GNKA 4AN9A 4C3RA 2YEXA 4FODA 4ERKA 3JR1A 4LUDA 4FKRA 3OCTA 5FRIA 4EOJA 1SVHA 3BBTB 4P5ZA 5IQIA 4RFYA 2OSCA 4XP2A 3UZTA 3NCGA 3V5WA 1OGUA 1ZAOA 2AUHA 4RIXA 3BYOA 3PLAE 3RK7A 3ZH8A 2XYNA 4RLKA 1OECA 4BZOA 1M2QA 3RPVA 5IEXA 2DUVA 1WCCA 2YFXA 3R1SA 3C13A 5IH4A 3PJ1A 4L42A 2OIBA 4O38A 3PSCA 4P7EA 3VBXA 3QC4A 4MNFA 4F08A 3EKKA 4C35A 5A54A 3ZM9A 3E8NA 5CNOA 3WI6A 4E1ZA 5DN3A 4GK4A 4AFEA 4M68A 2ERKA 4DCEA 2JC6A 3LFEA 2GQRA 1CKIA 5JFSA 3KXZA 3QGYA 4U0IA 2YDIA 4LRKA 2IO6A 1DAYA 5GZ8A 4K9YA 1OZ1A 3GGFA 4OBPA 5JFVA 5DNRA 4ARKA 5I9YA 4IAZA 4A7CA 3P79A 3VUIA 2BDFA 2HXQA 4C7TA 1JAMA 1PMNA 1SVEA 3QALE 4AS0A 4RA5A 3QZIA 4X0MA 3C9WA 4UMPA 3E7VA 1JKKA 3CC6A 2C69A 3MTFA 4ONAA 4O91A 3CKXA 4J52A 4HPTE 4FKSA 4TXCA 5CAOA 5LCKA 5DI1A 3I6UA 4HPUE 4TWPA 4C2WA 3FC2A 5J9YA 3VJOA 5E8ZA 4LFIA 4RZWA 4FTTA 4BFMA 3H10A 3FZRA 4RG0A 1H07A 3EFWA 2C47A 4GH2A 4M14A 5FWKK 1YXUA 5HOAA 5TO8A 2X1NA 4CQGA 1H1RA 2ITQA 3DAEA 2BFXA 3DT1A 4HZSA 3EQFA 3R7GA 2JKQA 4PTGA 4MXOA 3L8VA 4QMPA 4M15A 3KKVA 4EHEA 5K0XA 4KBAA 1ZYLA 3UNZA 1Q4LA 4QMUA 2PMIA 1XH7A 3BRBA 3LFBA 3R73A 4YBJA 4YLLA 5CT7A 3WZDA 4D1ZA 3OFMA 1WBTA 2R2PA 3EQRA 5LMKC 5E1SA 3EIDA 3QHRA 3QYZA 1OIYA 2C3LA 3QZGA 4QP8A 3MW1A 4WKQA 5E7RA 1XWSA 2YLEA 3MIAA 1G5SA 1MQ4A 4GCJA 4TZRA 5GINE 3H4JA 4O7SA 2C0IA 4KIOA 4FTLA 3RTPA 4XG9A 1CTPE 4BVUA 4EHZA 4HOKA 1OITA 4L3JA 5D7AA 4DC2A 5CAQA 3QCQA 3KQ7A 5FXSA 3H9FA 3TT0A 4BIBA 2W96B 3ETAA 2QO2A 5C1QB 1H27A 5KKRB 1G8SA 3QX2A 5M56A 2W5HA 3FMJA 3QTSA 4L7FA 4OBOA 4I1ZA 5CWZA 3E64A 5DR6A 3G9LX 5EW3A 4BCHA 5FDXA 4I3ZA 4MBIA 4CV9A 5HICA 1GIJA 3MPTA 4U43A 3AGMA 3A62A 2VWWA 3BHTA 3V3VA 3ZUVA 3C4CA 4DH3A 5I9ZA 4WSQA 5LVOA 3LXPA 5GIOE 4EH4A 4MTAA 3UG2A 4FZFB 4OUCA 2QLUA 3QWJA 3E8DA 5AEPA 4KIQA 2XIKA 2G2IA 3NR9A 3PY1A 4PNIA 1GZKA 5L8JA 5M06A 2YZAA 2PY3A 4XP0A 3FBVA 5TKDA 3U8WA 2G2FA 4FIEA 3CY2A 2WU7A 3PRFA 4HNFA 2HZIA 2YWPA 4RQKA 2CNUA 2XNNA 3P7BA 3RK5A 3FAAA 4L00A 3AMAA 5A14A 3KULB 3MB7A 3UVRA 2XF0A 5DWRA 2GNHA 4KKEA 1GJOA 5IDNA 2QG5A 4KB8A 4C3PA 3BGPA 4ZMFA 3OY1A 3OUNB 2HIWA 4OLIA 4G6NA 4F0FA 2F57A 2HK5A 2WMQA 4U9AA 3AC4A 3F5XA 4GKIA 3D4QA 3IO7A 3MVLA 4K18A 3MH2A 4NCTC 4FNZA 3IECA 4KUJA 2GFCA 2NO3A 4RX7A 5DEWA 4Y8DA 4GYGA 4A4XA 4H3QA 4PMMA 5C8MA 5EOBA 4BDAA 1G3NA 5AR4A 2VTMA 3S00A 3QBNA 4JXFA 1OL2A 3M11A 3QQFA 4FG7A 5D10A 4USDA 5CNNA 3Q6WA 3AQVA 4RJ5A 4O0VA 5EI8A 5A4LA 4V05A 4FYNA 4O2PA 1B6CB 1KSWA 1STCE 3KK9A 3LHJA 4G3EA 4MXXA 4YNEA 3UNJA 4JRNA 1YW2A 2WOUA 4UMRA 5DT4A 3FYJX 5IQBA 4HCTA 4D4RA 5HQ0A 5EFQA 1TQMA 3HYHA 1AD5A 3L9LA 3HV7A 5ANIA 5E8TA 4UN0C 3Q2MA 1WBPA 2X8IA 3DXNA 5JK3A 1ZYCA 5EW8A 3BEAA 2WOTA 3QLGA 1FOTA 4LUEA 3RAWA 2OI4X 5FEQA 3PJ3A 2XJ1A 2BTRA 4FSUA 3CD8A 5HESA 3AC8A 3ZFYA 4F7SA 3ZBXA 3P7CA 1BI7A 3R8PA 1ZY5A 5T6KA 3VUHA 2RGPA 5KMJA 3NW7A 3O51A 3B8QA 2A1AB 4JX7A 3VBYA 2R3PA 4FV4A 3W2OA 3ZO4A 1ND4A 1PXJA 3KVWA 4HYUA 3R8LA 4PPAA 3PTGA 1J1CA 4GG7A 2WTWA 4I24A 4R1VA 3T3UA 3UVQA 5JZJA 4Y46A 4ANMA 3C7QA 5KCVA 2BVAA 3A7IA 3PXYA 4NL0A 4L8MA 4ITIA 4BCIA 2ACXA 3NUUA 5JEBA 3CJFA 3VBQA 4FKQA 4EK5A 4H05A 1YI3A 3GOPA 3QFVA 2IZRA 4FZ7A 3EOCA 5HG7A 3RHXA 5FM3A 3RP9A 2JDTA 4YZMA 1O6KA 4WNOA 4L6QA 3NW6A 3UGCA 5C9CA 1UNHA 4AF3A 3ODYX 3VS7A 4FNYA 3A7GA 4CMUA 5IQDA 4G3CA 3U6HA 2XK8A 3HRCA 5CU2A 3SLSA 3RWPA 4BKJA 4W4YA 3AD5A 5FXRA 3O23A 5GJDA 3A7JA 1YDTE 4MF1A 4WD5A 2FVDA 3NUAA 5BVEA 2Q83A 2C1AA 4CXAA 2UZVA 3BYSA 2EB2A 2XIZA 2GNJA 4EYMA 4UB7A 4OTRA 4YTIA 4ZJJA 1OBDA 3U6JA 4BHNA 5E8XA 5BPYA 1XKKA 1IAJA 3BV2A 3FKNA 3NIEA 4YZBA 2QR8A 4IAFA 3V6SA 4WUAA 3QUDA 5C27A 4EJ7A 3F7WA 4J7BA 4DH1A 3R30A 4EONA 2VO6A 1JKLA 2QOOA 5AA9A 4AOTA 1U59A 5AX3A 2OJFE 4G5PA 1W83A 4L44A 4IACA 4L46A 4NM5A 3UQCA 2J6MA 4FKJA 3EQBA 5GZ9A 1YI4A 4IADA 5CSVA 4KBCA 3EKNA 4A9TA 4OGRA 5BQ0A 2X6DA 4OAUC 4WBBB 2BMCA 3ANQA 4XBUA 2GFSA 1YI6A 3VQHA 2QONA 4GVAA 5IG1A 3O2MA 2ITYA 2WMXA 4FKUA 2W99B 4QQ5A 4EI4A 3PWYA 4FNWA 4NH1A 2C30A 3EB0A 4TPTA 