5K7FA

Crystal structure of apo aibr
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
184
structure length
179
Chain Sequence
b'RYRAILETAARLICDRGYEGTSMQEIAAACRMTKAGLYHHIQNKEQLLFAIMNYGMDLFEEQVLSRVQDIANPVERLRACMRHNILLVTRGWSKEVIIILHEGETRAFIDARKKKYVDFLEEAFSQASQQGLIRPVDPTVGAFSFLGMVLWIYKWFKPDGRLTDEQIADGMVGMLFPPF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, TetR family
publication title The AibR-isovaleryl coenzyme A regulator and its DNA binding site - a model for the regulation of alternative de novo isovaleryl coenzyme A biosynthesis in Myxococcus xanthus.
pubmed doi rcsb
source organism Myxococcus xanthus (strain dk 1622)
molecule tags Transcription
total genus 69
structure length 179
sequence length 184
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF17932 TetR_C_24 Tetracyclin repressor-like, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5k7fA01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 5k7fA02
1MBJA 1NK2P 3T6NA 4I6ZA 3SFIA 5FHPA 1MH3A 4W97A 1ETQA 1EF4A 1U9OA 3S1QJ 2MSYA 1ETOA 3O8GA 2ELKA 3M4OJ 2QF7A 4AF5A 4DZPA 3LSRA 1HCRA 4GCTA 5H9TA 3WHBA 2XGDA 4AYBN 2GM4A 2VPRA 3G56A 4Y7NJ 3V6GA 1LFUP 5EG0B 3AQSA 2LR8A 5F0CA 3FKIJ 3GZIA 3BR6A 4MIMA 2CUFA 2NS8A 2EBIA 5C4JJ 5D1RA 2ID6A 2G7SA 4QIWN 1K61A 1TC3C 1QVTA 2RAEA 5F0FA 4A3DJ 2G0EA 3A02A 3S5RA 1IG7A 4UUTA 1Q1VA 4C2MJ 3ZQGA 2O7TA 2M8GX 1BA5A 3BR2A 1UMQA 2DMNA 4FE7A 3GTJJ 1HOMA 1TWCJ 3IV5A 2DJNA 4QTRA 1ETWA 3SJMA 3COLA 1WH5A 2LTPA 3O60A 1OFCX 3JRAA 1GUUA 5DAJA 2ME0A 3VW0A 1JT0A 3B81A 3IH4A 2QOPA 3BTJA 1RKWA 3JRCA 1GVDA 4B1RA 1X2NA 2YUSA 1ZQ3P 2LKXA 4RBOA 1Y1WJ 3NI7A 1BL0A 4D7MA 4FISA 1AKHA 4D5CA 5EF6A 1HDDC 2HYTA 3BRUA 5C4YA 4IHWA 1CQTA 2YU9J 2WV1A 4JX6A 1UI5A 2FQ4A 5GP9A 2LP0A 1ETYA 2DMPA 2K40A 1UI6A 2V57A 3QPLA 4FTHA 3VPRA 3S15J 1T56A 1RESA 4DZJA 1JUMA 3RZOJ 5FJ8J 1PUFA 3QBMA 1IV6A 2DMQA 1BW6A 4XRSA 3BTLA 2PBXA 2MGQA 3BR0A 4MXMA 2DG8A 3G1LA 4BKXA 1XG1A 2DA7A 4FE4A 1VI0A 3HOVJ 3HGGA 3BQZA 3DPJA 2L7FP 3S17J 2UXUA 2K9NA 1B72A 5IYBJ 1VNDA 1SGMA 1I50J 2HI3A 5K7ZA 5FLVA 1APLC 2IBDA 1MSFC 1IGNA 3ON2A 4M3FA 2VI6A 1GT0C 3FIWA 2R7ZJ 5IOYA 3ANPA 1JT6A 4DYRA 1SANA 3HB9A 3VVYA 1DU6A 1QVUA 4D7NA 5C4XJ 2IU5A 2UXIA 2NP5A 4ABZA 5JLXA 4RDUA 4GFKA 4A69C 2FX0A 2EQRA 2JWTA 1PUFB 4LOCA 5BNGA 1IRZA 3BR1A 2ZOYA 1FEXA 2M0CA 4L5EA 3ANGA 4DYCA 3VUQA 2VKEA 2VKVA 2GBYA 3HOWJ 2JJ7A 2XPUA 3E7QA 4W1UA 2EH3A 3LOCA 3VVZA 3F1BA 4JX5A 3GTOJ 3K2AA 2B63J 2TRTA 5HAWA 1UG2A 5EG0A 2LY9A 2NP3A 1ZKGA 3Q0WA 2WB1N 2KDZA 2COBA 4JNNA 3GTKJ 4MO7A 3SDGA 2E19A 2IAIA 3OIOA 5IP7J 2Q24A 5AQCA 5HBUA 2HOTA 2FBQA 2F07A 5D19A 2DA1A 2ZCMA 2L9RA 5E3NA 3OSFA 3S1NJ 2NVYJ 2DA4A 3DCFA 5C3EJ 3S1RJ 2E2HJ 3CMYA 2JA8J 3HDDA 3BR5A 1GV5A 4M3BA 3LSPA 3A01A 1XS9A 3ZQCA 1JJ8C 4A3LJ 3HGYA 5FGLA 2X48A 3HIMA 2M9HA 3F0CA 4J19A 1BJZA 4GFLA 4NELA 3HOZJ 2GLOA 1ZK8A 4ME9A 5M5YJ 2JA5J 2X6OA 2HDDA 3BR3A 4XRSG 1RETA 1GV2A 2XB5A 1S7EA 1H88C 1U9NA 1JUSA 2DN0A 3BNIA 2W48A 1A6IA 1U8BA 2R5YA 1A5JA 2HXIA 2EZHA 3VW2A 2DA2A 4AC6A 5F1JA 3GTMJ 1JKOC 2H8RA 3RKQA 3V78A 2R92J 1LE8A 3RQIA 3HOXJ 1P7IA 3GTQJ 5CXGA 3B6CA 3EUPA 4GCLA 2HYJA 2LLKA 1SFOJ 2LVSA 2CQQA 3S16J 2QKOA 3A01B 1GDTA 3NARA 2PZ9A 5M5XJ 4A3EJ 4ACIA 2RHAA 2Y31A 1WI3A 2ME6A 5C44J 1WPKA 3AQTA 1JJ6C 4JKZA 3BG5A 3HTIA 4C3IJ 3PASA 4M3DA 2HKUA 4M3GA 4HNVA 1X58A 2M2EA 1MBGA 2HOAA 3Q0UA 1OCTC 5J3LA 4S0HB 2R5YB 5IYDJ 3HKZN 1F36A 3HE0A 2NOGA 1Z77A 2G7LA 2YVEA 5K7FA 1OCPA 4HKUA 1ETXA 2MG4A 5FKKA 1LE8B 2HXOA 1Z0XA 4A3JJ 1LFBA 2CU7A 3H0GJ 2XPVA 4IEJA 4I76A 3M3YJ 3FISA 1G2HA 3LHQA 4XRMA 2X9DA 4AC0A 1YRNA 2DA3A 4MFDA 2YS9A 4YZEA 5CXIA 3PPBA 4UUSB 3KKDA 3TP3A 1W0UA 2XB0X 1QPIA 2O7OA 5M5WJ 1ETKA 5EFYA 4JX4A 2L7ZA 2OERA 3GBGA 1HDPA 3BTCA 5IP9J 4JL3A 3ZQIA 4MK6A 2ZB9A 3MVPA 4QSHA 4PXIA 4BY1J 5EYRA 1MNMC 2K9QA 5E3LA 3BG9A 1RPWA 1IDZA 2G3BA 4BBSJ 3G7RA 4CGRA 1ETVA 1RKTA 5F08A 4L62A 3KZ9A 1O4XA 2HQ5A 2LD5A 4BY7J 3NPIA 1JTYA 1YRNB 1ZTRA 9ANTA 3LJLA 1AU7A 3NXCA 3TP0A 4C3HJ 3ZQFA 3BT9A 2WUIA 3CQZJ 3S2DJ 2N8GA 2Y0SN 2TCTA 3ZOBA 1OJLA 4A3MJ 2ECBA 2XGCA 1F43A 4A3CJ 3QKXA 2JN6A 1MBHA 2FJ1A 1U78A 3JSJA 3HBLA 2E1OA 4G12A 5HSZA 4CYCA 3IH2A 2REKA 2E2IJ 1JTXA 3I4NJ 3JRFA 2DA6A 5E3MA 1K83J 2LFBA 4BBRJ 3BJBA 3NNRA 2G7GA 3WHCA 3HM5A 1NTCA 4DYQA 2GFNA 4NDLA 2QWTA 2EZKA 5IYCJ 1TWFJ 5FLMJ 1AHDP 3IH3A 4IHVA 5E3OA 2RASA 5DTDA 4GCKA 3LSJA 2XRLA 4MLOA 5F04A 2NS7A 2UXHA 3S14J 4AUXA 1JGGA 1D5YA 3BCGA 1H89C 2XDNA 4KWAA 3E7LA 5IOZA 1E3OC 1MBKA 1BW5A 5FKOA 2D6YA 3OOUA 4B3AA 2VUMJ 1RR7A 5CW8A 4CYCB 4JYKA 1R9TJ 2IEKA 2FD5A 3NAUA 5FKLA 1MBFA 1ZGWA 3VIBA 1WH7A 3CRJA 4A93J 3VOKA 4UDSA 3CCYA 5K58A 3RD3A 3S2HJ 2DG7A 1JUPA 2L0KA 2CRGA 2MW8A 1I3QJ 4A3GJ 1POGA 2ZOZA 3S1MJ 4D5FA 5EDNA 3P9TA 5F27A 2NVTJ 2NX4A 2W53A 4JP0A 4UUSA 1FTZA 5M3MJ 2D5VA 2Y2ZA 3MN2A 2NVQJ 5EGOB 2LK2A 3FK7A 1HLVA 1ITYA 3B6AA 4A3BJ 5EZHA 3BTIA 2JA6J 1DU0A 5JLWA 2GENA 2QIBA 3K7AJ 2OPTA 3PO3J 2YVHA 3L1PA 3CWRA 3I4MJ 3C07A 5GPCA 2KT0A 2K9SA 3LSGA 5HODA 3PO2J 3JRDA 5EZGA 5DS9A 3BQYA 4A3IJ 4GFBA 4DW6A 1XC5A 4X6AJ 3Q0VA 1IC8A 5K7HA 3VOXA 3C2BA 3GTPJ 1IUFA 2UXOA 1VFCA 5D18A 3QQAA 1JKPC 5J1UA 2ID3A 3HTHA 4ICHA 1B8IA 3NRGA 4X1EA 2P81A 3IUVA 3GTGJ 5EEAA 2HOSA 4XK4A 3ZQHA 3FRQA 1P7JA 3W6VA 4V2GA 1TWHJ 2O9LA 4EEFG 4IHYA 1FJLA 5FKNA 2XPWA 3UKGA 2NVXJ 3ON4A 3GEUA 3JRHA 2DMUA 2XGEA 5J1RA 2R5ZA 2GUHA 3HOYJ 3KKCA 3Q3SA 2AO9A 3BHQA 2ZCXA 2R0QC 4A3FJ 2L7MP 4BXXJ 2DMTA 2PMZN 1T33A 4MFEA 3H3VK 3G1OA 1NK3P 1MBEA 1H8AC 2JK3A 3LWJA 2DTZA 3KNWA 3JREA 2QTQA 1X2MA 2H1KA 1WGXA 1FIPA 3JRIA 1B8IB 1IJWC 2ECCA 1AKHB 2Y30A 3HOUJ 1MSEC 3JRGA 4B4CA 4M6VA 2WGBA 3PM1A 3CDLA 3HEFA 1WCMJ 1HF0A 2Y9YA 1QRYA 4C3JJ 4XIDA 3HTAA 3TEDA 1ZR4A 5GPAA 3CJDA 2R5ZB 1TWAJ 3RH2A 5IP6A 1MH4A 3VP5A 1ZR2A 3ZQLA 1I6HJ 2DA5A 4NN1A 4XICA 3OSGA 2JA7J 2R93J 1TWGJ 3VW1A 2UXPA 5J1YA 5FKMA 4IHXA 2ZCNA 2WAQN 2E2JJ 3GTLJ 4M3EA 4FCYA 2OF7A 1ENHA 3EGQA 1UHSA 2EZLA 3BG3A 2EZIA 3QPSA 3RZDJ 3MKLA 3HTJA 1Y1VJ 4A3KJ 1B72B 3DEWA 3MNLA 1VF9A 5M3FJ 3TW7A 2CQXA 2CJJA 1IDYA 2CUEA 2M34A 3O8HA 1FIAA 3VVXA 2O8KA 3JR9A 2XSDC 2Y9ZA 5EGOA 1ORKA 2JMWA 3LNQA 5FMPA 3D1NI 2QCOA 4Y52J 3FK6A 1JKRC 3A03A 1W0TA 5IPAA 1FTTA 2I10A 4V2FA 3TW6A 3JRBA 2OI8A 3G1MA 1JKQC 5F0HA 2AHQA
chains in the Genus database with same CATH superfamily
1NK2P 3T6NA 1N75A 3SFIA 5FHPA 4YFNF 3L2QA 2M7BA 2OQRA 4MQ9F 1G3TA 3GX4X 3ZMZA 1T08B 2K85A 4XN3A 3O8GA 1Z7LA 2ELKA 4XL9A 3M4OJ 3K4BA 3C2HA 5DDGA 3WHBA 4BE0A 2Y0SA 2GM4A 4ESBA 5F0CA 5C4JJ 4YIRX 2FQ3A 5D1RA 3ZQ7A 3LA7A 3MCZA 2A3SA 1QVTA 2XASA 4HNUA 4BDZA 4LK1F 4IQJA 5HDNA 1IO2A 1EKEA 2O3FA 3EUAA 3OYLA 1HW2A 1Q1VA 4C2MJ 4RMNA 4KICA 1PUEE 1VQ4I 1HXDA 3ONQA 2UXNA 3TDUC 3ZN0A 2CWEA 1BA5A 3BR2A 2BEOA 3MWMA 3GTJJ 1JI8A 1ETWA 5IT9K 1L3LA 3SFZA 2P6SA 2ZJRF 3I3LA 3FDYA 3JRAA 1S72I 1Y0UA 1WSUA 3CTAA 2M45A 2R7RA 3E6MA 4D0PA 3FHZA 1CF7B 1RKWA 1W7PD 1X2NA 2V6CA 3K4KA 4JOMA 1Y1WJ 1BL0A 2IGNA 1AKHA 1FP2A 1HSTA 3JCUC 1BR2A 5EF6A 3HXLA 3V7SA 1R6RA 1X4OA 5ILVA 1CQTA 2FBHA 2WV1A 3PNTA 4MQVA 2FQ4A 1D8KA 2QVOA 5DCFA 4HX4A 1HA8A 2DMPA 4BXFA 2KMUA 3E6BA 1T56A 2W82A 1JUMA 2X6WA 2DMQA 1BW6A 2LY1A 2PBXA 2JQ7A 1XSVA 2KDOA 2HVRA 4RGSA 2DG8A 3H5AA 2MLKA 5HOOA 1JXSA 3HGGA 3SXYA 5JFRA 3BQZA 2M4KA 2K9NA 1B72A 1A36A 5IYBJ 2ISZA 5CQEA 5K7ZA 1APLC 5JVGF 1IGNA 2H09A 4I99C 3EPZA 5EEHA 3ANPA 1Y56A 1SANA 1WJ5A 3HB9A 3CCUI 4QLCU 1DU6A 2KRHA 1IXRC 1W4MA 4M71A 4LITA 2NP5A 4GFKA 4A69C 5D8KB 1MMDA 4B44A 2PEXA 5J4YA 4LOCA 3OMYA 2M0CA 3D5LA 4DYCA 3DPTA 2ZJQF 3WTXC 1ZELA 2EH3A 4RB3C 2P8TA 4HV5A 4JX5A 1AOYA 1T95A 2TRTA 3M8FA 1IRXA 1USSA 1OLTA 2RNGA 3H3UA 2LY9A 2NP3A 3ZGKA 5KNLA 3ZQQA 3LMMA 4UVCA 3K70C 5F6FA 2KDZA 3HZJA 3ZPLA 2COBA 3IRRA 3SDGA 2BY3A 5AQCA 4PFPA 3LFUA 2HOTA 2Q2EB 4E6KG 1XTAA 2M30A 3E6DA 2F5FA 1BI3A 2P5VA 4U88A 3RIRA 2JA8J 4L18B 2JUGA 1GV5A 4M3BA 2OCCH 3A01A 1XS9A 1O3SA 2ZCWA 5EEGA 1EV7A 4LLGF 2E1NA 2B9SA 1BJZA 2RREA 5GAHJ 3CMEI 4GFLA 4CCLA 2GLOA 2DPUA 4ME9A 1JGSA 2EB7A 4UVAA 4B3XA 3EYYA 3KP2A 3ZN1A 2XB5A 2CS3A 1P6RA 3G4SI 1H88C 4H0EA 4U7DA 3WE2A 1VQ9I 3PUFA 5DEQA 3CCVI 4DQ2A 1R5GA 4ZDPA 3AG1H 6PAXA 2MA3A 1QO0D 2YX7A 2X1CA 2DAOA 1IN7A 2EFOA 2I8DA 4GCLA 2HYJA 2LLKA 3WTYC 2B1EA 3IC7A 2LVSA 1R1TA 1I5ZA 1U3EM 3W2VA 3FM5A 1E3HA 4Q5SF 1YIOA 5M5XJ 4ACIA 2F48A 2GZWA 2Y31A 2ME6A 2OZ6A 3L2CA 5C44J 4CCMA 1OISA 3AQTA 2G7UA 1R00A 4XLHA 3DEUA 5L3DA 1S6LA 4XLAA 3OYNA 1OCTC 5J3LA 3KPHA 4CO8A 1RZ4A 3L09A 4U9LA 3HKZN 2VXDA 1OCPA 4E7JA 3V7RA 2MG4A 1LE8B 3CJQB 3K1NA 1KU9A 3QP6A 2CUZA 1LFBA 3AAFA 1XSXA 3FISA 3X2QH 2IS2A 3FMQA 3LHQA 4XRMA 2CW0F 2YS9A 2CQ7A 2DO7A 5DD8A 1ZH5A 3PPBA 2K9MA 3KKDA 2LDUA 4JQFA 3AKZA 1QPIA 2VT2A 3HYIA 5M5WJ 1ETKA 5CVUA 5TISC 1J75A 2NRAC 5EFYA 2L7ZA 2W25A 4AIJA 4O6JA 3GBGA 3AG3H 4IOCF 3CD6I 3JAMZ 4BEHA 1WQ2A 1Z9CA 2ZMEC 4XLEA 2NNYA 2XUBA 3GO5A 3C3WA 3MVPA 1BI1A 4G6QA 5CVIA 4BY1J 3JTGA 1MNMC 1DGWY 4G6TB 2L9VA 4KYWA 3HIFA 1TNTA 4U0WA 4Y4RA 1RI7A 4R8HA 5HDKA 2HR3A 1YRNB 3F6OA 1ZTRA 2QKMB 2Z33A 4Q48A 2NOJB 3TP0A 4IHSA 3D5RC 3RKXA 4XKCA 4OAZA 2N8GA 5JHFA 5TGTA 3HC7A 2TCTA 4UXNA 1BOAA 