5TOZA 3W55A 4BHZA 3QC9A 4EWHA 2C5XA 2BZHB 1FVRA 4O96A 2ITTA 4FVQA 5HIBA 2J90A 4LL5A 3H3CA 2A2AA 4FYOA 4LRMA 3PPKA 4OTHA 3K3JA 3NVKI 3DLSA 2W5AA 2X81A 4FTUA 4AZSA 3HLLA 3W16A 3FLZA 5J5SA 4PV0A 2QHMA 2J9MA 2JIUA 1WBOA 4QRCA 4FC0A 4WNKA 3A7HA 3OC1A 3FZSA 4L53A 2P2IA 3LMGA 2C5YA 4IM3A 4RMZA 1BI8A 2WHBA 4RA4A 2YLFA 4KNBA 3V8WA 3LQ8A 3E5AA 5KUPA 1PMUA 4TWNA 3ZXZA 3AC3A 5IQEA 3PP0A 3TZ8A 4CG9A 5LXMA 3S2PA 3MV5A 2PE0A 4NKAA 2Z2WA 4DTAA 2W06A 2Y0AA 1Q8UA 4I4FA 4W4VA 4CT1A 5LMKA 3UG1A 1Q8TA 1BKXA 2BAKA 1GNGA 3BHHA 4JLCA 4R5SA 5AR7A 4F9BA 5A4EA 3KRXA 3CY3A 3QQKA 3S3IA 4BCNA 2QR7A 4BBMA 2P55A 1PY5A 3NSZA 3Q53A 4FF8A 3OEZA 2X2KA 2A4LA 3GQIA 5AAGA 3AOXA 3PYYA 4BDCA 2ZJWA 4E8AA 4FK6A 5IA1A 3I60A 3NS9A 4FE2A 4XBRA 1OKYA 3PA3A 1H1QA 4E5WA 3U87A 4GIHA 3SG9A 2WMSA 4YLJA 5F1ZA 1WAKA 3HEGA 2C3JA 4RT7A 4RIWA 4CKJA 3ORKA 5A46A 4ZTQA 4QTBA 5AUZA 4Z7HA 4PUZA 4S33A 3Q96A 4BDEA 4FKOA 4F6SA 1SNXA 2VTQA 4G2FA 4Z9LA 4HGLA 4L45A 2QOIA 2QQ7A 3G5DA 4LGGA 3ZZWA 2J0LA 5JZNA 4BTFA 4ZTRA 4D2TA 4I92A 2HELA 1QL6A 3BGQA 2VWIA 3PJ8A 2X4FA 3QQGA 5AP1A 2I40A 4QTDA 4PDSA 1KOBA 2J2IB 4YTHA 1QPJA 4C61A 3ZTXA 5EYMA 2X2LA 3ZO2A 3A7FA 2QVSE 3W2RA 2CLQA 5EI6A 5HNGA 2Y8OA 4IZAA 4QMSA 5E1EA 2FO0A 4RQVA 4O7ZA 4UMTA 1GZNA 3ZCLA 5AIKA 3F3VA 2A19B 3EH9A 3UQFA 5M07A 3UZPA 3AMYA 2YA9A 3NUSA 2ZM3A 2YM7A 5I0BA 5JFXA 5EOLA 3KULA 4UZDA 4DH8A 3LFDA 2F4JA 1RJBA 1P14A 3GU4A 4M7IA 4M97A 5JGDA 3WOWA 1PXNA 2YJSA 5AUXA 3SRVB 2YCQA 4GG5A 3C50A 3F3WA 4BBFA 4GSBA 4G6OA 4QTAA 1IEPA 2HZ0A 2XZSA 4LMNA 3R9NA 3HNGA 5IUHA 4ZSAA 1JWHA 5TE0A 3QKMA 3QWKA 4IC8A 3F2RA 1MP8A 1DI8A 3BLHA 3FLNC 4KS7A 5J1VA 2IW9A 3HDMA 3ULZA 1V0PA 4C36A 5KMMA 2LGCA 4UALA 3QZFA 4TWOA 3D7TB 2WMBA 3Q3BA 1OUKA 2DS1A 5BUJA 4Q5EA 3UMXA 4KABA 2CGXA 4BDGA 2ZB0A 4B9DA 4DGMA 4E4XA 2O2UA 4YC3A 2FGIA 3DBFA 3R8MA 4D0XA 3GU6A 3FXXA 4BDDA 2WKMA 4O86A 1PF8A 4IBMA 3ZDIA 4CFFA 4MWHA 4FT5A 4AOJA 2EXCX 4MH7A 2R0IA 4RX8A 3I7CA 4RZVA 2ITOA 4A06A 3NW5A 2CCHA 4HGEA 1H1WA 3JPVA 4NW6A 2QURA 3MJ2A 4P2KA 5ETFA 4O27B 5CVFA 5ANJA 1OKWA 3BQRA 3K3IA 3U4WA 1SM2A 4C37A 4F4PA 2VTNA 4R7BA 2W05A 4A4OA 3BYUA 1OIQA 3MI9A 4ACDA 3I81A 3RK9A 4I6BA 4AP7A 4OTDA 5BVDA 3TDVA 3MY1A 3LFNA 3MJ1A 3VN9A 4V0GA 4O84A 2NPQA 2W0JA 3UPXA 1JKSA 4C8BA 5IEYA 5C01A 4DGNA 2C5NA 4ZXTA 4FKGA 4EK3A 4BWKA 5AP5A 3MESA 4BWXA 5A9UA 4MBLA 3LFSA 2R3FA 2QO9A 2W1HA 3HV3A 2XVDA 2PZYA 3FHIA 2CGVA 4FGBA 5D12A 3BWFA 1K9AA 4XP3A 4FEWA 4MHAA 5EG3A 4CMOA 4JBQA 4JQ8A 1LEZA 4PDPA 5LQFA 1FVVA 4C4GA 4Y85A 4EOIA 4S34A 5IQCA 3L9PA 3FLSA 4OTQA 3ZYAA 3F61A 4D2RA 1PJKA 2ZV9A 5K4IA 1A9UA 1LPUA 2OG8A 4Q2AA 2RFNA 1K3AA 4UX9A 4LI5A 1JKTA 2BAQA 3PDTA 3SW4A 2YISA 3DA6A 3QUEA 3NUYA 4YJPA 3UC3A 3LKMA 4FSMA 2W1CA 3IDCA 3MY5A 3COHA 4Z7GA 3TNQB 1KOAA 2XMYA 4I4EA 1NVSA 4F1OA 3KXGA 3IDPA 3ZS5A 4JQEA 2W1FA 2W5BA 2H8HA 2BIKB 3HMMA 2NRYA 3ZZEA 3DS6A 4MAOA 4QQTA 5A6OA 3EQHA 4EQCA 4FL1A 4CQEA 5L6PA 2VO7A 2WIHA 5ANEA 5LOHA 5HD7A 3LFFA 2JLDA 1QPDA 2Q0NA 3UE4A 2Z7RA 4E6QA 4N0SA 2IJMA 4ZLYA 4IIRA 5BMSA 2CJMA 1E9HA 3D2IA 1MRVA 1SMHA 4WIHA 4EBWA 5HTBA 3O7LD 3ZHPC 1Q97A 5CEQA 2VX1A 2BKZA 2XCHA 4M3QA 4CLIA 3DK6A 3VNTA 3DOGA 4FMQA 5FDPA 5L2WA 3RPOA 3QKKA 4QMMA 4X2FA 5J8IA 4D5KA 2PZRA 3BIZA 3HGKA 4IB1A 4TW9A 5GHVA 3ZLWA 4CTCA 4YJTA 2HCKA 3FDNA 3OF0A 3DZOA 3HDNA 1LP4A 2G9XA 4H3PA 5HCXA 1K2PA 2Y6MA 4BTJA 3GFWA 4NIFA 4E6AA 3EQPA 2E9UA 3Q4UA 3Q9ZA 5CAPA 3RM6A 3VUGA 3WZKA 2OXXA 3PA4A 3IW7A 4X2GA 4C0TA 3TJDA 4AA4A 3TZMA 2YAKA 4TYJA 4D2WA 3D94A 1Y6AA 4GK2A 4UWYA 4DG0E 4WHZA 3D15A 4FVPA 3OBGA 4IB5A 5AM7A 4WUNA 4YHTA 2IZTA 3A60A 3O7LB 4QYGA 4BF2A 2UZOA 3KRJA 1H00A 2OLCA 1EH4A 3DDPA 2UUEA 5HVYA 3TUCA 3RM7A 4C59A 2W1GA 4FV6A 3FPQA 5CEOA 2UW5A 1Q24A 4B8LA 2VTHA 2EU9A 1XH9A 5HEZA 3R2BA 4A9SA 4TNDA 2XNMA 3VHEA 5AM6A 5D11A 1H1PA 5C8NA 4AW1A 4GU6A 4BCOA 5FP6A 4XG6A 4GJ2A 3FKOA 4JDJA 5AIRA 1G8AA 4DTBA 5EHLA 3FQEA 4ZS0A 4J98A 4XV2A 3V5TA 5IH5A 3CP9A 2B7AA 4QMQA 5CVGA 5C26A 3FLQA 2O3PA 3UODA 4ZP5A 3VS0A 1Y91A 5CASA 4BZNA 4EJNA 2PUPA 5FXQA 3MIYA 5JGAA 5CT0A 3SXFA 3WF5A 4NFNA 1OVEA 3UOLA 4M69B 4CRSA 5D1JA 4B7TA 4BYJA 5BVNA 4TT7A 2ONLC 1SVGA 4FOBA 3UPZA 2YCRA 2GSFA 5CI7A 2JD5A 3ERKA 3UYSA 5AUYA 2QD9A 3FL5A 3DU8A 4XRJA 2X39A 3HV4A 2WQMA 5HI2A 1AQ1A 4EK4A 5AUWA 4GS6A 4PQNA 2CPKE 2CKOA 3O71A 4CYIA 5H8BA 2Z02A 4EUUA 2IW6A 1URWA 2ITWA 5L2QA 2XEZA 4FVRA 4L3LA 4XG4A 3FL4A 2OICA 3MFTA 4BRXA 5EI2A 3B2WA 2QI8A 3FQSA 2C5OA 4IWPA 2OIQA 3TJCA 4NTTA 5KBRA 4XV1A 3UO4A 1NVQA 4UYAA 2QHNA 3COIA 4EKKA 5CEPA 5CF6A 3JS2A 5M4IA 4PDOA 3HMPA 4QTEA 4AZFA 2XK9A 4KKGA 1Q3DA 4U97A 1M2RA 4ANNA 3ZBFA 4AZWA 2CCIA 4C4HA 1KE6A 3NYOA 4ACGA 1ATPE 3TCPA 5H3QA 3R7YA 2WQBA 4CT2A 2YM5A 4RVTA 1S9IA 3E92A 2CGUA 1OIUA 3QQJA 1YOMA 3P4KA 4QPSA 3MS9A 3QX4A 5IA2A 3VS3A 5ETIA 1NW1A 1KWPA 4MXZA 3ZO3A 4MD7E 3VJNA 2WQOA 3MY0A 3Q5ZA 4ZOGA 3DBDA 5DR2A 3MDYA 4WG4A 4B0GA 2ZV2A 4HVSA 3LJ1A 1UV5A 2JBOA 3IONA 1Q62A 3RAIA 1CDKA 4TTHB 1A48A 2E9PA 4F1TA 4O2ZA 4DF3A 5J7HA 4LOOA 2GCDA 3OCBA 3EJ1A 1UU7A 4M12A 2UZNA 4PP9A 5HNBA 2QOBA 2JDSA 4HCVA 3W33A 3C0IA 2EVAA 2B9JA 3ZSHA 3UO5A 3R7UA 4JT3A 4RFMA 1KE9A 4FSYA 3SC1A 5LVMA 2R3OA 3PIXA 3SV0A 3DCVA 1H8FA 2B55A 4YURA 5B2LA 5GJFA 3HMIA 3REPA 3OBJA 2WTCA 4FTOA 3Q6UA 1LUFA 3FUPA 2J5FA 4G9CA 2IVUA 5CYIA 3CKWA 4AW2A 3LPBA 4FT7A 4H58A 1YXXA 5D7VA 4BKYA 4CZTA 1M7NA 3LM5A 3HUBA 5IU2A 4GMYA 4BDBA 5A3XA 3RNYA 4RWJA 2OW3A 5KZ0A 2HW7A 5EYDA 3OROA 4YC8A 3IDBA 4G3FA 4BI1A 3SW7A 3PG1A 3DXQA 3VUKA 1L3RE 4KA3A 4BGQA 4TKSA 3SHEA 2W4JA 4DFLA 4ENYA 1ZLTA 3RAHA 1Q61A 1OIRA 5KBQA 2XS0A 3O8UA 4M66A 5CZHA 3S95A 5FGKA 1OPJA 2UZUE 2P0CA 3GVUA 2C6OA 3BKBA 4RWLA 3FMHA 3R7EA 2Z7LA 4M13A 2W9FB 1X8BA 4IX3A 5EDQA 1OKZA 4BCJA 4NJ3A 2ZV7A 2W1DA 5C8KA 3JUHA 3FPMA 4QYYA 2VO3A 3QQUA 3HUCA 4DE4A 1IA8A 4BB4A 4EH8A 4Y5QA 3V51A 5M4CA 4JG8A 4R8QA 5GZAA 3CPBA 5AP3A 4WO5A 2DYLA 3OWKA 3HP5A 1P4OA 5HE3A 3BHVA 3WYYA 3EFKA 1JSUA 5FM2A 5J87A 3W2QA 3S0OA 3PZEA 1TQIA 2XJ0A 3F3ZA 1J7LA 5HBJA 2WTDA 4XV9A 2VTRA 3GENA 4R3PA 4LL0A 1IAHA 5BNJA 3HAMA 4ASXA 2B9HA 2JIVA 3QQHA 5G6VA 4HW7A 2OXYA 1JPAA 4LGHA 2LAVA 2Y4IC 4I0RA 3EYGA 4ALWA 4YSMA 3E3PA 3EQIA 1YVJA 4D9UA 5I3RA 1PXPA 2X8EA 2PHKA 5JGBA 4ENXA 2G2HA 2OKRA 4AZTA 2QO7A 2OZOA 3V5JA 3G15A 4DEHA 3KFAA 5KNJA 1R78A 4EL9A 1W82A 3UMWA 4DT9A 4IAIA 2J0MB 3AD6A 3ENHA 4F7NA 5CX9A 4K11A 4QQCA 2X7OA 5F94A 4BGHA 3BPRA 5IQHA 3TUBA 3QXOA 5BVKA 3V5PA 4MNEB 3KVXA 4FIHA 4BDIA 3RCJA 3S4QA 2VTJA 5E8SA 4BYIA 5HX8A 5I5ZA 5K5NA 4EQMA 3GC9A 5B2MA 2G15A 5HO6A 5IMEA 4Y5HA 3OY3A 4D5HA 2VUWA 3BE9A 2R3KA 3F3TA 3FI3A 4W9XA 4YJVA 4I0SA 4ZSJA 1TVOA 3VS1A 3FZPA 3HAVA 3PIYA 2X9FA 1UU3A 4QT1A 2BRNA 3QTRA 4PMSA 4RJ3A 5KX8A 1Q8WA 3QCYA 3PE1A 2XIYA 2UV2A 4Q9SA 2PYWA 2HY0A 4O7YA 4XH6A 4O1OA 4DFZE 3D5VA 3EFJA 3WE4A 4BKZA 3UP2A 5A4CA 3OWPA 4I22A 4FKLA 3C4XA 4IFGA 2ITUA 1OL5A 1P5EA 3SXSA 4EC8A 3GI3A 1Y6BA 4X3FA 4DFUA 1E1VA 2ZDTA 4FV8A 4O7RA 2BHEA 3SOCA 3MA6A 4K8AA 4V01A 2CHLA 5T3QA 4BCMA 4DBXA 1BL7A 2REIA 3PUPA 3R63A 3SQQA 2FUMA 3LQ5A 3WIGA 2PK9A 1WMKA 2UZDA 4C58A 1QCFA 3RNIA 2YIWA 3ZLXA 2C6LA 2UVZA 3C0GA 4RJ8A 2GHMA 4EZ7A 5FG8A 3JY0A 3ZONA 3ROYA 3HV5A 3ZUUA 1RE8A 4YJRA 3GT8A 3CE3A 2EXEA 5AV0A 3QTXA 3TM0A 1RW8A 2Y9QA 3DK3A 4O0YA 5F4NA 4GFOA 4E4NA 5C03A 5BYZA 1JOWB 3F5UA 4U44A 3BLQA 3ZRKA 5IQAA 1U5QA 2BPMA 3FY2A 4C33A 4RVLA 5CEMA 4EH3A 5AV3A 4FSZA 3ZEWA 4I5PA 2QU5A 4MBJA 4IWQA 4RRVA 3UIXA 1WVXA 1UNGA 1ZYDA 4EUTA 5IZFA 2BKKA 3GBZA 4P5QA 3CR0A 4IB0A 3IQ7A 2PUNA 1R39A 2EXMA 3GU7A 3MPMA 3ORPA 3QL8A 4ZIMA 4MCVA 2WMAA 3E87A 4B4LA 3EN9A 5T68A 5HLWA 5LVPA 2XKEA 4FTCA 1Z5MA 2B4SB 3DKCA 5EKOA 4ZZMA 5CY3A 2YACA 4GL9A 3EN7A 4J8NA 3F5GA 3VF8A 2RG6A 3TUDA 3AC1A 3AGLA 3EZVA 4CD0A 4FTMA 4OTFA 3FMNA 2V5QA 3AT2A 3LM0A 1V0BA 2I0EA 2WIPA 2GTMA 3OMVA 4MWIA 4EC9A 5EW9A 3R00A 4LOPA 2W1ZA 4C02A 5EQEA 4ZY4A 5HNIX 2BZIB 3I4BA 1XH5A 4ALVA 3TV7A 2BIYA 3ZRLA 3FZ1A 3CQUA 