4KT5C 3F21A 1F43A 3LSTA 4AIDA 4N0BA 2BHYA 1W7PA 4A3CJ 3QKXA 4R1HA 5DUIA 4F93B 1KQ8A 3CC2I 2FJ1A 1U78A 2K7LA 3E5XA 2ZXJA 1T39A 4C9YA 4I01A 3JSOA 4XQFA 2REKA 2ELJA 2Z9OA 1BIAA 2E60A 2DU9A 1KYWA 5D6FA 2QA4I 4IF4A 1MDMB 3LWFA 2HOEA 3NNRA 5LFAA 1J5YA 1DDNA 2GFNA 3WU2C 5IYCJ 3LQQA 1P9QC 3OR1C 4IHVA 1D5VA 5E3OA 1SD7A 2RASA 2DDBA 4LIVA 5F04A 2UXHA 2H27A 4PSWA 3S14J 1JGGA 3BCGA 1H89C 4E7HA 2XDNA 2KHMA 4KWAA 4CUGA 1B6AA 1E3OC 1MBKA 4WK8F 3U2RA 2HYFA 3I59B 2GWRA 2K9LA 4G7ZF 1YOVB 5E20A 3FXJA 3OYMA 2FA5A 1VQ6I 1WVRA 4CH7A 1H0MA 4L9NA 1YJNI 1Y8QB 1ZLKA 3TKYA 2A6EF 1RC9A 1FX7A 2K3FA 2LH9A 3OL4A 4HNTA 2L0KA 2MW8A 3ECOA 3VSLA 3KP6A 3W2AA 2F5DA 1QZYA 2ZOZA 3ISPA 3T5XA 3EYIA 4D5FA 5EDNA 1I1GA 3VTIA 2EFNA 3KX2A 3M7GA 4YEJA 4JP0A 4IKFA 2EA4A 1AA7A 2MBFA 5M3MJ 1XSDA 1H9TA 1N78A 2R3SA 1EH8A 3FXKA 1TP4A 3REOA 4EJTA 2NVQJ 2WB1A 3G2BA 2PN6A 3B6AA 3U1DA 3RYPA 3RTRA 3MKYB 2PLYA 2L7KA 5FO5A 2RQQA 1VZ0A 2HZDA 3KIOA 5JI6A 1DU0A 2GENA 2QIBA 3K4LA 2VIXA 3MAJA 2EJRA 1O7FA 3WTWC 4D1QA 2NS0A 1HKTA 4X0GA 4BJ6C 2KT0A 1RNLA 3BJOA 2DT6A 4GFBA 2G7HA 2GXBA 3FXRA 1XD7A 3Q0VA 1IC8A 1AWCA 3H9GA 1A04A 3V42A 2KZGA 5LHHA 1TNSA 4UUVA 2UXOA 1XMXA 2Z99A 1VFCA 5J1UA 2ID3A 3DWLE 3R6SA 2P81A 4XLFA 1T0FA 3GTGJ 4BQQA 1QPMA 1SVLA 2UZKA 3FZVA 1BIBA 3KLOA 3QAHA 1I3AA 3ZR8X 1ZG3A 1TWHJ 2O9LA 4RM2A 1W5TA 3UKGA 2NVXJ 5CVJA 1ACIA 3JRHA 2LRDA 3L7WA 3KKCA 3Q3SA 4DJAA 2ZCXA 1MDMA 2LMDA 2R7XA 3LSMA 4N4OB 4BXXJ 3V8LA 5BOXA 1R58A 2LG4A 2PMZN 1T33A 2DJIA 3PFIA 4MFEA 2STWA 3VOEA 2O0YA 2OCEA 2JK3A 3PIPF 2DTZA 3OYFA 2DFHA 3ELKA 4XN0A 3OYGA 1U8RA 1HW1A 1U5TA 2IJLA 2HNHA 3WG9A 1X2MA 2H1KA 2QTQA 1WGXA 3FMRA 3J7AO 3JRIA 3CMMA 2VLAA 3HOUJ 1ZGJA 1MSEC 2KIQA 2VJ4A 1BM9A 1IW7F 2WGBA 3PM1A 2IW5A 2KJCA 3I59A 5FGMA 2QQ9A 4AIHA 3K4CA 2P4WA 5A2QZ 2BZTA 2AS5F 3ZCOA 5K5QA 3E97A 2V1XA 4U0VA 5GPAA 1TWAJ 4LD5A 2CV0A 5IP6A 2I5UA 1GXPA 1YJWI 3DF8A 1V5GA 2DYRH 2DA5A 3CUQC 4CDGA 2UUZA 4AWXB 2BVMA 4M9ZA 1LPQA 4IHXA 4KMUX 3E3VA 2MD5A 1Z1DA 4FCYA 2OF7A 1MMNA 3GCMA 2JVHA 3RZDJ 3MKLA 4DGWB 3T1BA 3HTJA 1Y1VJ 2L4MA 4A3KJ 1ZRFA 3ZMSA 4LB6B 2PG4A 2ZXWH 2A5WA 5LRRA 2EIKH 4P96A 2VONA 2Z2SB 5ERIA 3LNQA 5FMPA 1T98A 2HDWA 2I10A 2OI8A 5FRNA 2VODA 1MBJA 3K4MA 1MH3A 4EJWA 1U9OA 2E1MB 3FXMA 3S1QJ 3CJTB 2A68F 4Y15A 4IJAA 5DYMA 3ZRGA 3AL0B 2VJIA 1ETOA 3HJEA 1S5LC 3LSRA 5H9TA 3MMYB 5DCMB 3OWTA 3G56A 1V55H 3AQSA 4KISA 2TDXA 3HOTA 2NS8A 4HSTA 5CVRA 1IUYA 2CSOA 2ID6A 4U87A 2G7SA 2NXNB 2FRHA 2FXAA 1TC3C 1YW7A 2XVCA 3WE3A 3KE2A 4A3DJ 2VJJA 2G0EA 3S5RA 2DT7B 2VQCA 1KU7A 4HSRA 2KP6A 1PDNC 2FMLA 3BJ6A 1TWCJ 1VQKI 2DJNA 1OR7C 2E7XA 3KEYA 4QTRA 3WGHA 5TRDA 3COLA 1WH5A 1IN4A 2LTPA 2W24A 3ZMTA 2L3DA 1GUUA 4YRVA 5DAJA 3MEXA 4OMZA 1OCZH 3IH4A 3W3CA 1GVDA 3DEEA 3WGGA 4EM2A 2YUSA 1Y0NA 4F52A 3J81Z 2LKXA 4RBOA 3I64A 1O57A 3BY6A 4FISA 3C2GA 1ZG5A 2DFEA 3IRQA 1HDDC 2HYTA 4M74A 4BJ5C 1RR8C 3ABTA 2YU9J 4O5VA 1UI5A 2E5NA 5GP9A 4HZFA 1ETYA 2GA1A 2FSWA 1LDDA 4GXOA 3MD2A 3QPLA 3OOPA 4A6EA 4ESFA 1RESA 2K86A 5FJ8J 2P5KA 3GYHX 2O8XA 3BDDA 2HGCA 1PUFA 1IV6A 3BTLA 1IRGA 2R7DA 3BR0A 3MQ0A 3G1LA 1SD6A 1XG1A 2A69F 4FE4A 3DTIA 3GVAA 1VI0A 1Y39A 3CZ6A 4CZZA 1E3PA 1UJ8A 2B0LA 2VOPA 4UB8C 4KA4A 2DYSH 1Q1HA 4Z6YA 2DODA 1W5SA 3LA2A 4RGXA 3DFGA 3S17J 4GYGA 1F1ZA 4BQAA 1VNDA 1E0EA 2NAZA 3IHUA 4N9IA 1P4XA 1XMKA 3P9KA 2MFZA 5ICEA 1FLIA 5IOYA 4WXDA 4I09A 1JT6A 2JA2A 3W2WA 4YG2F 2HFHA 4H4KC 5D8LB 3RSNA 2IU5A 1GVJA 4HF0A 3BCAA 4B8XA 2JWTA 3BZCA 2GAUA 3BR1A 3DBHB 3GFMA 1PVEA 4KIBA 2VC1A 4NUBA 1W36C 2VKEA 4HPQA 1T2KA 1LJ9A 5HDGA 1I1SA 4B48A 3LOCA 3UR3C 3F1BA 3FHNA 3K2AA 5B3SH 4G94A 4KUMA 4YFXF 4RAFA 4OIOF 1J09A 2X85A 5E17F 3B73A 3FWEA 1UG0A 3C7JA 3F8BA 4I02A 1ZG1A 5H6QA 3Q0WA 5D4SA 2RQPA 3E5UA 3ECHA 4PJNA 3GTKJ 4ON0A 4K2EA 2Q24A 2L2OA 2FU4A 4LFUA 1X1PA 3H0DA 3ERED 5D19A 4XOTA 4II3A 4KMFA 5C3EJ 3S1RJ 2ZC2A 4V19K 3K70D 3NWTA 1G4DA 1DUXC 4XBFA 2HPIA 4LG3A 2V7FA 3HGYA 5BQTA 4J00A 1FT9A 2X48A 3K10A 4B09A 2J5OA 1ZARA 3E0JB 4LLLA 5HVQC 2JA5J 5B1BH 4CXFA 3KYLA 1S7EA 4M6YA 1U9NA 2HEOA 1BOBA 3QWLA 1MMGA 2W48A 2R5YA 2HXIA 2DA2A 4AC6A 4WF2A 1SVMA 2MD0A 4OIPF 3H36A 2BY1A 4F91B 3WG7H 3RQIA 2LF7A 1BC7C 3HOXJ 1P7IA 3GTQJ 2D1HA 2V79A 1Z6RA 4IZZA 2XAGA 4MTEA 2L01A 3S16J 3A01B 2ICWG 4ZYGA 1DQUA 3NARA 5LGTA 2Q8KA 1EH7A 1TT5B 2FMYA 3BJAA 1I27A 4HRIA 3MZ8A 2EWNA 1W5CC 1WI3A 1RIOH 1BBYA 5BMZA 1JJ6C 4DBQA 2OD5A 4GCVA 3H5NA 2QQBA 4M3DA 1S7AA 2CFOA 1P2FA 1KONA 1X58A 2R7OA 1LDKB 3CP8A 2RVCA 4M3GA 4HNVA 2M5WA 4NC7A 3ZMVA 2V4JC 1DP3A 2RN7A 4S0HB 3SYTA 5JHUA 4U9NA 3QOEA 1R71A 1ONVA 4HKUA 5FKKA 4BXUA 1Z0XA 1T38A 1D0ZA 4AM3A 1TW2A 2DDAA 2ZJ2A 2DW4A 2CU7A 4N4NB 3H0GJ 1B4AA 2XPVA 4HDUA 4IPAA 1G2HA 1GXQA 4EV0A 1LB2A 1A35A 2IP2A 3T8TA 2KPMA 4AYBA 3ZXSA 1WFXA 5JVTA 3HOSA 5GAGJ 2LKPA 4PSXA 3A1YA 1X1DA 2IGMA 4BJTA 3J7AY 2YVXA 2XAUA 1ULYA 2AQFA 1HW5A 2BY2A 2P0WA 4BQNA 2W4SA 3BPXA 2FE3A 2LOOA 3CF2A 2EA2A 3ZMUA 2W00A 3I53A 3BTCA 4IRVA 4RAYA 5LGUA 2ZB9A 2E71A 3H1CA 4QSHA 3TO7A 2BV6A 3CCLI 1FOXA 2M1BA 1V5EA 1IDZA 4CGRA 3F22A 2EPFA 2GA2A 3LA3A 4D9JA 1SEUA 3FXQA 3T0YA 3KZ9A 5LHIA 1F5TA 1O4XA 3M07A 4BY7J 1JTYA 5D4RA 4CYDA 2KJBA 3LJLA 3NXCA 4CA0A 3G3ZA 3KP4A 3CQZJ 3H35A 5HNHA 4L0ZB 1SFUA 2Y0SN 4C30A 1OQYA 3DBLB 4A3MJ 5HS7A 1FNNA 4PJJA 2UV1A 2IGOA 1MBHA 3KYDB 1M1EB 1XGNA 5DM6F 3JSJA 3KLNA 2E1OA 4ENJA 4BEHB 2WADA 5K5RA 2E2IJ 1P4AA 3K0LA 1JTXA 1BR1A 3DBRB 2HKUA 2HKOA 1CGPA 5E3MA 1K83J 2CV2A 2LFBA 2QEXI 2XF6A 5FB2A 2L9SA 3WHCA 2DOEA 2A07F 1IAWA 1NTCA 2QWTA 3PUBA 3CO7C 4M9XA 2EZKA 3DTKA 5FLMJ 1AHDP 5LD2C 5K1YA 3IH3A 5L3EA 5DV5A 1E2XA 3F8NA 4O3MA 1D5YA 3TO6A 3K4JA 1NG6A 2DQLA 3E7LA 1W7PB 5IOZA 4L0YB 1YG2A 2OC6A 2WA0A 3BP8A 1FMVA 3OOUA 5FKOA 2AXTC 3BZ6A 1QA6A 2IRFG 2ADUA 4XLPF 5ICGA 1FBSA 4KNYA 5FKLA 1J2XA 4HEA2 3IWZA 4P55A 1MBFA 5HS8A 4P5OA 1TTYA 3AG2H 3RQ4A 5IT3A 1IN6A 5AIQA 3F9KA 2V6EA 4UDSA 3DQVC 2FNAA 2CRGA 2P7VB 1REPC 4A3GJ 2VBWA 2NVTJ 4GDFA 4CCOA 3P9IA 3V8KA 4CZCA 2Y2ZA 3MN2A 3JAMK 4A6DA 2LK2A 1JHFA 2MC3A 2F5EA 1UHWA 4A3BJ 4YIFA 1TL8A 2IA1A 3M1EA 4IRHA 1G59A 2XGXA 2HKXA 2ISYA 3PO3J 4ZDOA 2VKHA 2EIJH 1B9NA 3I4MJ 4PJLA 3LSGA 4BQOA 2B7EA 2PQ8A 3PO2J 4E4HA 5DS9A 3ULQB 1XC5A 2E7WA 2PFBA 3P7NA 4U7BA 2V9PA 3I5UA 2KRFA 1VQ7I 2BGCA 3I4PA 4HQEA 5J40A 4CCJA 1B9MA 4EMSA 5D18A 1JKPC 3HTHA 3GWZA 2LC2A 4RLFA 2Y48A 4BL0B 3NRGA 4ICHA 1KU2A 4UV8A 4XK4A 2DK5A 3FRQA 2ELHA 3S8PA 2OBPA 3W6VA 5J47A 4EEFG 4RM3A 1FJLA 1Z7UA 3ON4A 2XGEA 4PZJA 4N9HA 2GUHA 4XMYA 2X6XA 2AO9A 4NHJA 2P5LC 1TQMA 5D5XB 4A3FJ 4HX8A 2VE8A 4LG0A 1PYVA 2OJED 2DMTA 1LUJB 3V8JA 2A6HF 2X0LA 1K6OA 3QYEA 1NK3P 1MBEA 1QNTA 2R7FA 1XGOA 3KNWA 3JREA 1USTA 3TOBA 1X19A 1OKRA 4P1WA 2QUFA 2GOXB 2HZTA 3RJPA 3CDLA 2QGUA 3HEFA 4WCGA 2JTVA 3KZZA 3VEPA 3BC8A 1R49A 3H9QA 5B1AH 4G7OF 1ZR4A 3J80Z 1JHHA 3CJDA 3GLLA 1MZBA 3S3MA 3RH2A 3TOAA 1MH4A 3VODA 3M8EA 2VN2A 3G73A 1IXSB 3ZQLA 4IHTA 5CQGA 4UV9A 3HRSA 5IY5H 2VQGA 5J1YA 2X1EA 5FKMA 2R7VA 4RLQA 5HLHA 3PNYA 3DXJF 1IF1A 4AVZA 1YS6A 5DM7F 2E2JJ 3S32A 4M3EA 3EGQA 1UHSA 2DQRA 1DP7P 3KP3A 4EJOA 1U5TB 3LL7A 3HPGA 3SZPA 2H94A 2HVQA 2QWWA 3SZTA 4NB5A 2CUEA 1SMTA 2LY2A 2XRNA 1Y6IA 1VQLI 3D1NI 4PJ0C 4Y52J 3FK6A 3B02A 1YI2I 1W0TA 2R7TA 2MH2A 1LKXA 4IOAF 3G1MA 1FOKA 3BWGA 1LEAA 2WBMA 3WTSC 2YX4A 1ON2A 5E1XA 4RB0A 1U2WA 1ETQA 4W97A 3DLAA 4E7IA 2XAFA 3O3KA 2M8EA 4FETA 3OYBA 2JPCA 3A4CA 1JE8A 2PJRA 2QENA 2QF7A 1HSJA 2LSOA 3AFHA 4DZPA 1HCRA 3KETA 2ZMEA 2M0MA 2XGDA 4G9YA 2LNBA 2EFWA 1D0YA 5F1RA 1FOWA 4Y7NJ 2HU9A 3V6GA 4EGZA 3C18A 1LFUP 4HF2A 1IZ1A 2IS4A 2XC7A 2QSFX 1K4TA 1G3SA 2CH0A 2DOAA 3BR6A 1R22A 2CUFA 4XSXF 3WU0A 3GZIA 2BE5F 2VT3A 3QYBA 2WV0A 3OY9A 3S2WA 1K61A 1FBUA 4L5JA 2NYXA 3MKZA 2IA2A 4WXCA 1IG7A 1YLFA 4UUTA 4L5IA 4NBQA 3ZQGA 3WU1B 3HHHA 1BI2A 2O7TA 2M8GX 3E5QA 4DOZA 2DMNA 5TJJA 3SJMA 4OIQF 2Z5UA 1K7AA 3OR2C 4WWCA 1KA8A 4OU0A 5DUKA 3VYSB 3L2WA 3B81A 2OAZA 2QOPA 3BTJA 2PJPA 3GFLA 4B1RA 4YIIA 4AU7A 3A0BC 2HTJA 3NI7A 2L4AA 4D7MA 1J59A 5JR3A 2CG4A 4XONA 5FLXK 5C4YA 4OOIA 2JSPA 3BG7A 3R4KA 2FOKA 4IRGA 2V57A 4BS9A 2Z3YA 3QPTA 4CCKA 3S15J 4FT8A 1HKQA 4DZJA 1ZHFA 3QBMA 2JUCA 4XRSA 4HX7A 3DPLC 5AONA 3U21A 3P5JA 3VYRB 3HTSB 3PNVA 4PGGA 2KLOA 4ZTJA 5GTIC 3S3OA 1PP7U 3K69A 2MC4A 3DPJA 1FY7A 2M4GA 1BI0A 2L7FP 3VYTB 2UXUA 1SGMA 1I50J 5FLVA 2IBDA 1HKSA 1SFEA 2ZXHA 4M3FA 1MIJA 3FIWA 4ASNA 2R7ZJ 1J9IA 2LF8A 1WWXA 3FBNB 4DYRA 4RA2A 4LK0F 1LDJA 2VBYA 3V4GA 3EUHC 1QVUA 1SD4A 4LMYA 2RNJA 2UXIA 3BLYA 3BCBA 2HTSA 3E6CC 4B47A 1PUFB 3SZGA 2BW3A 1IRZA 2ZOYA 3ANGA 1V3FA 4L5EA 3MFKA 3QU3A 2ACJA 2VKVA 3HOWJ 2JJ7A 2XPUA 2E5ZA 4W1UA 5DD4A 4DNCA 3E7QA 1XCBA 3U1KA 1VQMI 1KQ0A 2F4OB 2OU2A 2B63J 3M1CA 5HAWA 1UG2A 1UELB 3IAS2 4A0ZA 1W36D 1S9HA 2X1DA 1L0OC 2WB1N 2DCEA 2E19A 3OIOA 5HBUA 3KP7A 2FBQA 2F07A 2DA1A 2ZCMA 2L9RA 3SQNA 3S1NJ 2NVYJ 2DA4A 3DCFA 5E79C 2Y75A 3BR5A 1V54H 4TV7A 1OCRH 5HLTA 2A61A 3ZQCA 2F5VA 3VYUB 4HW0A 5FGLA 1G6NA 3QYFA 1MNEA 5FD6A 4NELA 3FXOA 3RYRA 3PSIA 3FM3A 1FZPB 1ZK8A 2A6TA 4XRSG 3UNGC 1GV2A 1IXCA 2XAJA 1JUSA 5LEJA 3BNIA 1VQNI 4LGWA 2L02A 4FX4A 1WI9A 4MEYF 1X3UA 5F1JA 4IQ4A 1JKOC 3GTMJ 2KFDA 3CCJI 2WY7Q 3PL8A 2QYOA 2Y0MA 3MZHA 1NHAA 2K4BA 3N97A 5CXGA 1Z67A 3WTZA 3B6CA 1YO5C 4HAMA 3OYEA 1OYIA 2CQQA 2WAQA 2QKOA 3M9AA 5AIPA 3VB2A 1H9GA 3R60A 3Q5FA 2F5CA 1VQ5I 1ZYRF 3VSKA 4F3QA 3HSEA 1WPKA 3K9TA 2ZY9A 2ZO4A 4HQMA 4JKZA 3BG5A 3N05A 3CUQA 3M8JA 1VQPI 1OYYA 3AL0C 2KRCA 1MBGA 2HWVA 4RB2C 3OIPA 2R5YB 4Y17A 1MGTA 4BUPA 3RCOA 5HLGA 2NOGA 1Z77A 3AG4H 3DP7A 4E7ZA 5K7FA 3IUOA 2JT1A 3JSPA 2YVEA 4OD4A 1ETXA 2HXOA 4KN4X 1YJ9I 4LJZF 2OV7A 2W84A 2KIMA 2DI3A 4I76A 2O61A 4XLNF 2HYGD 3F6VA 5BPIA 2BHZA 1G3WA 2X9DA 5GADJ 2GXAA 3FF5A 2FBKA 2DA3A 3O2PE 5FD5A 4YZEA 1UCRA 3PQKA 1MNDA 5LGNA 3ML6A 3HPHA 1R7JA 2H6CA 2XB0X 4XM3A 2HS5A 5HLIA 1R5HA 2VXZA 3J7ZI 3P9CA 3WTVC 2W85A 4ZJZA 4L9VA 4JX4A 2OERA 2J5PA 1LEBA 2W57A 3A0HC 4CSWA 1I6XA 1SAXA 4KJZA 5IP9J 1ZN2A 4EM1A 3PJRA 1KQ9A 2DOFA 3DV8A 1UHMA 3HRTA 3HG9A 5E3LA 3BG9A 2VQLA 1RKTA 4AD9A 3NPIA 2LBFA 2JRTA 9ANTA 3K4NA 1AU7A 4C3HJ 4YFKF 2E34A 3BT9A 2VE9A 1QQIA 3S2DJ 4ESJA 3BPVA 4BAYA 3OL3A 3ZOBA 4RB1A 1OJLA 1HBXG 2XGCA 1OPCA 5LBQA 5ILUA 3ZP5A 2JN6A 1OR7A 1MKMA 1S3JA 4GGGA 2IT0A 3GLXA 2CGPA 2XKOA 4BHCA 4CYCA 3A2KA 3VWBA 1YW8A 2FJI1 2BYVE 5D5UB 3S3NA 2XROA 3WODF 3F8MA 3BZKA 1T6SA 3GEZA 1TW3A 1XMAA 1ON1A 3QPHA 3HUGB 1Z21A 4EJVA 4HOBA 3CCSI 3PQJA 2G7GA 4IXAA 3GW2A 3VDXA 3HM5A 1RRJA 5LRSA 5L3FA 4NDLA 3KP5A 1TWFJ 2ESHA 3FMSA 5E8IA 4XKVA 4GCKA 3LSJA 2PX9A 2XRLA 5KAFC 3E1SA 3OS2A 1EH6A 3KZYA 3GF2A 1LNWA 2D6YA 5L3BA 1WJFA 2VUMJ 2CQNA 5CW8A 2NNNA 2MABA 3MKWB 1D0XA 4JYKA 1R9TJ 1S8NA 2IEKA 2FD5A 3NAUA 5CLSA 3GZNB 3GZ6A 3GZ5A 3I55I 3CP2A 4IO9F 3KEOA 4IX7A 3VIBA 1WH7A 3CESA 4G6DA 3VOKA 3CCYA 3CCMI 2PBIA 2DXIA 2DG7A 2CW7A 2R7SA 1I3QJ 1POGA 2HQRA 3S1MJ 3P9TA 5F27A 1IV8A 2W53A 2IPQX 2QSHX 2DTRA 3H92A 2D5VA 2RV8A 3MZYA 4FQGA 5EGOB 2Z1DA 3FK7A 1HLVA 1ITYA 3GFIA 3NRVA 1YFHA 4HBLA 4QWQA 2JA6J 3BTIA 1XGSA 3I56I 5FROA 5JLWA 3JW4A 4Y3OA 2O03A 2OPTA 2YVHA 3SWHA 2XAQA 3CWRA 2MLGA 2HPMA 2IGKA 3SHFA 5GPCA 2K9SA 4ZH4F 3JRDA 5EZGA 3EETA 2C6YA 4XSZF 4XR6A 5KCMA 4IVNA 1XDUA 5K7HA 2H8WA 3C2BA 1U6GA 3GTPJ 1IUFA 3PIOF 4ZYDA 2L54A 3QQAA 2H1LA 4BU2A 1B8IA 4X1EA 3NQOA 2QQ8A 4AVPA 5EEAA 2Y69H 2HOSA 3W6JB 5B66C 3HSRA 1R36A 4WX9A 4V2GA 3IKVA 1WJBA 3IKTA 4IHYA 3O6BB 3PSFA 4PK4A 3GEUA 4ZZDA 5BPDA 2DMUA 3OYHA 5J1RA 2R5ZA 3BHQA 2R0QC 3HUGA 3KZIC 5LLQA 4ENMA 1IN8A 4DIQA 3G1OA 3RPQA 3OIQA 5IT9Z 2QZ8A 2OA4A 4E70A 1J7KA 3LSIA 1HC8A 3N4MA 3JRGA 1R1VA 3L2RA 1G3YA 1WCMJ 2P6TA 3HKZA 4RGRA 2Y9YA 1QRYA 4C3JJ 4NQWA 4M9SA 4XIDA 3HTAA 4EM0B 2O6GE 3DLLF 4QPQA 2VBZA 1R5ID 3ROUA 4XKBA 2ZSHB 1ZR2A 4F7ZA 4NN1A 4XICA 1SMYF 3DKYA 3ESWB 1XPXA 4HA8A 2VC0A 2B3WA 3VW1A 1FMWA 4LG0B 4G8XA 2QM3A 1UFMA 3QP5A 3R0AA 2ZCNA 2KKOA 2ETHA 1OCOH 2D1VA 5E1WA 3TGNA 1ENHA 4I0AA 1XN7A 2EZLA 4ITVA 1E17A 2K3PA 3U9GA 3RPUD 1WJDA 3S93A 1OCCH 2F2EA 4MNUA 1X1BA 3DEWA 3K1MA 1MJ9A 4HLXA 2L9NA 2CJJA 1IDYA 2M34A 3O8HA 3DKXA 1FIAA 5GTHC 2KL4A 4RGUA 2XSDC 5EGOA 2Y9ZA 2KISA 4L9JA 3OS1A 3OYCA 2QCOA 4KDPA 1JKRC 3A03A 1XCVA 3LFKA 4V2FA 3JRBA 2E1CA 5F0HA 2AHQA 2Q0OA 1YS7A 3IV5A 4I6ZA 1EF4A 2MSYA 2PFVA 3BG6A 1Z6TA 1KGSA 1WJEA 3TBIA 3VFZA 2DPDA 2A05A 4RAGA 4AF5A 3I9V2 2BOLA 1WJCA 4BDYA 4GCTA 3FBIB 4AYBN 3W6KB 2VPRA 4HG2A 1VTNC 1UAAA 2K5CA 3RKYA 5FFXA 5EG0B 2LR8A 1CF7A 2YU3A 3FKIJ 1FYKA 4MIMA 1DPUA 2EBIA 3KEQA 1R4MB 2VBXA 1IN5A 2JZYA 5D5WB 4QIWN 1SVOA 3RI4A 1O3TA 2P7CB 3D0SA 3DU5A 2RAEA 5F0FA 2BVLA 3A02A 2HQNA 3CC4I 3DKWA 2ZSIB 3TDZC 4XLCA 1YX5A 4FE7A 1UMQA 1HOMA 4Z2YA 3KCCA 2WTEA 2Z16A 1LVAA 2PJRB 5CYVA 3O60A 1OFCX 4ZDLA 1O3RA 1ZRDA 2ZMEB 2WAFA 4EATA 5J4VA 3CDIA 2ME0A 2VL8A 1P4WA 1X3ZB 3VW0A 4L9TA 2WAEA 3RKWA 1JT0A 3HHGA 3RDIA 1X4PA 3JRCA 2ZJPF 2M7AA 3CJRB 5ILSA 4EGYA 1ZQ3P 4DBRA 4P9UA 4LLNA 2PI0A 1BR4A 1S29A 3JTHA 4WXHA 2GXGA 1BJAA 5E1ZB 4D5CA 3BRUA 3J80K 3HRUA 4IHWA 2F4IA 1TLHB 5D5VB 2K27A 5H2FC 1PP8F 2VOOA 4JX6A 3V7CA 4NC6A 2LP0A 3BOQA 1K4SA 2K40A 1LVKA 1MMAA 1UI6A 4ZZLA 4FTHA 1FOYA 2CO5A 3VPRA 1SD5A 3RZOJ 3F3XA 5D6EA 3K1PA 2MGQA 4MXMA 3H9JA 4CCNA 2COMA 2H6BA 4BKXA 5GAEJ 2DA7A 3HOVJ 1T8IA 4YELA 4A2UA 2CV1A 2CW8A 2GQQA 3ZMDA 4A0YA 2HI3A 1X1CA 2MH9A 1ZGAA 2VB6A 3LAPA 1MSFC 3ON2A 4C2MA 2VI6A 4HDVA 2F4MB 1GT0C 4R79A 1QHGA 4I98B 4KN7X 3WTUC 5KVRA 4DVYP 1R23A 3ERMA 2EV5A 2KIFA 4BHPA 4E7SA 3VVYA 2ZFUA 2Q2EA 3H3ZA 4II2A 4D7NA 5C4XJ 2QBYB 4BE1A 4ABZA 5JLXA 4RDUA 3CCEI 2FX0A 5HNFA 2EQRA 2HDCA 4PCQA 5BNGA 1FEXA 2EFQA 3NWSA 2XKPA 3VUQA 2V9VA 2YR2A 1YIJI 2GBYA 3F8FA 2HQAA 4KIGA 4RS8A 3VVZA 1VQ8I 3Q9VA 4UB6C 3GTOJ 1YYVA 2DFIA 2XIGA 5EG0A 2OZUA 2STTA 2R7WA 2DT5A 3PFYA 1ZKGA 3TO9A 3BROA 4OD5A 2FNPA 2DK8A 3EUKL 1RUNA 4JNNA 4MO7A 4HYEA 4F92B 2IAIA 5IP7J 4JK1X 1YQAA 4A5MA 4BE2A 5J6XA 2IS1A 3F72A 4GYIA 5E3NA 2EK5A 3OSFA 1U0JA 1T0FC 4E7LA 2PMZA 3CMYA 4B43A 2E2HJ 4A0XA 3HDDA 2BW3B 2E36A 3LSPA 5LEKA 1QU3A 1WJAA 1YW9A 2FOWA 2IVMA 3WGIA 1JJ8C 4A12A 4A3LJ 1XB4A 2RGVA 2V9KA 2D2WA 2R4GA 2X4HA 1TT0A 3HIMA 2M9HA 3F0CA 4J19A 2XHKA 1F4KA 3IAM2 3HOZJ 2JSCA 4UY8I 5M5YJ 4RAZA 2X6OA 2ZNYA 3BR3A 2HDDA 3CCRI 1RETA 2L5QA 1YX3A 1ODDA 1NH3A 3WTTC 2F6CA 2DN0A 3K6GA 3IL2A 1A6IA 1U8BA 5B5EC 1SC7A 1A5JA 2EZHA 3VW2A 3L00A 2H8RA 3RKQA 3V78A 2R92J 2QSGX 1U5TC 1J0RA 3OYJA 2W7NA 1LE8A 5KK1A 4C2TA 1XGMA 5F64A 4FASD 4S04A 4BH9A 1R4NB 3EUPA 2KQRA 4MGRA 1Z3XA 2WC2A 1WKMA 2WWYA 1SFOJ 2V1DA 3HTUA 1O7LA 1GDTA 4U0YA 1K79A 4OMYA 1SFXA 2GIZA 3DPUA 4M6XA 2M3AA 1D1CA 4PDKA 2PZ9A 1QHHD 2VKDA 4A3EJ 1QZEA 2RHAA 3CDHA 3L2VA 2OTLI 1FSEA 3RPUA 3GUDA 4PFOA 4GO1A 3CC7I 4C3IJ 2OTJI 3HTIA 1MW7A 3L9FA 4ZYEA 3PASA 1MJAA 1Z91A 2M2EA 2HOAA 3Q0UA 1WHUA 1LFPA 2BY0A 5H20A 5A2QK 5ICCA 1QBJA 5IYDJ 1IRFA 4XKWA 4BHBA 1F36A 1KZHA 3HE0A 2FBIA 2EV0A 4Q4ZF 2KIUA 1RUOA 4A3JJ 2GOMA 3GMEA 3I54A 3T8RA 1FC3A 4IEJA 3QODA 1B1BA 3HSFA 2QBYA 4C2UA 3M3YJ 3I0TA 4AC0A 1YRNA 4WIBA 4EQQA 4MFDA 3R61A 5E8GA 5CXIA 4MTDA 4OIRF 4UUSB 2WY8Q 5BS6A 3TP3A 1W0UA 1D3YA 1FWZA 2O7OA 2K4JA 1VQOI 1HQCA 3EQLF 2D45A 4M72A 3KFWX 4CHUA 1ZREA 3CUQB 1GHCA 4EVIA 1FYMA 4XRFA 2YPRA 1XX5A 2XSJC 1KYZA 4CICA 1HDPA 4IRIA 2CUJA 3C1DA 4AIKA 2QQAA 2W1OA 4JL3A 3ZQIA 1EJ9A 2R7UA 4MK6A 1UB9A 1N77A 4E7KA 4PXIA 4M73A 5KHDA 3G71I 5EYRA 3FKJA 2K9QA 1RPWA 2G3BA 4BBSJ 3G7RA 1ETVA 2OUMA 5F08A 1K78B 4L62A 2DBBA 2ESNA 4JBAA 1EA3A 2O5RA 4KT6A 4XORA 4ENKA 2HQ5A 2LD5A 2AQEA 2EV6A 4G7HF 1V4RA 1FBQA 3ABKH 3Q9SA 1WRJA 1LQ1A 1MD0A 3ZQFA 5LHGA 5J8CA 3IWFA 4CGZA 2WUIA 4BACA 3TQNA 1XDSA 4ETSA 1MMSA 3ASOH 1STZA 1D1BA 3NEUA 3J7YJ 2ECBA 5EJCA 1FPQA 1X3WB 3CO6C 4UNOA 3HBLA 2E35A 4G12A 5HSZA 3NS4A 1DPRA 1C0WA 1TZLA 3IH2A 4UVBA 4A5NA 2V1NA 5FLXZ 2V26A 3I4NJ 4FX0A 3JRFA 3QRFF 4J01A 2DA6A 2VPLA 2EINH 4BBRJ 4NC8A 1OMIA 3OYDA 3BJBA 4UHTA 1YE9A 1S7OA 2BXZA 1B59A 5H6RA 4DYQA 4I2OA 4HF1A 2LBFB 2V1UA 3I58A 1N25A 4Y33A 3DU6A 5DTDA 4MLOA 2NS7A 2JVGA 3LQRA 4AUXA 3J81K 3SEZA 2XF5A 1BW5A 1MJBA 2CMPA 3D5SC 4B3AA 1RR7A 4CYCB 3OS0A 4MEXF 4KITB 1YITI 1R1UA 1V5FA 5ED4A 3OYKA 2X6YA 1ZGWA 3COAC 4A93J 3CRJA 2BBYA 4FHTA 5K58A 2XDVA 3RD3A 4BGDA 3S2HJ 3F23A 1JUPA 2XF7A 4EJUA 3OYIA 3SEQA 3ABMH 2VASA 2EIMH 1D1AA 2ZXIA 3TMOA 1D8JA 2NX4A 3EUHA 5CPRB 4UUSA 1FTZA 2GIVA 4BNCA 3HL2A 1O3QA 3TL4X 5L3CA 5FFZA 4OAYA 3G6EI 2OQGA 4KFCA 4KIFA 5CKTA 1DGRM 4LB5A 2E1MC 3OYAA 4MHGA 4I0BA 5FRMA 5EZHA 3IP4B 1W1WE 3ABLH 3CLOA 4S05A 1ZRCA 3K7AJ 1Y8RB 4LIUA 3L1PA 3KYCB 1TQPA 2X51A 3C07A 2DFFA 1TQIA 1QGPA 3CJNA 4PJMA 2LREA 2EILH 3FXUA 5HODA 1FSHA 1YTYA 2CFXA 2K02A 3BQYA 3HRMA 1K78A 2FF4A 2G9WA 4A3IJ 3H5RA 4DW6A 4BYYA 1A31A 4X6AJ 1QZZA 1ZAOA 4XOPA 2M87A 2ZBKA 2ZNZA 1BN5A 2FEZA 3VOXA 1K6YA 3CUOA 3GXOA 3K8PC 2ZKZA 4OINF 3QU6A 2JRMA 2BXYA 4ANJA 2YSRA 2AXLA 3ABUA 3CLQA 3I71A 4ZC3A 3IUVA 1A6QA 3ZQHA 2FUG2 4Y13A 1P7JA 3LSHA 1NG7A 5ICFA 2RKHA 1SFKA 4QPOA 1FP1D 4NNJA 3ASNH 5FKNA 1ZLJA 2XPWA 4IL6C 1Z05A 3HOYJ 3OV8A 2CYYA 2L7MP 3CCQI 3LSKA 1TBXA 2NVUB 3L2UA 2CQKA 2EFPA 1X1AA 5CJ9A 3H3VK 2XV4S 1H8AC 3QOPA 3LWJA 2RC4A 5K5OA 2UXXA 1FYLA 2A2FX 1FIPA 4PGHA 3EDPA 4ZYAA 1B8IB 1IJWC 2ECCA 1AKHB 2Y30A 2IS6A 1I39A 2VJ5A 5CVVA 4B4CA 4M6VA 1HF0A 4F55A 2XAHA 1GLNA 2QKLB 1PJRA 2IXSA 4Q47A 2JPBA 3TEDA 2QLZA 2UWMA 2R5ZB 1OYWA 2IA0A 3F8CA 3SDBA 3VP5A 2A5YB 3GFJA 3FXLA 1I6HJ 3OSGA 2PMHA 2JA7J 3K2ZA 1KU3A 2DLLA 4PUSA 1YHQI 1TWGJ 2Q1ZB 3LAJA 2R93J 2UXPA 4P9FA 2HVSA 2WAQN 4HV6A 3GTLJ 4ENNA 1G8XA 3R0JA 3BG3A 2VQHA 5DCMA 5J8FA 2EZIA 1BC8C 3FX3A 3QPSA 3CF5F 4HLYA 1UZCA 2PMUA 2R7QA 4OWRB 4ZYHA 1B72B 2LKSA 3MNLA 4I7HA 5HS9A 4GRIA 1VF9A 3DTEA 2ZFWA 2RDPA 3TW7A 5E18F 2CQXA 5M3FJ 1ERDA 3VVXA 1WZ2A 4XNFA 2KZVA 1Z3YA 3CMAI 4ZTFA 2O8KA 2MYSA 3JR9A 5KAIC 1ORKA 2JMWA 2LYCA 2G7LA 4NQWB 5L3GA 5IPAA 1FTTA 1P92A 3TW6A 1JKQC 1SAUA 1F9NA
chains in the Genus database with same CATH topology