5AP0A 3Q32A 2R7BA 4N6YA 1ZMWA 5AFVA 3HMNA 1REKA 2VU3A 3BELA 3TKHA 3UNKA 3D2KA 1YWVA 3FEGA 4JIAA 3UIUA 5KHWA 3Q9XA 4ITHA 2VTSA 1YXVA 4QMTA 2B9IA 4YJOA 4YZDA 5BUIA 4OR5A 3VS6A 5DR9A 2X7FA 1YHWA 2BZKB 3KCFA 3R71A 3F88A 4NZWB 2EUFB 4F9CA 4AW0A 2XM9A 4O22A 3R7OA 2R3RA 4NYEA 3KMWA 3R9RA 2VX0A 1H25A 1KE5A 2F2UA 4IDTA 2B53A 2WTJA 4N4SA 1WZYA 4QP3A 3LJ2A 4KAOA 5CEKA 3KMMA 3L8PA 3BE2A 2OJJA 3F7ZA 3PXKA 1UWJA 2JKOA 4U8ZA 3U4UA 2XB7A 5I9UA 4K6ZA 1FBNA 4FEUA 3A4OX 4HZRA 2UZTA 2AYPA 4X7QA 3OVVA 3PY3A 2JDRA 3R22A 2YDJA 4CYJA 1ZMUA 4GYIA 4ZS4A 1PHKA 4DH7A 2J51A 2QOHA 1DAWA 2BRHA 3LW0A 4FK3A 2I6LA 3NPCA 3PZHA 4ZTHA 4PDYA 3DNDA 4AA0A 1CKPA 3SGCA 2ITPA 2C6IA 4R78A 4PNKA 4MK0A 1PW2A 2I0HA 4XUFA 5HVJA 2R3IA 4LG4A 4M69A 3VW8A 3GFEA 4EQUA 5H2UA 4O0UA 5HBHA 4BDFA 3E3BX 3O50A 1B39A 3GCPA 2OK1A 2YM4A 3NUXA 2WTKC 5AV1A 5LARA 4L52A 3TN8A 3C4WA 3WZUA 3N4VA 1QPCA 4PL3A 4V0GB 2ZOQA 4A9UA 2PZ5A 3MPAA 3BHYA 2ITXA 4M8TA 4QOXA 3SXRA 4BCGA 3CLYA 5JT2A 3G51A 5HLPA 3FSKA 4BC6A 4GT3A 2Z60A 4IANA 5E8UA 4KRCA 3KU2A 3OTVA 3QZHA 2O65A 2J0IA 1NXKA 3QKLA 3ZRMA 3A61A 3CPCA 3PXRA 3R01A 4K1BA 5CU4A 1XBBA 3K5VA 5IMXA 2VZ6A 3ACKA 3KXNA 2YERA 3P9JA 1BX6A 5DHJA 2WFYA 3EL7A 4LMUA 3RWQA 3AT4A 4RLLA 4V04A 2UZBA 2UW3A 3ITZA 4EH9A 4XV3A 4O7WA 4CZUA 4ZLOA 3HV6A 1PXMA 3E8EA 1NA7A 4AGDA 2NNWB 2VNWA 4G16A 3AC5A 3DJ6A 5AWMA 3Q9WA 5IA3A 4JX3A 4NW5A 4DITA 3HRBA 4IVDA 1GZ8A 1GZOA 2XBJA 3TWJA 2GNLA 3AT3A 5EHYA 4A4LA 3KRLA 3NIZA 2PVRA 5BYLA 3R83A 4ZZOA 2V7AA 3D14A 2C5VA 4ZTMA 3CTHA 4LYNA 3Q4ZA 3VWAA 2CKQA 5A6NA 3LLTA 4ASDA 5CXHA 3WZEA 5J79A 3RZFA 5FBNC 4LOQA 4UBAA 4IEBA 5KZIA 4B8MA 2WMVA 2C6DA 4OTWA 1HCKA 4HVGA 2X0GA 1U4DA 4AE9A 4NM7A 2P4IA 3F66A 4EOMA 4IB3A 4DEIA 1BYGA 2GDOA 5FBOA 3PSDA 4PTCA 4Y95A 1H28A 3TKIA 2CGWA 3QF9A 3KCKA 3DBCA 4YSJA 2OFUA 5ACBC 3CQEA 3SX9A 4NCTA 2VO0A 4FTKA 4IM2A 3QYWA 5I9VA 4MQ2A 3BCEA 4D0WA 5EQPA 2OH4A 3OXZA 4QNYA 2JKMA 3COKA 1MQBA 4Z3VA 5AP2A 4AE6A 1WVYA 4HYHA 5I9XA 2F2CB 2PZIA 3W32A 1FPUA 3HECA 3DB6A 4QP6A 5HIDA 4AGWA 4DFXE 3C4EA 4ACMA 4F64A 2C3KA 2YCFA 3SOAA 3E62A 1H01A 3ZC5A 3QD3A 5CENA 1Q41A 3R8ZA 3ZU7A 4X2KA 5DBXA 5DG5A 3NEWA 4IFCA 3IW6A 3W8LA 2B52A 4YBKA 2XKDA 4D28A 5JN2A 3PY0A 5AR3A 4RPVA 3W2CA 4R5YA 2BALA 3ORTA 1W84A 4WSYA 5HG8A 2QOLA 1OPKA 4FEQA 3V8TA 3QA0A 2FSTX 4GT4A 3WILA 4O6EA 4BCPA 5BYYA 4CKRA 3MN3A 5HU3A 5I9WA 2WQNA 5DFPA 2GTNA 3FMEA 5BMMA 5M4UA 5CEIA 3OS3A 3TDWA 3NLBA 3GCSA 2WMTA 3U54A 1PXKA 4CTBA 1UKIA 2PVKA 2WNTA 3QD2B 2XCKA 3ELJA 3F6XA 3PWDA 5HO8A 5CQWA 4F7JA 4KWPA 5DLSA 1YKRA 1YXSA 2J0JA 3FHRA 5EYCA 3WF7A 4K2RA 4R3CA 3UYTA 4FTNA 4FSWA 4XYFA 3OW4A 2IW8A 1H4LA 4EOOA 2Y7JA 4BCKA 4ORKA 5HE0A 2ZYBA 4F0IA 1UKHA 4NM0A 5BX0A 1H0VA 2BRMA 5ITAA 5FD2A 5LCJA 1VYZA 2WMUA 4U40A 3R9OA 5JFWA 3BHUA 3SKCA 3UJGA 1M7QA 4MF0A 4O21A 4IAKA 1OMWA 4YZ9A 4CLJA 2Q0BA 3JYAA 1ZYSA 3QUPA 3WIKA 4F7LA 1KE7A 4U79A 3HA8A 2ZAZA 4YMJA 4QNAA 3L9MA 3ZSIA 5DVRA 3IGOA 3OW3A 4TNBA 4JR7A 2PUUA 4QQJA 4TYGA 4D55A 3I0QA 4AACA 3PPZA 2FSOX 2SRCA 1WBNA 1ZOGA 5K3YA 3OT8A 4WG3A 4ERWA 1I09A 4XHKB 4XLVA 4C34A 1Q8ZA 4I0TA 2BRBA 1J91A 4O0XA 3L9NA 4EH2A 3G9NA 1Y57A 3H9OA 3LFQA 4D2SA 2FSMX 4TRLA 3VBTA 4PL5A 4DN5A 4UEUA 1W98A 4ANQA 2H34A 3N9XA 4FI1A 2IVSA 5GIPE 4O82A 2P3GX 4GW8A 2I1MA 2V0DA 4JI9A 3L8XA 3NVMB 3POZA 4O0SA 5HG5A 4ASZA 5DIAA 3UBDA 2R4BA 3FI8A 1KV1A 3V5LA 2XJ2A 4YTCA 1Y8GA 3B8RA 3DFAA 3FYKX 4OTGA 2DQ7X 4PMTA 3PA5A 4WRSA 2HYYA 3RMFA 4RIXB 4W9WA 3B2TA 2O5KA 4FT3A 5EQYA 2F49A 2PVMA 2BROA 4ZJVA 3D5UA 4YTFA 2R64A 4DFBA 3VRZA 4BDJA 5CF4A 2CNQA 1ZRZA 3NYNA 3P5KA 3FE3A 4HGSA 2B1PA 3Q5IA 3EN5A 4QD6A 4WOVA 2A27A 3D9VA 3IOPA 4RJ6A 3FZOA 5AAEA 4CFVA 3H0ZA 4R1YA 4QMWA 3U6IA 2UZWE 3GNIB 4NUSA 4H36A 2WTIA 2I7QA 5L6OA 3D5XA 3RHKA 5KMLA 5ETAA 1ERKA 2XH5A 2PVLA 3QTZA 1XR1A 2PVHA 5BVWA 3R28A 4ACCA 4O81A 4JOAA 2VTOA 3CQWA 1VR2A 3C5IA 4MXYA 5JSMA 3QRIA 5AUVA 4O0RA 2ITZA 5JQ5A 3QA8A 2YABA 4ZSGA 5HE1A 4U7ZA 1ZZLA 2W9ZB 2UW4A 2UW6A 4KSQA 2JBPA 2O63A 5IA0A 5IUGA 1M2PA 3RI1A 4AFJA 2QOKA 4CVAA 2QKWB 2XRUA 3TNIA 4TL0A 5L8KA 2Z7QA 4D2VA 4R6VA 5E91A 4G31A 4W8EA 4MQ1A 3TZ9A 4FKTA 2YN8A 2J5EA 3AC2A 5DE2A 2OZAB 3TZ7A 2XNOA 5K9IA 1GIHA 3NRMA 2XNGA 3QCXA 4MKCA 4WBOA 3NCZA 5ANKA 5ICPA 3FMMA 3K2LA 4YZNA 3GQLA 3IGGA 5E4HA 1REJA 1YHSA 4S31A 2O8YA 4ZY6A 1IASA 1BL6A 4G17A 3DTWA 4CMTA 4CFMA 4FV2A 4MYGA 2ZV8A 4CZYB 2KTYA 3R02A 3EQDA 4PPBA 3UO6A 4FOCA 2FSLX 4ID7A 4JL9A 4NKSA 4GU9A 1YHVA 4WA9A 3IG7A 3KN6A 3Q60A 4FSQA 3V04A 5JRQA 5M09A 4X3FC 4FV3A 2RSVA 3P1AA 3ZC6A 2CN8A 4PMPA 4JG7A 5IDPA 1JLUE 4GRBA 5F95A 3QLFA 4EOKA 2PE1A 5AUUA 3QCSA 1J7UA 4I93A 4J1RA 2XK7A 2OIDA 3SAYA 4IZ5A 3THBA 2ETMA 3ODZX 4RWKA 2PVNA 3NAYA 3UOJA 4HYSA 2YIYA 2YAAA 5DRDA 3COMA 3KREA 4JBOA 4HCUA 2G01A 4JIKA 5HLNA 4WT6A 3RBWA 4DCAA 2Y4IB 4G1WA 4BCFA 4BICA 1RDQE 4DAWA 3TI1A 4RVMA 4CSVA 3DGKA 4RIYB 3ENMA 5TT7A 3VW6A 4O7NA 2ITVA 3I5NA 3RINA 2J4ZA 4QPMA 4HVDA 3O8TA 2VTLA 5JQ8A 4E93A 4IJ9A 4YHFA 4XCUA 5CZIA 4DEDA 1O6LA 2H96A 3E8CA 4AOIA 4QMNA 3GC8A 4JNWA 5IPJA 4O0TA 3DKGA 2BRGA 2CMWA 2VTPA 5E9EA 5F9EA 3R8UA 3EQCA 3CD3A 3OWLA 3LVPA 1KUTA 4L9IA 4EKLA 3EN6A 2R3HA 2Z7SA 4YJSA 3H30A 5M51A 4PX6A 4BR3A 1FQ1B 3PVBA 2J7TA 5HHWA 3EMGA 3TACA 4GT5A 1M52A 4HNIA 2RFDA 4FV1A 4GK3A 5E8YA 3C4FA 1TKIA 5CSWA 3ZMMA 5HG9A 3K5UA 4EORA 5K5XA 4BIEA 4CFXA 4BDKA 2XKFA 3OHTA 4IX6A 2R3QA 2VGOA 1ZMVA 4DFNA 5J7BA 2UZLA 2VX3A 3EN4A 2O64A 4U5JA 3Q4TA 2XRWA 4F99A 3GC0A 2HENA 5DT3A 3LCSA 2GNFA 3Q52A 4FICA 4KIKA 4RIYA 3DKFA 4WRGA 3S1HA 2R9SA 1AGWA 2WTVA 4YGAA 4YLKA 5TF9A 4HVIA 4PP7A 5HD4A 3FKLA 3QU0A 2EB3A 3F2NA 3MSSA 1ZYJA 5BVFA 5F20A 3MFRA 1R3CA 3ATSA 4JAIA 5M08A 2WZJA 4O1PA 3K54A 3PG3A 3PXFA 4QMVA 2QKRA 4BIDA 4K77A 4XEYA 4ZEGA 3CEKA 4GFMA 4OT6A 3VBWA 1E1XA 3DV3A 3I79A 4ZLZA 5LVNA 3O8PA 3KC3A 4JDHA 3VUDA 5KMOA 4DFYA 4J53A 3G6HA
chains in the Genus database with same CATH superfamily
3R9HA 1T45A 3QXPA 4FG8A 2YM8A 3UIBA 4BI0A 1YWRA 5FEEA 4IDVA 2WAJA 4XMOA 3E7OA 4E5AX 2ETKA 2YIRA 2NYAA 3DXPA 2W1EA 5L2IA 1RQQA 3DBQA 4QYEA 4DLIA 3DJ5A 2UW8A 2X7GA 2VTIA 3NDMA 4IE9A 4NK9A 3LFAA 5LMAA 3TNHA 3MTLA 4A9RA 5IUIA 2PE2A 2WTKB 4MD8E 3WARA 3QRJA 4BL1A 2XKCA 2XA4A 2OWBA 3T8OA 1IRKA 3OT3A 4H3BA 1FMKA 4JRVA 5FUTA 1VYWA 1FINA 4RJ7A 3W2SA 2C3IB 4OTPA 3MBLA 3KF7A 4LQMA 2PMNX 2IEWA 5A4TA 3DQWA 2XM8A 3ACJA 1XH6A 2C6KA 2V22A 2X2MA 3NWWA 2HWOA 3T3VA 4YO6A 4G3DA 2F9GA 2WEIA 4NFMA 4C4IA 4IX4A 3F3UA 5IISA 2F7EE 3KY2A 5HTIA 2OBJA 3LLAA 3N4UA 3GP0A 4PRJA 2PVYA 3O17A 2IPXA 2BILB 4QTCA 4KKHA 5HO7A 1J7IA 5L3AA 3BX5A 2B0QA 4QMOA 3E88A 4IVAA 4PL4A 4XOZA 1XO2B 2R3JA 2CDZA 4MNEA 5CVHA 3RPRA 4BI2A 4F1MA 2JKKA 1PRYA 5HTCA 3H9RA 3NZ0A 3QTQA 4TY1A 4RFZA 3R7VA 2RFSA 3LQ3A 2JITA 3NMUF 3G33A 4DTKA 1M17A 4YUQA 5HX6A 4EZ3A 3EHAA 4IVCA 4IXPA 5CLPA 1P2AA 3SG8A 1W2CA 5IEVA 2OF2A 4J95A 4GFGA 4R7HA 5BV3A 5K0KA 3D83A 3KRWA 3GXLA 4DHJA 2OJ9A 5E8VA 1MRYA 2BTSA 3NGAA 5TR6A 4FEXA 2WMRA 3PLSA 3QGWA 4XS2A 4BBEA 5LMBA 4RX5A 1PMEA 1WBWA 4OTIA 4ZY5A 2W4KA 4ZSEA 4C2VA 4JDKA 4TYHB 3OG7A 2FYSA 3O0GA 3NFFB 3FXZA 1V1KA 5E92A 3TL8A 4ZK5A 3AXWA 3SDJA 4QMZA 4DLJA 4DA5A 2XNPA 3VO3A 3POOA 4IHPA 4AN3A 3ORLA 2E9VA 4PWNA 2JAMA 4GUBA 4RIWB 4U3ZA 4D9TA 4K0YA 3W10A 3BI6A 2ZDUA 2HY81 3HL7A 1UWHA 2PUIA 2GNIA 3ZFXA 4EBVA 4FIGA 1OB3A 5CANA 3KB7A 4AXAA 2AC3A 4GKHA 2PWLA 2PVJA 2XEYA 3T9IA 4RC2A 5HU9A 1OM1A 3BEGA 4QMLA 4F6UA 3WYXA 3LMIA 5LVLA 5JRSA 3RKBA 5L4QA 4R77A 4F70A 4KRDA 3MVHA 5EH0A 3RALA 4TYEA 3EYHA 5E90A 3EL8A 4AQCA 1F3MC 1YQJA 1O9UA 3CTQA 5FLFA 4FGRA 4J97A 3KEXA 4FT9A 3EQGA 4OT5A 5JMSA 4FIJA 4RX9A 2QC6A 2XK3A 2ZM1A 5E8WA 4AZVA 1TFFA 2NP8A 4JDIA 4Y83A 5BVOA 4I23A 4FTRA 1UVRA 4BTKA 1JVPP 4FTIA 3DAJA 4QMYA 5JH6A 3VUMA 4C57A 5AR5A 3OOGA 4FIFA 3KXXA 3FLYA 3PSBA 3AD4A 4F65A 1DM2A 5AP7A 2GHLA 4FV0A 3D7ZA 2BUJA 3C5UA 4CCBA 2J0KA 4QP9A 2GS6A 3GCUA 2E9OA 5HIEA 5J1WA 1U5RA 3FWQA 3LE6A 1APME 2WQEA 4I21A 4I5MA 