1MBJA 1NK2P 3T6NA 4I6ZA 3SFIA 5FHPA 1MH3A 4W97A 1ETQA 1EF4A 1U9OA 3S1QJ 2MSYA 1ETOA 3O8GA 2ELKA 3M4OJ 2QF7A 4AF5A 4DZPA 3LSRA 1HCRA 4GCTA 5H9TA 3WHBA 2XGDA 4AYBN 2GM4A 2VPRA 3G56A 4Y7NJ 3V6GA 1LFUP 5EG0B 3AQSA 2LR8A 5F0CA 3FKIJ 3GZIA 3BR6A 4MIMA 2CUFA 2NS8A 2EBIA 5C4JJ 5D1RA 2ID6A 2G7SA 4QIWN 1K61A 1TC3C 1QVTA 2RAEA 5F0FA 4A3DJ 2G0EA 3A02A 3S5RA 1IG7A 4UUTA 1Q1VA 4C2MJ 3ZQGA 2O7TA 2M8GX 1BA5A 3BR2A 1UMQA 2DMNA 4FE7A 3GTJJ 1HOMA 1TWCJ 3IV5A 2DJNA 4QTRA 1ETWA 3SJMA 3COLA 1WH5A 2LTPA 3O60A 1OFCX 3JRAA 1GUUA 5DAJA 2ME0A 3VW0A 1JT0A 3B81A 3IH4A 2QOPA 3BTJA 1RKWA 3JRCA 1GVDA 4B1RA 1X2NA 2YUSA 1ZQ3P 2LKXA 4RBOA 1Y1WJ 3NI7A 1BL0A 4D7MA 4FISA 1AKHA 4D5CA 5EF6A 1HDDC 2HYTA 3BRUA 5C4YA 4IHWA 1CQTA 2YU9J 2WV1A 4JX6A 1UI5A 2FQ4A 5GP9A 2LP0A 1ETYA 2DMPA 2K40A 1UI6A 2V57A 3QPLA 4FTHA 3VPRA 3S15J 1T56A 1RESA 4DZJA 1JUMA 3RZOJ 5FJ8J 1PUFA 3QBMA 1IV6A 2DMQA 1BW6A 4XRSA 3BTLA 2PBXA 2MGQA 3BR0A 4MXMA 2DG8A 3G1LA 4BKXA 1XG1A 2DA7A 4FE4A 1VI0A 3HOVJ 3HGGA 3BQZA 3DPJA 2L7FP 3S17J 2UXUA 2K9NA 1B72A 5IYBJ 1VNDA 1SGMA 1I50J 2HI3A 5K7ZA 5FLVA 1APLC 2IBDA 1MSFC 1IGNA 3ON2A 4M3FA 2VI6A 1GT0C 3FIWA 2R7ZJ 5IOYA 3ANPA 1JT6A 4DYRA 1SANA 3HB9A 3VVYA 1DU6A 1QVUA 4D7NA 5C4XJ 2IU5A 2UXIA 2NP5A 4ABZA 5JLXA 4RDUA 4GFKA 4A69C 2FX0A 2EQRA 2JWTA 1PUFB 4LOCA 5BNGA 1IRZA 3BR1A 2ZOYA 1FEXA 2M0CA 4L5EA 3ANGA 4DYCA 3VUQA 2VKEA 2VKVA 2GBYA 3HOWJ 2JJ7A 2XPUA 3E7QA 4W1UA 2EH3A 3LOCA 3VVZA 3F1BA 4JX5A 3GTOJ 3K2AA 2B63J 2TRTA 5HAWA 1UG2A 5EG0A 2LY9A 2NP3A 1ZKGA 3Q0WA 2WB1N 2KDZA 2COBA 4JNNA 3GTKJ 4MO7A 3SDGA 2E19A 2IAIA 3OIOA 5IP7J 2Q24A 5AQCA 5HBUA 2HOTA 2FBQA 2F07A 5D19A 2DA1A 2ZCMA 2L9RA 5E3NA 3OSFA 3S1NJ 2NVYJ 2DA4A 3DCFA 5C3EJ 3S1RJ 2E2HJ 3CMYA 2JA8J 3HDDA 3BR5A 1GV5A 4M3BA 3LSPA 3A01A 1XS9A 3ZQCA 1JJ8C 4A3LJ 3HGYA 5FGLA 2X48A 3HIMA 2M9HA 3F0CA 4J19A 1BJZA 4GFLA 4NELA 3HOZJ 2GLOA 1ZK8A 4ME9A 5M5YJ 2JA5J 2X6OA 2HDDA 3BR3A 4XRSG 1RETA 1GV2A 2XB5A 1S7EA 1H88C 1U9NA 1JUSA 2DN0A 3BNIA 2W48A 1A6IA 1U8BA 2R5YA 1A5JA 2HXIA 2EZHA 3VW2A 2DA2A 4AC6A 5F1JA 3GTMJ 1JKOC 2H8RA 3RKQA 3V78A 2R92J 1LE8A 3RQIA 3HOXJ 1P7IA 3GTQJ 5CXGA 3B6CA 3EUPA 4GCLA 2HYJA 2LLKA 1SFOJ 2LVSA 2CQQA 3S16J 2QKOA 3A01B 1GDTA 3NARA 2PZ9A 5M5XJ 4A3EJ 4ACIA 2RHAA 2Y31A 1WI3A 2ME6A 5C44J 1WPKA 3AQTA 1JJ6C 4JKZA 3BG5A 3HTIA 4C3IJ 3PASA 4M3DA 2HKUA 4M3GA 4HNVA 1X58A 2M2EA 1MBGA 2HOAA 3Q0UA 1OCTC 5J3LA 4S0HB 2R5YB 5IYDJ 3HKZN 1F36A 3HE0A 2NOGA 1Z77A 2G7LA 2YVEA 5K7FA 1OCPA 4HKUA 1ETXA 2MG4A 5FKKA 1LE8B 2HXOA 1Z0XA 4A3JJ 1LFBA 2CU7A 3H0GJ 2XPVA 4IEJA 4I76A 3M3YJ 3FISA 1G2HA 3LHQA 4XRMA 2X9DA 4AC0A 1YRNA 2DA3A 4MFDA 2YS9A 4YZEA 5CXIA 3PPBA 4UUSB 3KKDA 3TP3A 1W0UA 2XB0X 1QPIA 2O7OA 5M5WJ 1ETKA 5EFYA 4JX4A 2L7ZA 2OERA 3GBGA 1HDPA 3BTCA 5IP9J 4JL3A 3ZQIA 4MK6A 2ZB9A 3MVPA 4QSHA 4PXIA 4BY1J 5EYRA 1MNMC 2K9QA 5E3LA 3BG9A 1RPWA 1IDZA 2G3BA 4BBSJ 3G7RA 4CGRA 1ETVA 1RKTA 5F08A 4L62A 3KZ9A 1O4XA 2HQ5A 2LD5A 4BY7J 3NPIA 1JTYA 1YRNB 1ZTRA 9ANTA 3LJLA 1AU7A 3NXCA 3TP0A 4C3HJ 3ZQFA 3BT9A 2WUIA 3CQZJ 3S2DJ 2N8GA 2Y0SN 2TCTA 3ZOBA 1OJLA 4A3MJ 2ECBA 2XGCA 1F43A 4A3CJ 3QKXA 2JN6A 1MBHA 2FJ1A 1U78A 3JSJA 3HBLA 2E1OA 4G12A 5HSZA 4CYCA 3IH2A 2REKA 2E2IJ 1JTXA 3I4NJ 3JRFA 2DA6A 5E3MA 1K83J 2LFBA 4BBRJ 3BJBA 3NNRA 2G7GA 3WHCA 3HM5A 1NTCA 4DYQA 2GFNA 4NDLA 2QWTA 2EZKA 5IYCJ 1TWFJ 5FLMJ 1AHDP 3IH3A 4IHVA 5E3OA 2RASA 5DTDA 4GCKA 3LSJA 2XRLA 4MLOA 5F04A 2NS7A 2UXHA 3S14J 4AUXA 1JGGA 1D5YA 3BCGA 1H89C 2XDNA 4KWAA 3E7LA 5IOZA 1E3OC 1MBKA 1BW5A 5FKOA 2D6YA 3OOUA 4B3AA 2VUMJ 1RR7A 5CW8A 4CYCB 4JYKA 1R9TJ 2IEKA 2FD5A 3NAUA 5FKLA 1MBFA 1ZGWA 3VIBA 1WH7A 3CRJA 4A93J 3VOKA 4UDSA 3CCYA 5K58A 3RD3A 3S2HJ 2DG7A 1JUPA 2L0KA 2CRGA 2MW8A 1I3QJ 4A3GJ 1POGA 2ZOZA 3S1MJ 4D5FA 5EDNA 3P9TA 5F27A 2NVTJ 2NX4A 2W53A 4JP0A 4UUSA 1FTZA 5M3MJ 2D5VA 2Y2ZA 3MN2A 2NVQJ 5EGOB 2LK2A 3FK7A 1HLVA 1ITYA 3B6AA 4A3BJ 5EZHA 3BTIA 2JA6J 1DU0A 5JLWA 2GENA 2QIBA 3K7AJ 2OPTA 3PO3J 2YVHA 3L1PA 3CWRA 3I4MJ 3C07A 5GPCA 2KT0A 2K9SA 3LSGA 5HODA 3PO2J 3JRDA 5EZGA 5DS9A 3BQYA 4A3IJ 4GFBA 4DW6A 1XC5A 4X6AJ 3Q0VA 1IC8A 5K7HA 3VOXA 3C2BA 3GTPJ 1IUFA 2UXOA 1VFCA 5D18A 3QQAA 1JKPC 5J1UA 2ID3A 3HTHA 4ICHA 1B8IA 3NRGA 4X1EA 2P81A 3IUVA 3GTGJ 5EEAA 2HOSA 4XK4A 3ZQHA 3FRQA 1P7JA 3W6VA 4V2GA 1TWHJ 2O9LA 4EEFG 4IHYA 1FJLA 5FKNA 2XPWA 3UKGA 2NVXJ 3ON4A 3GEUA 3JRHA 2DMUA 2XGEA 5J1RA 2R5ZA 2GUHA 3HOYJ 3KKCA 3Q3SA 2AO9A 3BHQA 2ZCXA 2R0QC 4A3FJ 2L7MP 4BXXJ 2DMTA 2PMZN 1T33A 4MFEA 3H3VK 3G1OA 1NK3P 1MBEA 1H8AC 2JK3A 3LWJA 2DTZA 3KNWA 3JREA 2QTQA 1X2MA 2H1KA 1WGXA 1FIPA 3JRIA 1B8IB 1IJWC 2ECCA 1AKHB 2Y30A 3HOUJ 1MSEC 3JRGA 4B4CA 4M6VA 2WGBA 3PM1A 3CDLA 3HEFA 1WCMJ 1HF0A 2Y9YA 1QRYA 4C3JJ 4XIDA 3HTAA 3TEDA 1ZR4A 5GPAA 3CJDA 2R5ZB 1TWAJ 3RH2A 5IP6A 1MH4A 3VP5A 1ZR2A 3ZQLA 1I6HJ 2DA5A 4NN1A 4XICA 3OSGA 2JA7J 2R93J 1TWGJ 3VW1A 2UXPA 5J1YA 5FKMA 4IHXA 2ZCNA 2WAQN 2E2JJ 3GTLJ 4M3EA 4FCYA 2OF7A 1ENHA 3EGQA 1UHSA 2EZLA 3BG3A 2EZIA 3QPSA 3RZDJ 3MKLA 3HTJA 1Y1VJ 4A3KJ 1B72B 3DEWA 3MNLA 1VF9A 5M3FJ 3TW7A 2CQXA 2CJJA 1IDYA 2CUEA 2M34A 3O8HA 1FIAA 3VVXA 2O8KA 3JR9A 2XSDC 2Y9ZA 5EGOA 1ORKA 2JMWA 3LNQA 5FMPA 3D1NI 2QCOA 4Y52J 3FK6A 1JKRC 3A03A 1W0TA 5IPAA 1FTTA 2I10A 4V2FA 3TW6A 3JRBA 2OI8A 3G1MA 1JKQC 5F0HA 2AHQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MBJ A;  1NK2 P;  3T6N A;  4I6Z A;  3SFI A;  5FHP A;  1MH3 A;  4W97 A;  1ETQ A;  1EF4 A;  1U9O A;  3S1Q J;  2MSY A;  1ETO A;  3O8G A;  2ELK A;  3M4O J;  2QF7 A;  4AF5 A;  4DZP A;  3LSR A;  1HCR A;  4GCT A;  5H9T A;  3WHB A;  2XGD A;  4AYB N;  2GM4 A;  2VPR A;  3G56 A;  4Y7N J;  3V6G A;  1LFU P;  5EG0 B;  3AQS A;  2LR8 A;  5F0C A;  3FKI J;  3GZI A;  3BR6 A;  4MIM A;  2CUF A;  2NS8 A;  2EBI A;  5C4J J;  5D1R A;  2ID6 A;  2G7S A;  4QIW N;  1K61 A;  1TC3 C;  1QVT A;  2RAE A;  5F0F A;  4A3D J;  2G0E A;  3A02 A;  3S5R A;  1IG7 A;  4UUT A;  1Q1V A;  4C2M J;  3ZQG A;  2O7T A;  2M8G X;  1BA5 A;  3BR2 A;  1UMQ A;  2DMN A;  4FE7 A;  3GTJ J;  1HOM A;  1TWC J;  3IV5 A;  2DJN A;  4QTR A;  1ETW A;  3SJM A;  3COL A;  1WH5 A;  2LTP A;  3O60 A;  1OFC X;  3JRA A;  1GUU A;  5DAJ A;  2ME0 A;  3VW0 A;  1JT0 A;  3B81 A;  3IH4 A;  2QOP A;  3BTJ A;  1RKW A;  3JRC A;  1GVD A;  4B1R A;  1X2N A;  2YUS A;  1ZQ3 P;  2LKX A;  4RBO A;  1Y1W J;  3NI7 A;  1BL0 A;  4D7M A;  4FIS A;  1AKH A;  4D5C A;  5EF6 A;  1HDD C;  2HYT A;  3BRU A;  5C4Y A;  4IHW A;  1CQT A;  2YU9 J;  2WV1 A;  4JX6 A;  1UI5 A;  2FQ4 A;  5GP9 A;  2LP0 A;  1ETY A;  2DMP A;  2K40 A;  1UI6 A;  2V57 A;  3QPL A;  4FTH A;  3VPR A;  3S15 J;  1T56 A;  1RES A;  4DZJ A;  1JUM A;  3RZO J;  5FJ8 J;  1PUF A;  3QBM A;  1IV6 A;  2DMQ A;  1BW6 A;  4XRS A;  3BTL A;  2PBX A;  2MGQ A;  3BR0 A;  4MXM A;  2DG8 A;  3G1L A;  4BKX A;  1XG1 A;  2DA7 A;  4FE4 A;  1VI0 A;  3HOV J;  3HGG A;  3BQZ A;  3DPJ A;  2L7F P;  3S17 J;  2UXU A;  2K9N A;  1B72 A;  5IYB J;  1VND A;  1SGM A;  1I50 J;  2HI3 A;  5K7Z A;  5FLV A;  1APL C;  2IBD A;  1MSF C;  1IGN A;  3ON2 A;  4M3F A;  2VI6 A;  1GT0 C;  3FIW A;  2R7Z J;  5IOY A;  3ANP A;  1JT6 A;  4DYR A;  1SAN A;  3HB9 A;  3VVY A;  1DU6 A;  1QVU A;  4D7N A;  5C4X J;  2IU5 A;  2UXI A;  2NP5 A;  4ABZ A;  5JLX A;  4RDU A;  4GFK A;  4A69 C;  2FX0 A;  2EQR A;  2JWT A;  1PUF B;  4LOC A;  5BNG A;  1IRZ A;  3BR1 A;  2ZOY A;  1FEX A;  2M0C A;  4L5E A;  3ANG A;  4DYC A;  3VUQ A;  2VKE A;  2VKV A;  2GBY A;  3HOW J;  2JJ7 A;  2XPU A;  3E7Q A;  4W1U A;  2EH3 A;  3LOC A;  3VVZ A;  3F1B A;  4JX5 A;  3GTO J;  3K2A A;  2B63 J;  2TRT A;  5HAW A;  1UG2 A;  5EG0 A;  2LY9 A;  2NP3 A;  1ZKG A;  3Q0W A;  2WB1 N;  2KDZ A;  2COB A;  4JNN A;  3GTK J;  4MO7 A;  3SDG A;  2E19 A;  2IAI A;  3OIO A;  5IP7 J;  2Q24 A;  5AQC A;  5HBU A;  2HOT A;  2FBQ A;  2F07 A;  5D19 A;  2DA1 A;  2ZCM A;  2L9R A;  5E3N A;  3OSF A;  3S1N J;  2NVY J;  2DA4 A;  3DCF A;  5C3E J;  3S1R J;  2E2H J;  3CMY A;  2JA8 J;  3HDD A;  3BR5 A;  1GV5 A;  4M3B A;  3LSP A;  3A01 A;  1XS9 A;  3ZQC A;  1JJ8 C;  4A3L J;  3HGY A;  5FGL A;  2X48 A;  3HIM A;  2M9H A;  3F0C A;  4J19 A;  1BJZ A;  4GFL A;  4NEL A;  3HOZ J;  2GLO A;  1ZK8 A;  4ME9 A;  5M5Y J;  2JA5 J;  2X6O A;  2HDD A;  3BR3 A;  4XRS G;  1RET A;  1GV2 A;  2XB5 A;  1S7E A;  1H88 C;  1U9N A;  1JUS A;  2DN0 A;  3BNI A;  2W48 A;  1A6I A;  1U8B A;  2R5Y A;  1A5J A;  2HXI A;  2EZH A;  3VW2 A;  2DA2 A;  4AC6 A;  5F1J A;  3GTM J;  1JKO C;  2H8R A;  3RKQ A;  3V78 A;  2R92 J;  1LE8 A;  3RQI A;  3HOX J;  1P7I A;  3GTQ J;  5CXG A;  3B6C A;  3EUP A;  4GCL A;  2HYJ A;  2LLK A;  1SFO J;  2LVS A;  2CQQ A;  3S16 J;  2QKO A;  3A01 B;  1GDT A;  3NAR A;  2PZ9 A;  5M5X J;  4A3E J;  4ACI A;  2RHA A;  2Y31 A;  1WI3 A;  2ME6 A;  5C44 J;  1WPK A;  3AQT A;  1JJ6 C;  4JKZ A;  3BG5 A;  3HTI A;  4C3I J;  3PAS A;  4M3D A;  2HKU A;  4M3G A;  4HNV A;  1X58 A;  2M2E A;  1MBG A;  2HOA A;  3Q0U A;  1OCT C;  5J3L A;  4S0H B;  2R5Y B;  5IYD J;  3HKZ N;  1F36 A;  3HE0 A;  2NOG A;  1Z77 A;  2G7L A;  2YVE A;  5K7F A;  1OCP A;  4HKU A;  1ETX A;  2MG4 A;  5FKK A;  1LE8 B;  2HXO A;  1Z0X A;  4A3J J;  1LFB A;  2CU7 A;  3H0G J;  2XPV A;  4IEJ A;  4I76 A;  3M3Y J;  3FIS A;  1G2H A;  3LHQ A;  4XRM A;  2X9D A;  4AC0 A;  1YRN A;  2DA3 A;  4MFD A;  2YS9 A;  4YZE A;  5CXI A;  3PPB A;  4UUS B;  3KKD A;  3TP3 A;  1W0U A;  2XB0 X;  1QPI A;  2O7O A;  5M5W J;  1ETK A;  5EFY A;  4JX4 A;  2L7Z A;  2OER A;  3GBG A;  1HDP A;  3BTC A;  5IP9 J;  4JL3 A;  3ZQI A;  4MK6 A;  2ZB9 A;  3MVP