4XLIA 5IF1A 3HA6A 2RF9A 3TV4A 4NTSA 2IN6A 2QCSA 4AAAA 2V7OA 2IZUA 3U51A 1ZY4A 1Y8YA 4UV0A 5AA8A 2WMWA 4EH5A 4I94A 5FTQA 3OOMA 3BU3A 2G1TA 3DFCB 2Y6OA 4GUEA 2OH0E 2UZEA 4DEGA 4EOQA 3ORNA 2PULA 1O6YA 4NM3A 3WZJA 1OL1A 3MA3A 3HVCA 5CS6A 3P23A 5M55A 2C1BA 5ANGA 1B38A 5AR2A 5DH3A 3LXKA 4CEGA 2R0UA 2WO6A 5LWNA 3UDBA 4JJRA 2WD1A 3PXQA 4L43A 4X2JA 4ZAUA 3CSVA 2PU8A 2JDVA 1WFCA 2VTTA 5CSHA 3ALOA 3RVGA 4C38A 1H1SA 2YM6A 4RIOA 2WXVA 4JR3A 4DGLC 5CTPA 3HKOA 4CFNA 5AR8A 3DTCA 4EH7A 1NY3A 4ITJA 3IW5A 3VIDA 4MEDA 1PKGA 4ANOA 3Q4CA 5EDPA 5L2SA 4Z16A 4AX8A 4O83A 4RVKA 3CGOA 5ANDA 4EZ5A 5DPVA 4F9YA 4L7SA 4UWBA 3DKOA 1DI9A 5DRBA 3UTOA 2XANA 1L8TA 4P90A 4C62A 1ZOEA 3F69A 5CF5A 5DA3A 4AWIA 2JAVA 3KK8A 4E73A 4II5A 3GCVA 2PL0A 3IK3A 4DEBA 3PFYA 2PMLX 4FTQA 4UY9A 4BDHA 3PP1A 2UW9A 1JBPE 2OF4A 5EDRA 2FH9A 1W7HA 2OJGA 3LOKA 4U42A 3JVSA 4JG6A 3EWHA 2PMOX 4TYIA 4M0ZA 3CIKA 3VBVA 3V01A 4D4YA 1VEBA 4EK8A 3MFSA 4C3FA 4DGGA 3I1AA 3BU6A 4CRLA 4RWIA 2YIXA 2ITNA 3D0EA 1J3HA 4FX3A 3NNVA 4EOSA 1XMMA 3I5ZA 2RKUA 3PIZA 1CM8A 3WBLA 2P33A 4UXLA 3DZQA 4KIPA 4DEEA 4F9WA 4QP4A 4L01A 5B0XA 3GC7A 5AAFA 1CMKE 2GU8A 3KIOC 4X6QC 4RC4A 4IZYA 4AUAA 1OUYA 4R3RA 3IKAA 4N70A 4ALUA 2QOCA 1GIIA 4GV1A 4UWCA 4X6RA 1G8JA 3F2AA 4JBPA 3TKUA 4DGOA 2GS7A 3R04A 4E4MA 4M67A 4OW8A 4DHFA 3NNUA 3RPYA 5M44A 4IJPA 1VZOA 5DGZA 1LEWA 1WVWA 4Y72A 3CJGA 3QHWA 2B9FA 2IZSA 3MYGA 4FSNA 1FGIA 3CBLA 1LR4A 3OXTA 4Y73A 3JVRA 4QMXA 5CI6A 4RSSA 5ANOA 3M42A 3A99A 2XIXA 3GB2A 5J9ZA 2OGVA 3CGFA 5AP6A 3GOKA 4D4VA 2VWVA 2BCJA 4UZHA 1FMOE 5HE2A 3OTUA 4U41A 3VVHA 4EHVA 5H8EA 4O7TA 2UVYA 2XUUA 2ONLA 3I0OA 2PTKA 3GU8A 1R0EA 4F9AA 1XQZA 4ZMEA 3UZRA 4QYFA 2Y4PA 2YCSA 4BN1A 4O7VA 4ZTSA 1YOLA 3BWJA 1KE8A 4YU2A 2VGPA 3PJCA 2C4GA 5CU0A 2X8DA 1UU8A 3VRYA 4CFUA 3GCQA 1FGKA 4PF4A 3WF9A 4BZDA 4UMUA 2ESMA 3II5A 3PPJA 4D58A 5EKNA 3RAKA 5EM5A 5D41A 2ZMDA 3LCDA 3MH3A 5L6WL 3DAKA 3QQLA 4APPA 4EEVA 3E93A 2GS2A 3M2WA 4FBXA 5IA5A 3QRUA 1Q5KA 5EHOA 5ACKA 3D5WA 2CLXA 3KGAA 3SRVA 3HX4A 5BUEA 2O0UA 3Q9YA 4UXQA 5DEYA 2KULA 3MVJA 3RPSA 3PVGA 1CSNA 2W17A 4EH6A 5DMZA 4FZAB 1VJYA 5M57A 4IAAA 5HKMA 5CAVA 4RBLA 1Q8YA 1NVRA 4YPDA 2WGJA 4AW5A 3UP7A 3BYVA 3GEQA 1GAGA 2BHHA 2XBAA 3VQUA 2F7ZE 3DB8A 2IVTA 3TIYA 5FQDC 3DJ7A 3LCOA 3QD4A 3V5QA 4N57A 2HWPA 3VULA 4YZCA 3L1SA 3CCNA 4YO4A 4AGCA 3U55A 1F5QA 3ZO1A 4IZ7A 2R3LA 3DY7A 3NYXA 1URCA 2HAKA 2XYUA 1WBVA 3HMOA 1W0XC 4U6RA 4FV9A 5FTOA 3R9DA 4DINA 2PZPA 3R1QA 3T9TA 4YJUA 4C4EA 3ML1A 2RL5A 4HYIA 4EOLA 5HCYA 3NX8A 4NJDA 1BMKA 1DS5A 4YHJA 3ZEPA 1G8KA 4WNPA 3KXMA 5AV4A 4JAJA 2IWIA 4LGDA 2I0YA 5FEDA 3AMBA 2BFYA 4IWOA 5KHXA 2E9NA 4U3YA 2GMXA 1Q99A 4ANSA 4LV5A 2P2HA 2FA2A 5L8LA 1IG1A 5AUTA 3P7AA 4GEOA 1XH8A 1QMZA 4H1JA 4E20A 4J96A 3NYVA 4KBKA 3ZM4A 3LIJA 1PKDA 5AV2A 3PXZA 5HZNA 1F0QA 5LJJA 2OU7A 5CXZA 4K33A 3IW4A 4PTEA 5C4LA 3HP2A 2VWZA 2HZ4A 3FC1X 4B6LA 1V0OA 2ZM4A 3LAUA 4F6WA 4TN6A 2B54A 2HZNA 3IPHA 3TNPC 3UIMA 3O96A 3VS4A 3KRRA 5KMNA 4USEA 3FMKA 1Z57A 5EK7A 5ETCA 2FB8A 4DBNA 4G3GA 4HGTA 4QO9A 2QG7A 4BY9E 3R7IA 2YWVA 2PSQA 4D1XA 4DG3E 4AGUA 2PVFA 4U81A 4J8MA 1I44A 4UYNA 3ZLYA 4NEUA 3DLZA 2CKPA 1YDRE 4U80A 4B99A 1ZZ2A 4A07A 4ACHA 3N51A 4BTMA 3PJ2A 3MB6A 2XNBA 2BDWA 2VTAA 4JS8A 5B7VA 1OPLA 5AJQA 4CV8A 3SA0A 4X21A 5AX9A 4GIIA 4IW0A 4YC6A 5HVKA 4F09A 3DK7A 1PXLA 2JDOA 3GU5A 1PYXA 1PMVA 2XK6A 3ZFMA 4HVHA 4FG9A 4JBVA 4G6LA 3KN5A 1U46A 2VWBA 3R1YA 1YXTA 2HW6A 4KIKB 2VV9A 3QAME 5KMIA 3DNEA 5KKRC 4USFA 1KV2A 5KMKA 3MGYA 4F63A 1ZOHA 3W2PA 2RFEA 4E6DA 1WBSA 3LJ0A 5EM6A 3R8VA 4CGAA 4IC7A 4FTJA 1ZWSA 3IW8A 4MX9A 4MXAA 2UVXA 3ULIA 3FY0A 1H0WA 4Q5HA 1JSVA 2R3MA 4FKIA 3PFQA 5IQFA 2EWAA 4FKWA 3JXWA 4MD9E 3ZXTA 5K4JA 3RZBA 1R1WA 1HCLA 4D4SA 2VRXA 3OD6X 2JFLA 3I6WA 4O7LA 4BCQA 4Q9ZA 3FMDA 4EK6A 2AC5A 2H9VA 3OCSA 2WB8A 3V6RA 4FZ6A 4TYHA 4S32A 2GPHA 2VN9A 2CNVA 2ERZE 2RIOA 3ROCA 2ETRA 2OO8X 5I3OA 4IX5A 1R0PA 1S9JA 1W8CA 4FIIA 