A;  4QSH A;  4PXI A;  4BY1 J;  5EYR A;  1MNM C;  2K9Q A;  5E3L A;  3BG9 A;  1RPW A;  1IDZ A;  2G3B A;  4BBS J;  3G7R A;  4CGR A;  1ETV A;  1RKT A;  5F08 A;  4L62 A;  3KZ9 A;  1O4X A;  2HQ5 A;  2LD5 A;  4BY7 J;  3NPI A;  1JTY A;  1YRN B;  1ZTR A;  9ANT A;  3LJL A;  1AU7 A;  3NXC A;  3TP0 A;  4C3H J;  3ZQF A;  3BT9 A;  2WUI A;  3CQZ J;  3S2D J;  2N8G A;  2Y0S N;  2TCT A;  3ZOB A;  1OJL A;  4A3M J;  2ECB A;  2XGC A;  1F43 A;  4A3C J;  3QKX A;  2JN6 A;  1MBH A;  2FJ1 A;  1U78 A;  3JSJ A;  3HBL A;  2E1O A;  4G12 A;  5HSZ A;  4CYC A;  3IH2 A;  2REK A;  2E2I J;  1JTX A;  3I4N J;  3JRF A;  2DA6 A;  5E3M A;  1K83 J;  2LFB A;  4BBR J;  3BJB A;  3NNR A;  2G7G A;  3WHC A;  3HM5 A;  1NTC A;  4DYQ A;  2GFN A;  4NDL A;  2QWT A;  2EZK A;  5IYC J;  1TWF J;  5FLM J;  1AHD P;  3IH3 A;  4IHV A;  5E3O A;  2RAS A;  5DTD A;  4GCK A;  3LSJ A;  2XRL A;  4MLO A;  5F04 A;  2NS7 A;  2UXH A;  3S14 J;  4AUX A;  1JGG A;  1D5Y A;  3BCG A;  1H89 C;  2XDN A;  4KWA A;  3E7L A;  5IOZ A;  1E3O C;  1MBK A;  1BW5 A;  5FKO A;  2D6Y A;  3OOU A;  4B3A A;  2VUM J;  1RR7 A;  5CW8 A;  4CYC B;  4JYK A;  1R9T J;  2IEK A;  2FD5 A;  3NAU A;  5FKL A;  1MBF A;  1ZGW A;  3VIB A;  1WH7 A;  3CRJ A;  4A93 J;  3VOK A;  4UDS A;  3CCY A;  5K58 A;  3RD3 A;  3S2H J;  2DG7 A;  1JUP A;  2L0K A;  2CRG A;  2MW8 A;  1I3Q J;  4A3G J;  1POG A;  2ZOZ A;  3S1M J;  4D5F A;  5EDN A;  3P9T A;  5F27 A;  2NVT J;  2NX4 A;  2W53 A;  4JP0 A;  4UUS A;  1FTZ A;  5M3M J;  2D5V A;  2Y2Z A;  3MN2 A;  2NVQ J;  5EGO B;  2LK2 A;  3FK7 A;  1HLV A;  1ITY A;  3B6A A;  4A3B J;  5EZH A;  3BTI A;  2JA6 J;  1DU0 A;  5JLW A;  2GEN A;  2QIB A;  3K7A J;  2OPT A;  3PO3 J;  2YVH A;  3L1P A;  3CWR A;  3I4M J;  3C07 A;  5GPC A;  2KT0 A;  2K9S A;  3LSG A;  5HOD A;  3PO2 J;  3JRD A;  5EZG A;  5DS9 A;  3BQY A;  4A3I J;  4GFB A;  4DW6 A;  1XC5 A;  4X6A J;  3Q0V A;  1IC8 A;  5K7H A;  3VOX A;  3C2B A;  3GTP J;  1IUF A;  2UXO A;  1VFC A;  5D18 A;  3QQA A;  1JKP C;  5J1U A;  2ID3 A;  3HTH A;  4ICH A;  1B8I A;  3NRG A;  4X1E A;  2P81 A;  3IUV A;  3GTG J;  5EEA A;  2HOS A;  4XK4 A;  3ZQH A;  3FRQ A;  1P7J A;  3W6V A;  4V2G A;  1TWH J;  2O9L A;  4EEF G;  4IHY A;  1FJL A;  5FKN A;  2XPW A;  3UKG A;  2NVX J;  3ON4 A;  3GEU A;  3JRH A;  2DMU A;  2XGE A;  5J1R A;  2R5Z A;  2GUH A;  3HOY J;  3KKC A;  3Q3S A;  2AO9 A;  3BHQ A;  2ZCX A;  2R0Q C;  4A3F J;  2L7M P;  4BXX J;  2DMT A;  2PMZ N;  1T33 A;  4MFE A;  3H3V K;  3G1O A;  1NK3 P;  1MBE A;  1H8A C;  2JK3 A;  3LWJ A;  2DTZ A;  3KNW A;  3JRE A;  2QTQ A;  1X2M A;  2H1K A;  1WGX A;  1FIP A;  3JRI A;  1B8I B;  1IJW C;  2ECC A;  1AKH B;  2Y30 A;  3HOU J;  1MSE C;  3JRG A;  4B4C A;  4M6V A;  2WGB A;  3PM1 A;  3CDL A;  3HEF A;  1WCM J;  1HF0 A;  2Y9Y A;  1QRY A;  4C3J J;  4XID A;  3HTA A;  3TED A;  1ZR4 A;  5GPA A;  3CJD A;  2R5Z B;  1TWA J;  3RH2 A;  5IP6 A;  1MH4 A;  3VP5 A;  1ZR2 A;  3ZQL A;  1I6H J;  2DA5 A;  4NN1 A;  4XIC A;  3OSG A;  2JA7 J;  2R93 J;  1TWG J;  3VW1 A;  2UXP A;  5J1Y A;  5FKM A;  4IHX A;  2ZCN A;  2WAQ N;  2E2J J;  3GTL J;  4M3E A;  4FCY A;  2OF7 A;  1ENH A;  3EGQ A;  1UHS A;  2EZL A;  3BG3 A;  2EZI A;  3QPS A;  3RZD J;  3MKL A;  3HTJ A;  1Y1V J;  4A3K J;  1B72 B;  3DEW A;  3MNL A;  1VF9 A;  5M3F J;  3TW7 A;  2CQX A;  2CJJ A;  1IDY A;  2CUE A;  2M34 A;  3O8H A;  1FIA A;  3VVX A;  2O8K A;  3JR9 A;  2XSD C;  2Y9Z A;  5EGO A;  1ORK A;  2JMW A;  3LNQ A;  5FMP A;  3D1N I;  2QCO A;  4Y52 J;  3FK6 A;  1JKR C;  3A03 A;  1W0T A;  5IPA A;  1FTT A;  2I10 A;  4V2F A;  3TW6 A;  3JRB A;  2OI8 A;  3G1M A;  1JKQ C;  5F0H A;  2AHQ A; 
#chains in the Genus database with same CATH topology
 1NK2 P;  3T6N A;  1N75 A;  3SFI A;  5FHP A;  4YFN F;  3L2Q A;  2M7B A;  2OQR A;  4MQ9 F;  1G3T A;  3GX4 X;  3ZMZ A;  1T08 B;  2K85 A;  4XN3 A;  3O8G A;  1Z7L A;  2ELK A;  4XL9 A;  3M4O J;  3K4B A;  3C2H A;  5DDG A;  3WHB A;  4BE0 A;  2Y0S A;  2GM4 A;  4ESB A;  5F0C A;  5C4J J;  4YIR X;  2FQ3 A;  5D1R A;  3ZQ7 A;  3LA7 A;  3MCZ A;  2A3S A;  1QVT A;  2XAS A;  4HNU A;  4BDZ A;  4LK1 F;  4IQJ A;  5HDN A;  1IO2 A;  1EKE A;  2O3F A;  3EUA A;  3OYL A;  1HW2 A;  1Q1V A;  4C2M J;  4RMN A;  4KIC A;  1PUE E;  1VQ4 I;  1HXD A;  3ONQ A;  2UXN A;  3TDU C;  3ZN0 A;  2CWE A;  1BA5 A;  3BR2 A;  2BEO A;  3MWM A;  3GTJ J;  1JI8 A;  1ETW A;  5IT9 K;  1L3L A;  3SFZ A;  2P6S A;  2ZJR F;  3I3L A;  3FDY A;  3JRA A;  1S72 I;  1Y0U A;  1WSU A;  3CTA A;  2M45 A;  2R7R A;  3E6M A;  4D0P A;  3FHZ A;  1CF7 B;  1RKW A;  1W7P D;  1X2N A;  2V6C A;  3K4K A;  4JOM A;  1Y1W J;  1BL0 A;  2IGN A;  1AKH A;  1FP2 A;  1HST A;  3JCU C;  1BR2 A;  5EF6 A;  3HXL A;  3V7S A;  1R6R A;  1X4O A;  5ILV A;  1CQT A;  2FBH A;  2WV1 A;  3PNT A;  4MQV A;  2FQ4 A;  1D8K A;  2QVO A;  5DCF A;  4HX4 A;  1HA8 A;  2DMP A;  4BXF A;  2KMU A;  3E6B A;  1T56 A;  2W82 A;  1JUM A;  2X6W A;  2DMQ A;  1BW6 A;  2LY1 A;  2PBX A;  2JQ7 A;  1XSV A;  2KDO A;  2HVR A;  4RGS A;  2DG8 A;  3H5A A;  2MLK A;  5HOO A;  1JXS A;  3HGG A;  3SXY A;  5JFR A;  3BQZ A;  2M4K A;  2K9N A;  1B72 A;  1A36 A;  5IYB J;  2ISZ A;  5CQE A;  5K7Z A;  1APL C;  5JVG F;  1IGN A;  2H09 A;  4I99 C;  3EPZ A;  5EEH A;  3ANP A;  1Y56 A;  1SAN A;  1WJ5 A;  3HB9 A;  3CCU I;  4QLC U;  1DU6 A;  2KRH A;  1IXR C;  1W4M A;  4M71 A;  4LIT A;  2NP5 A;  4GFK A;  4A69 C;  5D8K B;  1MMD A;  4B44 A;  2PEX A;  5J4Y A;  4LOC A;  3OMY A;  2M0C A;  3D5L A;  4DYC A;  3DPT A;  2ZJQ F;  3WTX C;  1ZEL A;  2EH3 A;  4RB3 C;  2P8T A;  4HV5 A;  4JX5 A;  1AOY A;  1T95 A;  2TRT A;  3M8F A;  1IRX A;  1USS A;  1OLT A;  2RNG A;  3H3U A;  2LY9 A;  2NP3 A;  3ZGK A;  5KNL A;  3ZQQ A;  3LMM A;  4UVC A;  3K70 C;  5F6F A;  2KDZ A;  3HZJ A;  3ZPL A;  2COB A;  3IRR A;  3SDG A;  2BY3 A;  5AQC A;  4PFP A;  3LFU A;  2HOT A;  2Q2E B;  4E6K G;  1XTA A;  2M30 A;  3E6D A;  2F5F A;  1BI3 A;  2P5V A;  4U88 A;  3RIR A;  2JA8 J;  4L18 B;  2JUG A;  1GV5 A;  4M3B A;  2OCC H;  3A01 A;  1XS9 A;  1O3S A;  2ZCW A;  5EEG A;  1EV7 A;  4LLG F;  2E1N A;  2B9S A;  1BJZ A;  2RRE A;  5GAH J;  3CME I;  4GFL A;  4CCL A;  2GLO A;  2DPU A;  4ME9 A;  1JGS A;  2EB7 A;  4UVA A;  4B3X A;  3EYY A;  3KP2 A;  3ZN1 A;  2XB5 A;  2CS3 A;  1P6R A;  3G4S I;  1H88 C;  4H0E A;  4U7D A;  3WE2 A;  1VQ9 I;  3PUF A;  5DEQ A;  3CCV I;  4DQ2 A;  1R5G A;  4ZDP A;  3AG1 H;  6PAX A;  2MA3 A;  1QO0 D;  2YX7 A;  2X1C A;  2DAO A;  1IN7 A;  2EFO A;  2I8D A;  4GCL A;  2HYJ A;  2LLK A;  3WTY C;  2B1E A;  3IC7 A;  2LVS A;  1R1T A;  1I5Z A;  1U3E M;  3W2V A;  3FM5 A;  1E3H A;  4Q5S F;  1YIO A;  5M5X J;  4ACI A;  2F48 A;  2GZW A;  2Y31 A;  2ME6 A;  2OZ6 A;  3L2C A;  5C44 J;  4CCM A;  1OIS A;  3AQT A;  2G7U A;  1R00 A;  4XLH A;  3DEU A;  5L3D A;  1S6L A;  4XLA A;  3OYN A;  1OCT C;  5J3L A;  3KPH A;  4CO8 A;  1RZ4 A;  3L09 A;  4U9L A;  3HKZ N;  2VXD A;  1OCP A;  4E7J A;  3V7R A;  2MG4 A;  1LE8 B;  3CJQ B;  3K1N A;  1KU9 A;  3QP6 A;  2CUZ A;  1LFB A;  3AAF A;  1XSX A;  3FIS A;  3X2Q H;  2IS2 A;  3FMQ A;  3LHQ A;  4XRM A;  2CW0 F;  2YS9 A;  2CQ7 A;  2DO7 A;  5DD8 A;  1ZH5 A;  3PPB A;  2K9M A;  3KKD A;  2LDU A;  4JQF A;  3AKZ A;  1QPI A;  2VT2 A;  3HYI A;  5M5W J;  1ETK A;  5CVU A;  5TIS C;  1J75 A;  2NRA C;  5EFY A;  2L7Z A;  2W25 A;  4AIJ A;  4O6J A;  3GBG A;  3AG3 H;  4IOC F;  3CD6 I;  3JAM Z;  4BEH A;  1WQ2 A;  1Z9C A;  2ZME C;  4XLE A;  2NNY A;  2XUB A;  3GO5 A;  3C3W A;  3MVP A;  1BI1 A;  4G6Q A;  5CVI A;  4BY1 J;  3JTG A;  1MNM C;  1DGW Y;  4G6T B;  2L9V A;  4KYW A;  3HIF A;  1TNT A;  4U0W A;  4Y4R A;  1RI7 A;  4R8H A;  5HDK A;  2HR3 A;  1YRN B;  3F6O A;  1ZTR A;  2QKM B;  2Z33 A;  4Q48 A;  2NOJ B;  3TP0 A;  4IHS A;  3D5R C;  3RKX A;  4XKC A;  4OAZ A;  2N8G A;  5JHF A;  5TGT A;  3HC7 A;  2TCT A;  4UXN A;  1BOA A;  4KT5 C;  3F21 A;  1F43 A;  3LST A;  4AID A;  4N0B A;  2BHY A;  1W7P A;  4A3C J;  3QKX A;  4R1H A;  5DUI A;  4F93 B;  1KQ8 A;  3CC2 I;  2FJ1 A;  1U78 A;  2K7L A;  3E5X A;  2ZXJ A;  1T39 A;  4C9Y A;  4I01 A;  3JSO A;  4XQF A;  2REK A;  2ELJ A;  2Z9O A;  1BIA A;  2E60 A;  2DU9 A;  1KYW A;  5D6F A;  2QA4 I;  4IF4 A;  1MDM B;  3LWF A;  2HOE A;  3NNR A;  5LFA A;  1J5Y A;  1DDN A;  2GFN A;  3WU2 C;  5IYC J;  3LQQ A;  1P9Q C;  3OR1 C;  4IHV A;  1D5V A;  5E3O A;  1SD7 A;  2RAS A;  2DDB A;  4LIV A;  5F04 A;  2UXH A;  2H27 A;  4PSW A;  3S14 J;  1JGG A;  3BCG A;  1H89 C;  4E7H A;  2XDN A;  2KHM A;  4KWA A;  4CUG A;  1B6A A;  1E3O C;  1MBK A;  4WK8 F;  3U2R A;  2HYF A;  3I59 B;  2GWR A;  2K9L A;  4G7Z F;  1YOV B;  5E20 A;  3FXJ A;  3OYM A;  2FA5 A;  1VQ6 I;  1WVR A;  4CH7 A;  1H0M A;  4L9N A;  1YJN I;  1Y8Q B;  1ZLK A;  3TKY A;  2A6E F;  1RC9 A;  1FX7 A;  2K3F A;  2LH9 A;  3OL4 A;  4HNT A;  2L0K A;  2MW8 A;  3ECO A;  3VSL A;  3KP6 A;  3W2A A;  2F5D A;  1QZY A;  2ZOZ A;  3ISP A;  3T5X A;  3EYI A;  4D5F A;  5EDN A;  1I1G A;  3VTI A;  2EFN A;  3KX2 A;  3M7G A;  4YEJ A;  4JP0 A;  4IKF A;  2EA4 A;  1AA7 A;  2MBF A;  5M3M J;  