4G9RA 3QD0A 3IS5A 3FLWA 5CF8A 1J1BA 2VD5A 4TWCA 2Z8CA 3DDQA 3ALNA 3CS9A 3A4PA 3TTIA 3OCGA 2VAGA 5CALA 4FV7A 2C6EA 3MH1A 3P86A 4KSPA 2GNGA 3G2FA 4L67A 5HBEA 1NT2A 3OP5A 3OUKA 3TEIA 2VWUA 1CKJA 4DH5A 2CKEA 5A4QA 4DT8A 1MUOA 5HORA 4BGGA 5H8GA 3F5PA 2JEDA 3C51A 3KA0A 4OBQA 2YIQA 3EFLA 4FNXA 5JKGA 3RJCA 2UW0A 4ZTNA 2XALA 2C68A 1OI9A 4I41A 4CFWA 3RGFA 2JIIA 4XX9A 1JSTA 3NUPA 4AT5A 3VAPA 4FUXA 4XG8A 4OAVB 3W18A 4YJNA 4AXFA 1A06A 1FVTA 3IOKA 4XG3A 5L2TA 2VWYA 2R5TA 4DYMA 2BDJA 3TIZA 2QODA 5DT0A 3ID6C 2ZB1A 3R1NA 4S30A 3UOHA 4JMQA 3AG9A 3LXLA 3QRTA 2WELA 2XNEA 2RG5A 3ORZA 4FTAA 4YPSA 3UVPA 2JGZA 4IWDA 3E63A 4IH8A 4QP7A 4C4FA 5FTGA 3W0QA 1YOJA 1H08A 2XK4A 4RJ4A 4FEVA 1UU9A 2GQGA 4S2ZA 3R6XA 1M14A 2R3NA 3H0YA 4NU1A 2ZMCA 2BR1A 4W4WA 4A9YA 3JY9A 4NT4A 4KINA 2JFMA 4ANBA 2DWBA 4IVBA 3BQCA 2GHGA 5AADA 3TNWA 1GY3A 4N6ZA 1U54A 3RCDA 3F9NA 3NNWA 3SVVA 2CN5A 3LCKA 3G0EA 1TQPA 4O6LA 4AA5A 3HRFA 3BV3A 4AG8A 5CSPA 2F7XE 3NUNA 4L68A 4YNOA 5GJGA 3QTWA 4W8DA 2HXLA 3R2YA 2YDKA 2WEVA 5M4FA 4W4XA 3Q2JA 3MH0A 1JNKA 3MFUA 4YR8A 4E7WA 2IVVA 2I0VA 3WE8A 4CNHA 2ZVAA 1H26A 5LWMA 5M53A 4IAYA 4F0GA 5KE0A 3G90X 3UQGA 3ORIA 2C0OA 3C4ZA 3FV8A 3FXWA 4GJ3A 4YP8A 4HJOA 4YJQA 5CU3A 4I6QA 4FSTA 3VF9A 1QPEA 1SZMA 3FZTA 3ZUTA 1SYKA 3DBEA 4LV8A 4M84A 4MVFA 3ORXA 1T46A 1P4FA 3OWJA 1YWNA 4QP1A 3F82A 2H6DA 1XHAA 5DYJA 1BUHA 3M1SA 2OXDA 4E3CA 3VS2A 1XH4A 2R3GA 4FL3A 4XG2A 1ZXEA 3NNXA 1SNUA 4O0WA 1Q3WA 2QOFA 1OL6A 3KL8A 3KMUA 4I6HA 4UMQA 2NRUA 4KD1A 4XJ0A 3VC4A 3WF6A 2PPQA 2X9EA 3FQHA 2OJIA 4DEAA 4FL2A 4AZEA 1JQHA 4I6FA 4ZTLA 3ZSGA 4APCA 3VUTA 5J9LA 2C6MA 4QYHA 3R0TA 5EM7A 5KO1A 5I4NA 3FJQE 4EYJA 3ATTA 5EYKA 2HOGA 3QTUA 4WG5A 2YM3A 2YJRA 3W1FA 3ET7A 1PXOA 4ZZNA 5J95A 2YZLA 1UNLA 1OL7A 4FV5A 3U9NA 3EZRA 2C0TA 3TG1A 3TXOA 4CKIA 3LZBA 1HOWA 3HZTA 3BU5A 4M0YA 2XIRA 4CCUA 5EM8A 3QRKA 4LRJA 3ANRA 4G5JA 3LXNA 3SD0A 3VS5A 2CSNA 3ORMA 3V8SA 4MXCA 2YHVA 5G1XA 5AMNA 5HCZA 2VNYA 3OZ6A 1YDSE 3FMLA 4D2PA 3W8QA 1OBGA 4ZSLA 3MVMA 3TV6A 4DTBA 2WPAA 3FI2A 2E2BA 3FI4A 4FA2A 4FUYA 3WF8A 3N4TA 4E4LA 3OEFX 2QOQA 5J5TA 1PXIA 1H24A 3L8SA 4EOPA 3BGZA 4IM0A 4E26A 3BZ3A 3ZOSA 3ZDUA 5CU6A 3P08A 4C4JA 3PVWA 4XRLA 5CAUA 2QLQA 5AP4A 2X6EA 4ASEA 1IA9A 2V55A 3C1XA 4JVGA 3LMHA 4L3PA 4P4CA 2VWXA 1XBAA 4IMYA 4FSRA 4I5CA 2XP2A 3A2CA 1ZARA 2W4OA 4RC3A 3I7BA 4QP2A 1GOLA 4XOYA 5DOSA 4FR4A 4ZJIA 3UOKA 3CXWA 4AT4A 1U54B 4DG2E 4AXDA 4BWPA 4WNMA 2OZAA 3NAXA 4AT3A 4GVJA 4AU8A 2IG7A 4XNEA 5FP5A 3TTJA 4KS8A 4X3FB 3R21A 5C4KA 3PVUA 2GQSA 5CSXA 5IA4A 1XBCA 4PY1A 2BAJA 4I5HA 2QNJA 2X4ZA 2UW7A 3DQXA 3BYMA 1XJDA 3CTJA 4IQ6A 4J71A 4ANLA 4LM5A 4FKVA 3FSFA 3A8XA 2J50A 1MRUA 4R7IA 3U9CA 4EWQA 2C6TA 3PRIA 4FZDB 3PE2A 3A8WA 4RGJA 3Q04A 4NSTA 4Z55A 4E6CA 3KF4A 2W7XA 1Z9XA 1BLXA 4NWMA 4X2NA 3UC4A 4I20A 3G6GA 4AN2A 3DPKA 4E5BA 4D1SA 1IR3A 4J99A 3LFCA 5IQGA 3KXHA 1OKVA 2V62A 5HGIA 2BZJA 2R7IA 2W1IA 3G0FA 5H9BA 3BBWA 3GUBA 2OFVA 3ZLSA 4FKPA 2YITA 3OXIA 3P78A 2QU6A 3QTIA 3VHKA 4JQ7A 2A0CX 3LCTA 3D7TA 5IH6A 4QDEA 5IKWA 4X3JA 2WU6A 5B2KA 4CG8A 4FT0A 4EHGA 3P0MA 4U45A 5CQUA 1PYEA 4G34A 3C0HA 4PPCA 3BLRA 4H39A 1UA2A 1YRPA 3MWUA 4NIFB 4QPAA 4XG7A 5D9HA 4H1MA 5GNKA 4AN9A 4C3RA 2YEXA 4FODA 4ERKA 3JR1A 4LUDA 4FKRA 3OCTA 5FRIA 3PUFC 4EOJA 1SVHA 3BBTB 4P5ZA 5IQIA 3AKKA 4RFYA 2OSCA 4XP2A 3UZTA 3NCGA 3V5WA 1OGUA 1ZAOA 2AUHA 4RIXA 3BYOA 3PLAE 3RK7A 3ZH8A 2XYNA 4RLKA 1OECA 4BZOA 1M2QA 3RPVA 5IEXA 2DUVA 1WCCA 2YFXA 3R1SA 3C13A 5IH4A 3PJ1A 4L42A 2OIBA 4O38A 3PSCA 4P7EA 3VBXA 3QC4A 4MNFA 4F08A 3EKKA 4C35A 5A54A 3ZM9A 3E8NA 5CNOA 3WI6A 4E1ZA 5DN3A 4GK4A 4AFEA 4M68A 2ERKA 4DCEA 2JC6A 3LFEA 2GQRA 1CKIA 5JFSA 3KXZA 3QGYA 4U0IA 2YDIA 4LRKA 3NFGB 2IO6A 1DAYA 5GZ8A 4K9YA 1OZ1A 3GGFA 4OBPA 5JFVA 5DNRA 4ARKA 5I9YA 4IAZA 4A7CA 3P79A 2A98A 3VUIA 2BDFA 2HXQA 4C7TA 1JAMA 1PMNA 1SVEA 3QALE 4AS0A 4RA5A 3QZIA 4X0MA 3C9WA 4UMPA 3E7VA 1JKKA 3CC6A 2C69A 3MTFA 4ONAA 4O91A 