1XSD A;  1H9T A;  1N78 A;  2R3S A;  1EH8 A;  3FXK A;  1TP4 A;  3REO A;  4EJT A;  2NVQ J;  2WB1 A;  3G2B A;  2PN6 A;  3B6A A;  3U1D A;  3RYP A;  3RTR A;  3MKY B;  2PLY A;  2L7K A;  5FO5 A;  2RQQ A;  1VZ0 A;  2HZD A;  3KIO A;  5JI6 A;  1DU0 A;  2GEN A;  2QIB A;  3K4L A;  2VIX A;  3MAJ A;  2EJR A;  1O7F A;  3WTW C;  4D1Q A;  2NS0 A;  1HKT A;  4X0G A;  4BJ6 C;  2KT0 A;  1RNL A;  3BJO A;  2DT6 A;  4GFB A;  2G7H A;  2GXB A;  3FXR A;  1XD7 A;  3Q0V A;  1IC8 A;  1AWC A;  3H9G A;  1A04 A;  3V42 A;  2KZG A;  5LHH A;  1TNS A;  4UUV A;  2UXO A;  1XMX A;  2Z99 A;  1VFC A;  5J1U A;  2ID3 A;  3DWL E;  3R6S A;  2P81 A;  4XLF A;  1T0F A;  3GTG J;  4BQQ A;  1QPM A;  1SVL A;  2UZK A;  3FZV A;  1BIB A;  3KLO A;  3QAH A;  1I3A A;  3ZR8 X;  1ZG3 A;  1TWH J;  2O9L A;  4RM2 A;  1W5T A;  3UKG A;  2NVX J;  5CVJ A;  1ACI A;  3JRH A;  2LRD A;  3L7W A;  3KKC A;  3Q3S A;  4DJA A;  2ZCX A;  1MDM A;  2LMD A;  2R7X A;  3LSM A;  4N4O B;  4BXX J;  3V8L A;  5BOX A;  1R58 A;  2LG4 A;  2PMZ N;  1T33 A;  2DJI A;  3PFI A;  4MFE A;  2STW A;  3VOE A;  2O0Y A;  2OCE A;  2JK3 A;  3PIP F;  2DTZ A;  3OYF A;  2DFH A;  3ELK A;  4XN0 A;  3OYG A;  1U8R A;  1HW1 A;  1U5T A;  2IJL A;  2HNH A;  3WG9 A;  1X2M A;  2H1K A;  2QTQ A;  1WGX A;  3FMR A;  3J7A O;  3JRI A;  3CMM A;  2VLA A;  3HOU J;  1ZGJ A;  1MSE C;  2KIQ A;  2VJ4 A;  1BM9 A;  1IW7 F;  2WGB A;  3PM1 A;  2IW5 A;  2KJC A;  3I59 A;  5FGM A;  2QQ9 A;  4AIH A;  3K4C A;  2P4W A;  5A2Q Z;  2BZT A;  2AS5 F;  3ZCO A;  5K5Q A;  3E97 A;  2V1X A;  4U0V A;  5GPA A;  1TWA J;  4LD5 A;  2CV0 A;  5IP6 A;  2I5U A;  1GXP A;  1YJW I;  3DF8 A;  1V5G A;  2DYR H;  2DA5 A;  3CUQ C;  4CDG A;  2UUZ A;  4AWX B;  2BVM A;  4M9Z A;  1LPQ A;  4IHX A;  4KMU X;  3E3V A;  2MD5 A;  1Z1D A;  4FCY A;  2OF7 A;  1MMN A;  3GCM A;  2JVH A;  3RZD J;  3MKL A;  4DGW B;  3T1B A;  3HTJ A;  1Y1V J;  2L4M A;  4A3K J;  1ZRF A;  3ZMS A;  4LB6 B;  2PG4 A;  2ZXW H;  2A5W A;  5LRR A;  2EIK H;  4P96 A;  2VON A;  2Z2S B;  5ERI A;  3LNQ A;  5FMP A;  1T98 A;  2HDW A;  2I10 A;  2OI8 A;  5FRN A;  2VOD A;  1MBJ A;  3K4M A;  1MH3 A;  4EJW A;  1U9O A;  2E1M B;  3FXM A;  3S1Q J;  3CJT B;  2A68 F;  4Y15 A;  4IJA A;  5DYM A;  3ZRG A;  3AL0 B;  2VJI A;  1ETO A;  3HJE A;  1S5L C;  3LSR A;  5H9T A;  3MMY B;  5DCM B;  3OWT A;  3G56 A;  1V55 H;  3AQS A;  4KIS A;  2TDX A;  3HOT A;  2NS8 A;  4HST A;  5CVR A;  1IUY A;  2CSO A;  2ID6 A;  4U87 A;  2G7S A;  2NXN B;  2FRH A;  2FXA A;  1TC3 C;  1YW7 A;  2XVC A;  3WE3 A;  3KE2 A;  4A3D J;  2VJJ A;  2G0E A;  3S5R A;  2DT7 B;  2VQC A;  1KU7 A;  4HSR A;  2KP6 A;  1PDN C;  2FML A;  3BJ6 A;  1TWC J;  1VQK I;  2DJN A;  1OR7 C;  2E7X A;  3KEY A;  4QTR A;  3WGH A;  5TRD A;  3COL A;  1WH5 A;  1IN4 A;  2LTP A;  2W24 A;  3ZMT A;  2L3D A;  1GUU A;  4YRV A;  5DAJ A;  3MEX A;  4OMZ A;  1OCZ H;  3IH4 A;  3W3C A;  1GVD A;  3DEE A;  3WGG A;  4EM2 A;  2YUS A;  1Y0N A;  4F52 A;  3J81 Z;  2LKX A;  4RBO A;  3I64 A;  1O57 A;  3BY6 A;  4FIS A;  3C2G A;  1ZG5 A;  2DFE A;  3IRQ A;  1HDD C;  2HYT A;  4M74 A;  4BJ5 C;  1RR8 C;  3ABT A;  2YU9 J;  4O5V A;  1UI5 A;  2E5N A;  5GP9 A;  4HZF A;  1ETY A;  2GA1 A;  2FSW A;  1LDD A;  4GXO A;  3MD2 A;  3QPL A;  3OOP A;  4A6E A;  4ESF A;  1RES A;  2K86 A;  5FJ8 J;  2P5K A;  3GYH X;  2O8X A;  3BDD A;  2HGC A;  1PUF A;  1IV6 A;  3BTL A;  1IRG A;  2R7D A;  3BR0 A;  3MQ0 A;  3G1L A;  1SD6 A;  1XG1 A;  2A69 F;  4FE4 A;  3DTI A;  3GVA A;  1VI0 A;  1Y39 A;  3CZ6 A;  4CZZ A;  1E3P A;  1UJ8 A;  2B0L A;  2VOP A;  4UB8 C;  4KA4 A;  2DYS H;  1Q1H A;  4Z6Y A;  2DOD A;  1W5S A;  3LA2 A;  4RGX A;  3DFG A;  3S17 J;  4GYG A;  1F1Z A;  4BQA A;  1VND A;  1E0E A;  2NAZ A;  3IHU A;  4N9I A;  1P4X A;  1XMK A;  3P9K A;  2MFZ A;  5ICE A;  1FLI A;  5IOY A;  4WXD A;  4I09 A;  1JT6 A;  2JA2 A;  3W2W A;  4YG2 F;  2HFH A;  4H4K C;  5D8L B;  3RSN A;  2IU5 A;  1GVJ A;  4HF0 A;  3BCA A;  4B8X A;  2JWT A;  3BZC A;  2GAU A;  3BR1 A;  3DBH B;  3GFM A;  1PVE A;  4KIB A;  2VC1 A;  4NUB A;  1W36 C;  2VKE A;  4HPQ A;  1T2K A;  1LJ9 A;  5HDG A;  1I1S A;  4B48 A;  3LOC A;  3UR3 C;  3F1B A;  3FHN A;  3K2A A;  5B3S H;  4G94 A;  4KUM A;  4YFX F;  4RAF A;  4OIO F;  1J09 A;  2X85 A;  5E17 F;  3B73 A;  3FWE A;  1UG0 A;  3C7J A;  3F8B A;  4I02 A;  1ZG1 A;  5H6Q A;  3Q0W A;  5D4S A;  2RQP A;  3E5U A;  3ECH A;  4PJN A;  3GTK J;  4ON0 A;  4K2E A;  2Q24 A;  2L2O A;  2FU4 A;  4LFU A;  1X1P A;  3H0D A;  3ERE D;  5D19 A;  4XOT A;  4II3 A;  4KMF A;  5C3E J;  3S1R J;  2ZC2 A;  4V19 K;  3K70 D;  3NWT A;  1G4D A;  1DUX C;  4XBF A;  2HPI A;  4LG3 A;  2V7F A;  3HGY A;  5BQT A;  4J00 A;  1FT9 A;  2X48 A;  3K10 A;  4B09 A;  2J5O A;  1ZAR A;  3E0J B;  4LLL A;  5HVQ C;  2JA5 J;  5B1B H;  4CXF A;  3KYL A;  1S7E A;  4M6Y A;  1U9N A;  2HEO A;  1BOB A;  3QWL A;  1MMG A;  2W48 A;  2R5Y A;  2HXI A;  2DA2 A;  4AC6 A;  4WF2 A;  1SVM A;  2MD0 A;  4OIP F;  3H36 A;  2BY1 A;  4F91 B;  3WG7 H;  3RQI A;  2LF7 A;  1BC7 C;  3HOX J;  1P7I A;  3GTQ J;  2D1H A;  2V79 A;  1Z6R A;  4IZZ A;  2XAG A;  4MTE A;  2L01 A;  3S16 J;  3A01 B;  2ICW G;  4ZYG A;  1DQU A;  3NAR A;  5LGT A;  2Q8K A;  1EH7 A;  1TT5 B;  2FMY A;  3BJA A;  1I27 A;  4HRI A;  3MZ8 A;  2EWN A;  1W5C C;  1WI3 A;  1RIO H;  1BBY A;  5BMZ A;  1JJ6 C;  4DBQ A;  2OD5 A;  4GCV A;  3H5N A;  2QQB A;  4M3D A;  1S7A A;  2CFO A;  1P2F A;  1KON A;  1X58 A;  2R7O A;  1LDK B;  3CP8 A;  2RVC A;  4M3G A;  4HNV A;  2M5W A;  4NC7 A;  3ZMV A;  2V4J C;  1DP3 A;  2RN7 A;  4S0H B;  3SYT A;  5JHU A;  4U9N A;  3QOE A;  1R71 A;  1ONV A;  4HKU A;  5FKK A;  4BXU A;  1Z0X A;  1T38 A;  1D0Z A;  4AM3 A;  1TW2 A;  2DDA A;  2ZJ2 A;  2DW4 A;  2CU7 A;  4N4N B;  3H0G J;  1B4A A;  2XPV A;  4HDU A;  4IPA A;  1G2H A;  1GXQ A;  4EV0 A;  1LB2 A;  1A35 A;  2IP2 A;  3T8T A;  2KPM A;  4AYB A;  3ZXS A;  1WFX A;  5JVT A;  3HOS A;  5GAG J;  2LKP A;  4PSX A;  3A1Y A;  1X1D A;  2IGM A;  4BJT A;  3J7A Y;  2YVX A;  2XAU A;  1ULY A;  2AQF A;  1HW5 A;  2BY2 A;  2P0W A;  4BQN A;  2W4S A;  3BPX A;  2FE3 A;  2LOO A;  3CF2 A;  2EA2 A;  3ZMU A;  2W00 A;  3I53 A;  3BTC A;  4IRV A;  4RAY A;  5LGU A;  2ZB9 A;  2E71 A;  3H1C A;  4QSH A;  3TO7 A;  2BV6 A;  3CCL I;  1FOX A;  2M1B A;  1V5E A;  1IDZ A;  4CGR A;  3F22 A;  2EPF A;  2GA2 A;  3LA3 A;  4D9J A;  1SEU A;  3FXQ A;  3T0Y A;  3KZ9 A;  5LHI A;  1F5T A;  1O4X A;  3M07 A;  4BY7 J;  1JTY A;  5D4R A;  4CYD A;  2KJB A;  3LJL A;  3NXC A;  4CA0 A;  3G3Z A;  3KP4 A;  3CQZ J;  3H35 A;  5HNH A;  4L0Z B;  1SFU A;  2Y0S N;  4C30 A;  1OQY A;  3DBL B;  4A3M J;  5HS7 A;  1FNN A;  4PJJ A;  2UV1 A;  2IGO A;  1MBH A;  3KYD B;  1M1E B;  1XGN A;  5DM6 F;  3JSJ A;  3KLN A;  2E1O A;  4ENJ A;  4BEH B;  2WAD A;  5K5R A;  2E2I J;  1P4A A;  3K0L A;  1JTX A;  1BR1 A;  3DBR B;  2HKU A;  2HKO A;  1CGP A;  5E3M A;  1K83 J;  2CV2 A;  2LFB A;  2QEX I;  2XF6 A;  5FB2 A;  2L9S A;  3WHC A;  2DOE A;  2A07 F;  1IAW A;  1NTC A;  2QWT A;  3PUB A;  3CO7 C;  4M9X A;  2EZK A;  3DTK A;  5FLM J;  1AHD P;  5LD2 C;  5K1Y A;  3IH3 A;  5L3E A;  5DV5 A;  1E2X A;  3F8N A;  4O3M A;  1D5Y A;  3TO6 A;  3K4J A;  1NG6 A;  2DQL A;  3E7L A;  1W7P B;  5IOZ A;  4L0Y B;  1YG2 A;  2OC6 A;  2WA0 A;  3BP8 A;  1FMV A;  3OOU A;  5FKO A;  2AXT C;  3BZ6 A;  1QA6 A;  2IRF G;  2ADU A;  4XLP F;  5ICG A;  1FBS A;  4KNY A;  5FKL A;  1J2X A;  4HEA 2;  3IWZ A;  4P55 A;  1MBF A;  5HS8 A;  4P5O A;  1TTY A;  3AG2 H;  3RQ4 A;  5IT3 A;  1IN6 A;  5AIQ A;  3F9K A;  2V6E A;  4UDS A;  3DQV C;  2FNA A;  2CRG A;  2P7V B;  1REP C;  4A3G J;  2VBW A;  2NVT J;  4GDF A;  4CCO A;  3P9I A;  3V8K A;  4CZC A;  2Y2Z A;  3MN2 A;  3JAM K;  4A6D A;  2LK2 A;  1JHF A;  2MC3 A;  2F5E A;  1UHW A;  4A3B J;  4YIF A;  1TL8 A;  2IA1 A;  3M1E A;  4IRH A;  1G59 A;  2XGX A;  2HKX A;  2ISY A;  3PO3 J;  4ZDO A;  2VKH A;  2EIJ H;  1B9N A;  3I4M J;  4PJL A;  3LSG A;  4BQO A;  2B7E A;  2PQ8 A;  3PO2 J;  4E4H A;  5DS9 A;  3ULQ B;  1XC5 A;  2E7W A;  2PFB A;  3P7N A;  4U7B A;  2V9P A;  3I5U A;  2KRF A;  1VQ7 I;  2BGC A;  3I4P A;  4HQE A;  5J40 A;  4CCJ A;  1B9M A;  4EMS A;  5D18 A;  1JKP C;  3HTH A;  3GWZ A;  2LC2 A;  4RLF A;  2Y48 A;  4BL0 B;  3NRG A;  4ICH A;  1KU2 A;  4UV8 A;  4XK4 A;  2DK5 A;  3FRQ A;  2ELH A;  3S8P A;  2OBP A;  3W6V A;  5J47 A;  4EEF G;  4RM3 A;  1FJL A;  1Z7U A;  3ON4 A;  2XGE A;  4PZJ A;  4N9H A;  2GUH A;  4XMY A;  2X6X A;  2AO9 A;  4NHJ A;  2P5L C;  1TQM A;  5D5X B;  4A3F J;  4HX8 A;  2VE8 A;  4LG0 A;  1PYV A;  2OJE D;  2DMT A;  1LUJ B;  3V8J A;  2A6H F;  2X0L A;  1K6O A;  3QYE A;  1NK3 P;  1MBE A;  1QNT A;  2R7F A;  1XGO A;  3KNW A;  3JRE A;  1UST A;  3TOB A;  1X19 A;  1OKR A;  4P1W A;  2QUF A;  2GOX B;  2HZT A;  3RJP A;  3CDL A;  2QGU A;  3HEF A;  4WCG A;  2JTV A;  3KZZ A;  3VEP A;  3BC8 A;  1R49 A;  3H9Q A;  5B1A H;  4G7O F;  1ZR4 A;  3J80 Z;  1JHH A;  3CJD A;  3GLL A;  1MZB A;  3S3M A;  3RH2 A;  3TOA A;  1MH4 A;  3VOD A;  3M8E A;  2VN2 A;  3G73 A;  1IXS B;  3ZQL A;  4IHT A;  5CQG A;  4UV9 A;  3HRS A;  5IY5 H;  2VQG A;  5J1Y A;  2X1E A;  5FKM A;  2R7V A;  4RLQ A;  5HLH A;  3PNY A;  3DXJ F;  1IF1 A;  4AVZ A;  1YS6 A;  5DM7 F;  2E2J J;  3S32 A;  4M3E A;  3EGQ A;  1UHS A;  2DQR A;  1DP7 P;  3KP3 A;  4EJO A;  1U5T B;  3LL7 A;  3HPG A;  3SZP A;  2H94 A;  2HVQ A;  2QWW A;  3SZT A;  4NB5 A;  2CUE A;  1SMT A;  2LY2 A;  2XRN A;  1Y6I A;  1VQL I;  3D1N I;  4PJ0 C;  4Y52 J;  3FK6 A;  3B02 A;  1YI2 I;  1W0T A;  2R7T A;  2MH2 A;  1LKX A;  4IOA F;  3G1M A;  1FOK A;  3BWG A;  1LEA A;  2WBM A;  3WTS C;  2YX4 A;  1ON2 A;  5E1X A;  4RB0 A;  1U2W A;  1ETQ A;  4W97 A;  3DLA A;  4E7I A;  2XAF A;  3O3K A;  2M8E A;  4FET A;  3OYB A;  2JPC A;  3A4C A;  1JE8 A;  2PJR A;  2QEN A;  2QF7 A;  1HSJ A;  2LSO A;  3AFH A;  4DZP A;  1HCR A;  3KET A;  2ZME A;  2M0M A;  2XGD A;  4G9Y A;  2LNB A;  2EFW A;  1D0Y A;  5F1R A;  1FOW A;  4Y7N J;  2HU9 A;  3V6G A;  4EGZ A;  3C18 A;  1LFU P;  4HF2 A;  1IZ1 A;  2IS4 A;  2XC7 A;  2QSF X;  1K4T A;  1G3S A;  2CH0 A;  2DOA A;  3BR6 A;  1R22 A;  2CUF A;  4XSX F;  3WU0 A;  3GZI A;  2BE5 F;  2VT3 A;  3QYB A;  2WV0 A;  3OY9 A;  3S2W A;  1K61 A;  1FBU A;  4L5J A;  2NYX A;  3MKZ A;  2IA2 A;  4WXC A;  1IG7 A;  1YLF A;  4UUT A;  4L5I A;  4NBQ A;  3ZQG A;  3WU1 B;  3HHH A;  1BI2 A;  2O7T A;  2M8G X;  3E5Q A;  4DOZ A;  2DMN A;  5TJJ A;  3SJM A;  4OIQ F;  2Z5U A;  1K7A A;  3OR2 C;  4WWC A;  1KA8 A;  4OU0 A;  5DUK A;  3VYS B;  3L2W A;  3B81 A;  2OAZ A;  2QOP A;  3BTJ A;  2PJP A;  3GFL A;  4B1R A;  4YII A;  4AU7 A;  3A0B C;  2HTJ A;  3NI7 A;  2L4A A;  4D7M A;  1J59 A;  5JR3 A;  2CG4 A;  4XON A;  5FLX K;  5C4Y A;  4OOI A;  2JSP A;  3BG7 A;  3R4K A;  2FOK A;  4IRG A;  2V57 A;  4BS9 A;  2Z3Y A;  3QPT A;  4CCK A;  3S15 J;  4FT8 A;  1HKQ A;  4DZJ A;  1ZHF A;  3QBM A;  2JUC A;  4XRS A;  4HX7 A;  3DPL C;  5AON A;  3U21 A;  3P5J A;  3VYR B;  3HTS B;  3PNV A;  4PGG A;  2KLO A;  4ZTJ A;  5GTI C;  3S3O A;  1PP7 U;  3K69 A;  2MC4 A;  3DPJ A;  1FY7 A;  2M4G A;  1BI0 A;  2L7F P;  3VYT B;  2UXU A;  1SGM A;  1I50 J;  5FLV A;  2IBD A;  1HKS A;  1SFE A;  2ZXH A;  4M3F A;  1MIJ A;  3FIW A;  4ASN A;  2R7Z J;  1J9I A;  2LF8 A;  1WWX A;  3FBN B;  4DYR A;  4RA2 A;  4LK0 F;  1LDJ A;  2VBY A;  3V4G A;  3EUH C;  1QVU A;  1SD4 A;  4LMY A;  2RNJ A;  2UXI A;  3BLY A;  3BCB A;  2HTS A;  3E6C C;  4B47 A;  1PUF B;  3SZG A;  2BW3 A;  1IRZ A;  2ZOY A;  3ANG A;  1V3F A;  4L5E A;  3MFK A;  3QU3 A;  2ACJ A;  2VKV A;  3HOW J;  2JJ7 A;  2XPU A;  2E5Z A;  4W1U A;  5DD4 A;  4DNC A;  3E7Q A;  1XCB A;  3U1K A;  1VQM I;  1KQ0 A;  2F4O B;  2OU2 A;  2B63 J;  3M1C A;  5HAW A;  1UG2 A;  1UEL B;  3IAS 2;  4A0Z A;  1W36 D;  1S9H A;  2X1D A;  1L0O C;  2WB1 N;  2DCE A;  2E19 A;  3OIO A;  5HBU A;  3KP7 A;  2FBQ A;  2F07 A;  2DA1 A;  2ZCM A;  2L9R A;  3SQN A;  3S1N J;  2NVY J;  2DA4 A;  3DCF A;  5E79 C;  2Y75 A;  3BR5 A;  1V54 H;  4TV7 A;  1OCR H;  5HLT A;  2A61 A;  3ZQC A;  2F5V A;  3VYU B;  4HW0 A;  5FGL A;  1G6N A;  3QYF A;  1MNE A;  5FD6 A;  4NEL A;  3FXO A;  3RYR A;  3PSI A;  3FM3 A;  1FZP B;  1ZK8 A;  2A6T A;  4XRS G;  3UNG C;  1GV2 A;  1IXC A;  2XAJ A;  1JUS A;  5LEJ A;  3BNI A;  1VQN I;  4LGW A;  2L02 A;  4FX4 A;  1WI9 A;  4MEY F;  1X3U A;  5F1J A;  4IQ4 A;  1JKO C;  3GTM J;  2KFD A;  3CCJ I;  2WY7 Q;  3PL8 A;  2QYO A;  2Y0M A;  3MZH A;  1NHA A;  2K4B A;  3N97 A;  5CXG A;  1Z67 A;  3WTZ A;  3B6C A;  1YO5 C;  4HAM A;  3OYE A;  1OYI A;  2CQQ A;  2WAQ A;  2QKO A;  3M9A A;  5AIP A;  3VB2 A;  1H9G A;  3R60 A;  3Q5F A;  2F5C A;  1VQ5 I;  1ZYR F;  3VSK A;  4F3Q A;  3HSE A;  1WPK A;  3K9T A;  2ZY9 A;  2ZO4 A;  4HQM A;  4JKZ A;  3BG5 A;  3N05 A;  3CUQ A;  3M8J A;  1VQP I;  1OYY A;  3AL0 C;  2KRC A;  1MBG A;  2HWV A;  4RB2 C;  3OIP A;  2R5Y B;  4Y17 A;  1MGT A;  4BUP A;  3RCO A;  5HLG A;  2NOG A;  1Z77 A;  3AG4 H;  3DP7 A;  4E7Z A;  5K7F A;  3IUO A;  2JT1 A;  3JSP A;  2YVE A;  4OD4 A;  1ETX A;  2HXO A;  4KN4 X;  1YJ9 I;  4LJZ F;  2OV7 A;  2W84 A;  2KIM A;  2DI3 A;  4I76 A;  2O61 A;  4XLN F;  2HYG D;  3F6V A;  5BPI A;  2BHZ A;  1G3W A;  2X9D A;  5GAD J;  2GXA A;  3FF5 A;  2FBK A;  2DA3 A;  3O2P E;  5FD5 A;  4YZE A;  1UCR A;  3PQK A;  1MND A;  5LGN A;  3ML6 A;  3HPH A;  1R7J A;  2H6C A;  2XB0 X;  4XM3 A;  2HS5 A;  5HLI A;  1R5H A;  2VXZ A;  3J7Z I;  3P9C A;  3WTV C;  2W85 A;  4ZJZ A;  4L9V A;  4JX4 A;  2OER A;  2J5P A;  1LEB A;  2W57 A;  3A0H C;  4CSW A;  1I6X A;  1SAX A;  4KJZ A;  5IP9 J;  1ZN2 A;  4EM1 A;  3PJR A;  1KQ9 A;  2DOF A;  3DV8 A;  1UHM A;  3HRT A;  3HG9 A;  5E3L A;  3BG9 A;  2VQL A;  1RKT A;  4AD9 A;  3NPI A;  2LBF A;  2JRT A;  9ANT A;  3K4N A;  1AU7 A;  4C3H J;  4YFK F;  2E34 A;  3BT9 A;  2VE9 A;  1QQI A;  3S2D J;  4ESJ A;  3BPV A;  4BAY A;  3OL3 A;  3ZOB A;  4RB1 A;  1OJL A;  1HBX G;  2XGC A;  1OPC A;  5LBQ A;  5ILU A;  3ZP5 A;  2JN6 A;  1OR7 A;  1MKM A;  1S3J A;  4GGG A;  2IT0 A;  3GLX A;  2CGP A;  2XKO A;  4BHC A;  4CYC A;  3A2K A;  3VWB A;  1YW8 A;  2FJI 1;  2BYV E;  5D5U B;  3S3N A;  2XRO A;  3WOD F;  3F8M A;  3BZK A;  1T6S A;  3GEZ A;  1TW3 A;  1XMA A;  1ON1 A;  3QPH A;  3HUG B;  1Z21 A;  4EJV A;  4HOB A;  3CCS I;  3PQJ A;  2G7G A;  4IXA A;  3GW2 A;  3VDX A;  3HM5 A;  1RRJ A;  5LRS A;  5L3F A;  4NDL A;  3KP5 A;  1TWF J;  2ESH A;  3FMS A;  5E8I A;  4XKV A;  4GCK A;  3LSJ A;  2PX9 A;  2XRL A;  5KAF C;  3E1S A;  3OS2 A;  1EH6 A;  3KZY A;  3GF2 A;  1LNW A;  2D6Y A;  5L3B A;  1WJF A;  2VUM J;  2CQN A;  5CW8 A;  2NNN A;  2MAB A;  3MKW B;  1D0X A;  4JYK A;  1R9T J;  1S8N A;  2IEK A;  2FD5 A;  3NAU A;  5CLS A;  3GZN B;  3GZ6 A;  3GZ5 A;  3I55 I;  3CP2 A;  4IO9 F;  3KEO A;  4IX7 A;  3VIB A;  1WH7 A;  3CES A;  4G6D A;  3VOK A;  3CCY A;  3CCM I;  2PBI A;  2DXI A;  2DG7 A;  2CW7 A;  2R7S A;  1I3Q J;  1POG A;  2HQR A;  3S1M J;  3P9T A;  5F27 A;  1IV8 A;  2W53 A;  2IPQ X;  2QSH X;  2DTR A;  3H92 A;  2D5V A;  2RV8 A;  3MZY A;  4FQG A;  5EGO B;  2Z1D A;  3FK7 A;  1HLV A;  1ITY A;  3GFI A;  3NRV A;  1YFH A;  4HBL A;  4QWQ A;  2JA6 J;  3BTI A;  1XGS A;  3I56 I;  5FRO A;  5JLW A;  3JW4 A;  4Y3O A;  2O03 A;  2OPT A;  2YVH A;  3SWH A;  2XAQ A;  3CWR A;  2MLG A;  2HPM A;  2IGK A;  3SHF A;  5GPC A;  2K9S A;  4ZH4 F;  3JRD A;  5EZG A;  3EET A;  2C6Y A;  4XSZ F;  4XR6 A;  5KCM A;  4IVN A;  1XDU A;  5K7H A;  2H8W A;  3C2B A;  1U6G A;  3GTP J;  1IUF A;  3PIO F;  4ZYD A;  2L54 A;  3QQA A;  2H1L A;  4BU2 A;  1B8I A;  4X1E A;  3NQO A;  2QQ8 A;  4AVP A;  5EEA A;  2Y69 H;  2HOS A;  3W6J B;  5B66 C;  3HSR A;  1R36 A;  4WX9 A;  4V2G A;  3IKV A;  1WJB A;  3IKT A;  4IHY A;  3O6B B;  3PSF A;  4PK4 A;  3GEU A;  4ZZD A;  5BPD A;  2DMU A;  3OYH A;  5J1R A;  2R5Z A;  3BHQ A;  2R0Q C;  3HUG A;  3KZI C;  5LLQ A;  4ENM A;  1IN8 A;  4DIQ A;  3G1O A;  3RPQ A;  3OIQ A;  5IT9 Z;  2QZ8 A;  2OA4 A;  4E70 A;  1J7K A;  3LSI A;  1HC8 A;  3N4M A;  3JRG A;  1R1V A;  3L2R A;  1G3Y A;  1WCM J;  2P6T A;  3HKZ A;  4RGR A;  2Y9Y A;  1QRY A;  4C3J J;  4NQW A;  4M9S A;  4XID A;  3HTA A;  4EM0 B;  2O6G E;  3DLL F;  4QPQ A;  2VBZ A;  1R5I D;  3ROU A;  4XKB A;  2ZSH B;  1ZR2 A;  4F7Z A;  4NN1 A;  4XIC A;  1SMY F;  3DKY A;  3ESW B;  1XPX A;  4HA8 A;  2VC0 A;  2B3W A;  3VW1 A;  1FMW A;  4LG0 B;  4G8X A;  2QM3 A;  1UFM A;  3QP5 A;  3R0A A;  2ZCN A;  2KKO A;  2ETH A;  1OCO H;  2D1V A;  5E1W A;  3TGN A;  1ENH A;  4I0A A;  1XN7 A;  2EZL A;  4ITV A;  1E17 A;  2K3P A;  3U9G A;  3RPU D;  1WJD A;  3S93 A;  1OCC H;  2F2E A;  4MNU A;  1X1B A;  3DEW A;  3K1M A;  1MJ9 A;  4HLX A;  2L9N A;  2CJJ A;  1IDY A;  2M34 A;  3O8H A;  3DKX A;  1FIA A;  5GTH C;  2KL4 A;  4RGU A;  2XSD C;  5EGO A;  2Y9Z A;  2KIS A;  4L9J A;  3OS1 A;  3OYC A;  2QCO A;  4KDP A;  1JKR C;  3A03 A;  1XCV A;  3LFK A;  4V2F A;  3JRB A;  2E1C A;  5F0H A;  2AHQ A;  2Q0O A;  1YS7 A;  3IV5 A;  4I6Z A;  1EF4 A;  2MSY A;  2PFV A;  3BG6 A;  1Z6T A;  1KGS A;  1WJE A;  3TBI A;  3VFZ A;  2DPD A;  2A05 A;  4RAG A;  4AF5 A;  3I9V 2;  2BOL A;  1WJC A;  4BDY A;  4GCT A;  3FBI B;  4AYB N;  3W6K B;  2VPR A;  4HG2 A;  1VTN C;  1UAA A;  2K5C A;  3RKY A;  5FFX A;  5EG0 B;  2LR8 A;  1CF7 A;  2YU3 A;  3FKI J;  1FYK A;  4MIM A;  1DPU A;  2EBI A;  3KEQ A;  1R4M B;  2VBX A;  1IN5 A;  2JZY A;  5D5W B;  4QIW N;  1SVO A;  3RI4 A;  1O3T A;  2P7C B;  3D0S A;  3DU5 A;  2RAE A;  5F0F A;  2BVL A;  3A02 A;  2HQN A;  3CC4 I;  3DKW A;  2ZSI B;  3TDZ C;  4XLC A;  1YX5 A;  4FE7 A;  1UMQ A;  1HOM A;  4Z2Y A;  3KCC A;  2WTE A;  2Z16 A;  1LVA A;  2PJR B;  5CYV A;  3O60 A;  1OFC X;  4ZDL A;  1O3R A;  1ZRD A;  2ZME B;  2WAF A;  4EAT A;  5J4V A;  3CDI A;  2ME0 A;  2VL8 A;  1P4W A;  1X3Z B;  3VW0 A;  4L9T A;  2WAE A;  3RKW A;  1JT0 A;  3HHG A;  3RDI A;  1X4P A;  3JRC A;  2ZJP F;  2M7A A;  3CJR B;  5ILS A;  4EGY A;  1ZQ3 P;  4DBR A;  4P9U A;  4LLN A;  2PI0 A;  1BR4 A;  1S29 A;  3JTH A;  4WXH A;  2GXG A;  1BJA A;  5E1Z B;  4D5C A;  3BRU A;  3J80 K;  3HRU A;  4IHW A;  2F4I A;  1TLH B;  5D5V B;  2K27 A;  