3CKXA 4J52A 4HPTE 4FKSA 4TXCA 5CAOA 5LCKA 5DI1A 3I6UA 4HPUE 4TWPA 4C2WA 3FC2A 5J9YA 3VJOA 5E8ZA 4LFIA 4RZWA 4FTTA 4BFMA 3H10A 3FZRA 4RG0A 1H07A 3EFWA 2C47A 4GH2A 4M14A 5FWKK 1YXUA 5HOAA 5TO8A 2X1NA 4CQGA 1H1RA 2ITQA 3DAEA 2BFXA 3DT1A 4HZSA 3EQFA 3R7GA 2JKQA 4PTGA 4MXOA 3L8VA 4QMPA 4M15A 3KKVA 4EHEA 5K0XA 4KBAA 1ZYLA 3UNZA 3W0MA 1Q4LA 4QMUA 2PMIA 1XH7A 3BRBA 3LFBA 3R73A 4YBJA 4YLLA 5CT7A 3WZDA 4D1ZA 3OFMA 1WBTA 2R2PA 3EQRA 5LMKC 5E1SA 3EIDA 3QHRA 3QYZA 1OIYA 2C3LA 3QZGA 4QP8A 3MW1A 4WKQA 5E7RA 1XWSA 2YLEA 3MIAA 1G5SA 1MQ4A 4GCJA 4TZRA 5GINE 3H4JA 4O7SA 2C0IA 4KIOA 4FTLA 3RTPA 4XG9A 1CTPE 4BVUA 4EHZA 4HOKA 1OITA 4L3JA 5D7AA 4DC2A 5CAQA 3QCQA 3KQ7A 5FXSA 3H9FA 3TT0A 4BIBA 2W96B 3ETAA 2QO2A 5C1QB 1H27A 5KKRB 1G8SA 3QX2A 5M56A 2W5HA 3FMJA 3QTSA 4L7FA 4OBOA 4I1ZA 5CWZA 3E64A 5DR6A 3G9LX 5EW3A 4BCHA 5FDXA 4I3ZA 4MBIA 4CV9A 5HICA 1GIJA 3MPTA 4U43A 3AGMA 3A62A 2VWWA 3BHTA 3V3VA 3ZUVA 3C4CA 4DH3A 5I9ZA 4WSQA 5LVOA 3LXPA 5GIOE 4EH4A 4MTAA 3UG2A 4FZFB 4OUCA 2QLUA 3QWJA 3E8DA 5AEPA 4KIQA 2XIKA 2G2IA 3NR9A 3PY1A 4PNIA 1GZKA 5L8JA 5M06A 2YZAA 2PY3A 4XP0A 3FBVA 5TKDA 3U8WA 2G2FA 4FIEA 3CY2A 2WU7A 3PRFA 4HNFA 2HZIA 2YWPA 4RQKA 2CNUA 2XNNA 3P7BA 3RK5A 3FAAA 4L00A 3AMAA 5A14A 3KULB 3MB7A 3UVRA 2XF0A 5DWRA 2GNHA 4KKEA 1GJOA 5IDNA 2QG5A 4KB8A 4C3PA 3BGPA 4ZMFA 3OY1A 3OUNB 2HIWA 4OLIA 4G6NA 4F0FA 2F57A 2HK5A 2WMQA 4U9AA 3AC4A 3F5XA 1W2FA 3D4QA 3IO7A 3MVLA 4K18A 3MH2A 4NCTC 4GKIA 4FNZA 3IECA 4KUJA 2GFCA 2NO3A 4RX7A 5DEWA 4Y8DA 4GYGA 4A4XA 4H3QA 4PMMA 5C8MA 5EOBA 4BDAA 3W0PA 1G3NA 5AR4A 2VTMA 3S00A 3QBNA 4JXFA 1OL2A 3M11A 3QQFA 4FG7A 5D10A 4USDA 5CNNA 3Q6WA 3AQVA 4RJ5A 4O0VA 5EI8A 5A4LA 4V05A 4FYNA 4O2PA 1B6CB 1KSWA 1STCE 3KK9A 3LHJA 4G3EA 4MXXA 4YNEA 3UNJA 4JRNA 1YW2A 2WOUA 4UMRA 5DT4A 3FYJX 5IQBA 4HCTA 4D4RA 5HQ0A 5EFQA 1TQMA 3HYHA 1AD5A 3L9LA 3HV7A 5ANIA 5E8TA 4UN0C 3Q2MA 1WBPA 2X8IA 3DXNA 5JK3A 1ZYCA 5EW8A 3BEAA 2WOTA 3QLGA 1FOTA 4LUEA 3RAWA 2OI4X 5FEQA 3PJ3A 2XJ1A 2BTRA 4FSUA 3CD8A 5HESA 3AC8A 3ZFYA 4F7SA 3ZBXA 3P7CA 1BI7A 3R8PA 1ZY5A 5T6KA 3VUHA 2RGPA 5KMJA 3NW7A 3O51A 3B8QA 2A1AB 4JX7A 3VBYA 2R3PA 4FV4A 3W2OA 3ZO4A 1ND4A 1PXJA 3KVWA 4HYUA 3R8LA 4PPAA 3PTGA 1J1CA 4GG7A 2WTWA 4I24A 4R1VA 3T3UA 3UVQA 5JZJA 4Y46A 4ANMA 3C7QA 5KCVA 2BVAA 3A7IA 3PXYA 4NL0A 4L8MA 4ITIA 4BCIA 2ACXA 3NUUA 5JEBA 3CJFA 3VBQA 4FKQA 4EK5A 4H05A 1YI3A 3GOPA 3QFVA 2IZRA 4FZ7A 3EOCA 5HG7A 3RHXA 5FM3A 3RP9A 2JDTA 4YZMA 1O6KA 4WNOA 4L6QA 3NW6A 3UGCA 5C9CA 1UNHA 4AF3A 3ODYX 3VS7A 4FNYA 3A7GA 4CMUA 5IQDA 4G3CA 3U6HA 2XK8A 3HRCA 5CU2A 3SLSA 3RWPA 4BKJA 4W4YA 3AD5A 5FXRA 3O23A 5GJDA 3A7JA 1YDTE 4MF1A 4WD5A 2FVDA 3NUAA 5BVEA 2Q83A 2C1AA 4CXAA 2UZVA 3BYSA 2EB2A 2XIZA 3TMOA 2GNJA 4EYMA 4UB7A 4OTRA 4YTIA 4ZJJA 1OBDA 3U6JA 4BHNA 5E8XA 5BPYA 1XKKA 1IAJA 3BV2A 3FKNA 3NIEA 4YZBA 2QR8A 4IAFA 3V6SA 4WUAA 3QUDA 5C27A 4EJ7A 3F7WA 4J7BA 4DH1A 3R30A 4EONA 2VO6A 1JKLA 2QOOA 5AA9A 4AOTA 1U59A 5AX3A 2OJFE 4G5PA 1W83A 4L44A 4IACA 4L46A 4NM5A 3UQCA 2J6MA 4FKJA 3EQBA 5GZ9A 1YI4A 4IADA 5CSVA 4KBCA 3EKNA 4A9TA 4OGRA 5BQ0A 2X6DA 4OAUC 4WBBB 2BMCA 3ANQA 4XBUA 2GFSA 1YI6A 3VQHA 2QONA 4GVAA 5IG1A 2ZFYA 3O2MA 2ITYA 2WMXA 4FKUA 2W99B 4QQ5A 4EI4A 3PWYA 4FNWA 4NH1A 2C30A 3EB0A 4TPTA 5TOZA 3W55A 4BHZA 3QC9A 4EWHA 2C5XA 2BZHB 1FVRA 4O96A 2ITTA 4FVQA 5HIBA 2J90A 4LL5A 3H3CA 2A2AA 4FYOA 4LRMA 3PPKA 4OTHA 3K3JA 3NVKI 3DLSA 2W5AA 2X81A 4FTUA 4AZSA 3HLLA 3W16A 3FLZA 5J5SA 4PV0A 2QHMA 2J9MA 2JIUA 1WBOA 4QRCA 4FC0A 4WNKA 2XAOA 3A7HA 3OC1A 3FZSA 4L53A 2P2IA 3LMGA 2C5YA 4IM3A 4RMZA 1BI8A 2WHBA 4RA4A 2YLFA 4KNBA 3V8WA 3LQ8A 3E5AA 5KUPA 1PMUA 4TWNA 3ZXZA 3AC3A 5IQEA 3PP0A 3TZ8A 4CG9A 5LXMA 3S2PA 3MV5A 2PE0A 4NKAA 2Z2WA 4DTAA 2W06A 2Y0AA 1Q8UA 4I4FA 4W4VA 4CT1A 5LMKA 3UG1A 1Q8TA 1BKXA 2BAKA 1GNGA 3BHHA 4JLCA 4R5SA 5AR7A 4F9BA 5A4EA 3KRXA 3CY3A 3QQKA 3S3IA 4BCNA 2QR7A 4BBMA 2P55A 1PY5A 3NSZA 3Q53A 4FF8A 3OEZA 2X2KA 2A4LA 3GQIA