5H2F C;  1PP8 F;  2VOO A;  4JX6 A;  3V7C A;  4NC6 A;  2LP0 A;  3BOQ A;  1K4S A;  2K40 A;  1LVK A;  1MMA A;  1UI6 A;  4ZZL A;  4FTH A;  1FOY A;  2CO5 A;  3VPR A;  1SD5 A;  3RZO J;  3F3X A;  5D6E A;  3K1P A;  2MGQ A;  4MXM A;  3H9J A;  4CCN A;  2COM A;  2H6B A;  4BKX A;  5GAE J;  2DA7 A;  3HOV J;  1T8I A;  4YEL A;  4A2U A;  2CV1 A;  2CW8 A;  2GQQ A;  3ZMD A;  4A0Y A;  2HI3 A;  1X1C A;  2MH9 A;  1ZGA A;  2VB6 A;  3LAP A;  1MSF C;  3ON2 A;  4C2M A;  2VI6 A;  4HDV A;  2F4M B;  1GT0 C;  4R79 A;  1QHG A;  4I98 B;  4KN7 X;  3WTU C;  5KVR A;  4DVY P;  1R23 A;  3ERM A;  2EV5 A;  2KIF A;  4BHP A;  4E7S A;  3VVY A;  2ZFU A;  2Q2E A;  3H3Z A;  4II2 A;  4D7N A;  5C4X J;  2QBY B;  4BE1 A;  4ABZ A;  5JLX A;  4RDU A;  3CCE I;  2FX0 A;  5HNF A;  2EQR A;  2HDC A;  4PCQ A;  5BNG A;  1FEX A;  2EFQ A;  3NWS A;  2XKP A;  3VUQ A;  2V9V A;  2YR2 A;  1YIJ I;  2GBY A;  3F8F A;  2HQA A;  4KIG A;  4RS8 A;  3VVZ A;  1VQ8 I;  3Q9V A;  4UB6 C;  3GTO J;  1YYV A;  2DFI A;  2XIG A;  5EG0 A;  2OZU A;  2STT A;  2R7W A;  2DT5 A;  3PFY A;  1ZKG A;  3TO9 A;  3BRO A;  4OD5 A;  2FNP A;  2DK8 A;  3EUK L;  1RUN A;  4JNN A;  4MO7 A;  4HYE A;  4F92 B;  2IAI A;  5IP7 J;  4JK1 X;  1YQA A;  4A5M A;  4BE2 A;  5J6X A;  2IS1 A;  3F72 A;  4GYI A;  5E3N A;  2EK5 A;  3OSF A;  1U0J A;  1T0F C;  4E7L A;  2PMZ A;  3CMY A;  4B43 A;  2E2H J;  4A0X A;  3HDD A;  2BW3 B;  2E36 A;  3LSP A;  5LEK A;  1QU3 A;  1WJA A;  1YW9 A;  2FOW A;  2IVM A;  3WGI A;  1JJ8 C;  4A12 A;  4A3L J;  1XB4 A;  2RGV A;  2V9K A;  2D2W A;  2R4G A;  2X4H A;  1TT0 A;  3HIM A;  2M9H A;  3F0C A;  4J19 A;  2XHK A;  1F4K A;  3IAM 2;  3HOZ J;  2JSC A;  4UY8 I;  5M5Y J;  4RAZ A;  2X6O A;  2ZNY A;  3BR3 A;  2HDD A;  3CCR I;  1RET A;  2L5Q A;  1YX3 A;  1ODD A;  1NH3 A;  3WTT C;  2F6C A;  2DN0 A;  3K6G A;  3IL2 A;  1A6I A;  1U8B A;  5B5E C;  1SC7 A;  1A5J A;  2EZH A;  3VW2 A;  3L00 A;  2H8R A;  3RKQ A;  3V78 A;  2R92 J;  2QSG X;  1U5T C;  1J0R A;  3OYJ A;  2W7N A;  1LE8 A;  5KK1 A;  4C2T A;  1XGM A;  5F64 A;  4FAS D;  4S04 A;  4BH9 A;  1R4N B;  3EUP A;  2KQR A;  4MGR A;  1Z3X A;  2WC2 A;  1WKM A;  2WWY A;  1SFO J;  2V1D A;  3HTU A;  1O7L A;  1GDT A;  4U0Y A;  1K79 A;  4OMY A;  1SFX A;  2GIZ A;  3DPU A;  4M6X A;  2M3A A;  1D1C A;  4PDK A;  2PZ9 A;  1QHH D;  2VKD A;  4A3E J;  1QZE A;  2RHA A;  3CDH A;  3L2V A;  2OTL I;  1FSE A;  3RPU A;  3GUD A;  4PFO A;  4GO1 A;  3CC7 I;  4C3I J;  2OTJ I;  3HTI A;  1MW7 A;  3L9F A;  4ZYE A;  3PAS A;  1MJA A;  1Z91 A;  2M2E A;  2HOA A;  3Q0U A;  1WHU A;  1LFP A;  2BY0 A;  5H20 A;  5A2Q K;  5ICC A;  1QBJ A;  5IYD J;  1IRF A;  4XKW A;  4BHB A;  1F36 A;  1KZH A;  3HE0 A;  2FBI A;  2EV0 A;  4Q4Z F;  2KIU A;  1RUO A;  4A3J J;  2GOM A;  3GME A;  3I54 A;  3T8R A;  1FC3 A;  4IEJ A;  3QOD A;  1B1B A;  3HSF A;  2QBY A;  4C2U A;  3M3Y J;  3I0T A;  4AC0 A;  1YRN A;  4WIB A;  4EQQ A;  4MFD A;  3R61 A;  5E8G A;  5CXI A;  4MTD A;  4OIR F;  4UUS B;  2WY8 Q;  5BS6 A;  3TP3 A;  1W0U A;  1D3Y A;  1FWZ A;  2O7O A;  2K4J A;  1VQO I;  1HQC A;  3EQL F;  2D45 A;  4M72 A;  3KFW X;  4CHU A;  1ZRE A;  3CUQ B;  1GHC A;  4EVI A;  1FYM A;  4XRF A;  2YPR A;  1XX5 A;  2XSJ C;  1KYZ A;  4CIC A;  1HDP A;  4IRI A;  2CUJ A;  3C1D A;  4AIK A;  2QQA A;  2W1O A;  4JL3 A;  3ZQI A;  1EJ9 A;  2R7U A;  4MK6 A;  1UB9 A;  1N77 A;  4E7K A;  4PXI A;  4M73 A;  5KHD A;  3G71 I;  5EYR A;  3FKJ A;  2K9Q A;  1RPW A;  2G3B A;  4BBS J;  3G7R A;  1ETV A;  2OUM A;  5F08 A;  1K78 B;  4L62 A;  2DBB A;  2ESN A;  4JBA A;  1EA3 A;  2O5R A;  4KT6 A;  4XOR A;  4ENK A;  2HQ5 A;  2LD5 A;  2AQE A;  2EV6 A;  4G7H F;  1V4R A;  1FBQ A;  3ABK H;  3Q9S A;  1WRJ A;  1LQ1 A;  1MD0 A;  3ZQF A;  5LHG A;  5J8C A;  3IWF A;  4CGZ A;  2WUI A;  4BAC A;  3TQN A;  1XDS A;  4ETS A;  1MMS A;  3ASO H;  1STZ A;  1D1B A;  3NEU A;  3J7Y J;  2ECB A;  5EJC A;  1FPQ A;  1X3W B;  3CO6 C;  4UNO A;  3HBL A;  2E35 A;  4G12 A;  5HSZ A;  3NS4 A;  1DPR A;  1C0W A;  1TZL A;  3IH2 A;  4UVB A;  4A5N A;  2V1N A;  5FLX Z;  2V26 A;  3I4N J;  4FX0 A;  3JRF A;  3QRF F;  4J01 A;  2DA6 A;  2VPL A;  2EIN H;  4BBR J;  4NC8 A;  1OMI A;  3OYD A;  3BJB A;  4UHT A;  1YE9 A;  1S7O A;  2BXZ A;  1B59 A;  5H6R A;  4DYQ A;  4I2O A;  4HF1 A;  2LBF B;  2V1U A;  3I58 A;  1N25 A;  4Y33 A;  3DU6 A;  5DTD A;  4MLO A;  2NS7 A;  2JVG A;  3LQR A;  4AUX A;  3J81 K;  3SEZ A;  2XF5 A;  1BW5 A;  1MJB A;  2CMP A;  3D5S C;  4B3A A;  1RR7 A;  4CYC B;  3OS0 A;  4MEX F;  4KIT B;  1YIT I;  1R1U A;  1V5F A;  5ED4 A;  3OYK A;  2X6Y A;  1ZGW A;  3COA C;  4A93 J;  3CRJ A;  2BBY A;  4FHT A;  5K58 A;  2XDV A;  3RD3 A;  4BGD A;  3S2H J;  3F23 A;  1JUP A;  2XF7 A;  4EJU A;  3OYI A;  3SEQ A;  3ABM H;  2VAS A;  2EIM H;  1D1A A;  2ZXI A;  3TMO A;  1D8J A;  2NX4 A;  3EUH A;  5CPR B;  4UUS A;  1FTZ A;  2GIV A;  4BNC A;  3HL2 A;  1O3Q A;  3TL4 X;  5L3C A;  5FFZ A;  4OAY A;  3G6E I;  2OQG A;  4KFC A;  4KIF A;  5CKT A;  1DGR M;  4LB5 A;  2E1M C;  3OYA A;  4MHG A;  4I0B A;  5FRM A;  5EZH A;  3IP4 B;  1W1W E;  3ABL H;  3CLO A;  4S05 A;  1ZRC A;  3K7A J;  1Y8R B;  4LIU A;  3L1P A;  3KYC B;  1TQP A;  2X51 A;  3C07 A;  2DFF A;  1TQI A;  1QGP A;  3CJN A;  4PJM A;  2LRE A;  2EIL H;  3FXU A;  5HOD A;  1FSH A;  1YTY A;  2CFX A;  2K02 A;  3BQY A;  3HRM A;  1K78 A;  2FF4 A;  2G9W A;  4A3I J;  3H5R A;  4DW6 A;  4BYY A;  1A31 A;  4X6A J;  1QZZ A;  1ZAO A;  4XOP A;  2M87 A;  2ZBK A;  2ZNZ A;  1BN5 A;  2FEZ A;  3VOX A;  1K6Y A;  3CUO A;  3GXO A;  3K8P C;  2ZKZ A;  4OIN F;  3QU6 A;  2JRM A;  2BXY A;  4ANJ A;  2YSR A;  2AXL A;  3ABU A;  3CLQ A;  3I71 A;  4ZC3 A;  3IUV A;  1A6Q A;  3ZQH A;  2FUG 2;  4Y13 A;  1P7J A;  3LSH A;  1NG7 A;  5ICF A;  2RKH A;  1SFK A;  4QPO A;  1FP1 D;  4NNJ A;  3ASN H;  5FKN A;  1ZLJ A;  2XPW A;  4IL6 C;  1Z05 A;  3HOY J;  3OV8 A;  2CYY A;  2L7M P;  3CCQ I;  3LSK A;  1TBX A;  2NVU B;  3L2U A;  2CQK A;  2EFP A;  1X1A A;  5CJ9 A;  3H3V K;  2XV4 S;  1H8A C;  3QOP A;  3LWJ A;  2RC4 A;  5K5O A;  2UXX A;  1FYL A;  2A2F X;  1FIP A;  4PGH A;  3EDP A;  4ZYA A;  1B8I B;  1IJW C;  2ECC A;  1AKH B;  2Y30 A;  2IS6 A;  1I39 A;  2VJ5 A;  5CVV A;  4B4C A;  4M6V A;  1HF0 A;  4F55 A;  2XAH A;  1GLN A;  2QKL B;  1PJR A;  2IXS A;  4Q47 A;  2JPB A;  3TED A;  2QLZ A;  2UWM A;  2R5Z B;  1OYW A;  2IA0 A;  3F8C A;  3SDB A;  3VP5 A;  2A5Y B;  3GFJ A;  3FXL A;  1I6H J;  3OSG A;  2PMH A;  2JA7 J;  3K2Z A;  1KU3 A;  2DLL A;  4PUS A;  1YHQ I;  1TWG J;  2Q1Z B;  3LAJ A;  2R93 J;  2UXP A;  4P9F A;  2HVS A;  2WAQ N;  4HV6 A;  3GTL J;  4ENN A;  1G8X A;  3R0J A;  3BG3 A;  2VQH A;  5DCM A;  5J8F A;  2EZI A;  1BC8 C;  3FX3 A;  3QPS A;  3CF5 F;  4HLY A;  1UZC A;  2PMU A;  2R7Q A;  4OWR B;  4ZYH A;  1B72 B;  2LKS A;  3MNL A;  4I7H A;  5HS9 A;  4GRI A;  1VF9 A;  3DTE A;  2ZFW A;  2RDP A;  3TW7 A;  5E18 F;  2CQX A;  5M3F J;  1ERD A;  3VVX A;  1WZ2 A;  4XNF A;  2KZV A;  1Z3Y A;  3CMA I;  4ZTF A;  2O8K A;  2MYS A;  3JR9 A;  5KAI C;  1ORK A;  2JMW A;  2LYC A;  2G7L A;  4NQW B;  5L3G A;  5IPA A;  1FTT A;  1P92 A;  3TW6 A;  1JKQ C;  1SAU A;  1F9N A; 
#chains in the Genus database with same CATH homology
 1MBJ A;  1NK2 P;  3T6N A;  4I6Z A;  3SFI A;  5FHP A;  1MH3 A;  4W97 A;  1ETQ A;  1EF4 A;  1U9O A;  3S1Q J;  2MSY A;  1ETO A;  3O8G A;  2ELK A;  3M4O J;  2QF7 A;  4AF5 A;  4DZP A;  3LSR A;  1HCR A;  4GCT A;  5H9T A;  3WHB A;  2XGD A;  4AYB N;  2GM4 A;  2VPR A;  3G56 A;  4Y7N J;  3V6G A;  1LFU P;  5EG0 B;  3AQS A;  2LR8 A;  5F0C A;  3FKI J;  3GZI A;  3BR6 A;  4MIM A;  2CUF A;  2NS8 A;  2EBI A;  5C4J J;  5D1R A;  2ID6 A;  2G7S A;  4QIW N;  1K61 A;  1TC3 C;  1QVT A;  2RAE A;  5F0F A;  4A3D J;  2G0E A;  3A02 A;  3S5R A;  1IG7 A;  4UUT A;  1Q1V A;  4C2M J;  3ZQG A;  2O7T A;  2M8G X;  1BA5 A;  3BR2 A;  1UMQ A;  2DMN A;  4FE7 A;  3GTJ J;  1HOM A;  1TWC J;  3IV5 A;  2DJN A;  4QTR A;  1ETW A;  3SJM A;  3COL A;  1WH5 A;  2LTP A;  3O60 A;  1OFC X;  3JRA A;  1GUU A;  5DAJ A;  2ME0 A;  3VW0 A;  1JT0 A;  3B81 A;  3IH4 A;  2QOP A;  3BTJ A;  1RKW A;  3JRC A;  1GVD A;  4B1R A;  1X2N A;  2YUS A;  1ZQ3 P;  2LKX A;  4RBO A;  1Y1W J;  3NI7 A;  1BL0 A;  4D7M A;  4FIS A;  1AKH A;  4D5C A;  5EF6 A;  1HDD C;  2HYT A;  3BRU A;  5C4Y A;  4IHW A;  1CQT A;  2YU9 J;  2WV1 A;  4JX6 A;  1UI5 A;  2FQ4 A;  5GP9 A;  2LP0 A;  1ETY A;  2DMP A;  2K40 A;  1UI6 A;  2V57 A;  3QPL A;  4FTH A;  3VPR A;  3S15 J;  1T56 A;  1RES A;  4DZJ A;  1JUM A;  3RZO J;  5FJ8 J;  1PUF A;  3QBM A;  1IV6 A;  2DMQ A;  1BW6 A;  4XRS A;  3BTL A;  2PBX A;  2MGQ A;  3BR0 A;  4MXM A;  2DG8 A;  3G1L A;  4BKX A;  1XG1 A;  2DA7 A;  4FE4 A;  1VI0 A;  3HOV J;  3HGG A;  3BQZ A;  3DPJ A;  2L7F P;  3S17 J;  2UXU A;  2K9N A;  1B72 A;  5IYB J;  1VND A;  1SGM A;  1I50 J;  2HI3 A;  5K7Z A;  5FLV A;  1APL C;  2IBD A;  1MSF C;  1IGN A;  3ON2 A;  4M3F A;  2VI6 A;  1GT0 C;  3FIW A;  2R7Z J;  5IOY A;  3ANP A;  1JT6 A;  4DYR A;  1SAN A;  3HB9 A;  3VVY A;  1DU6 A;  1QVU A;  4D7N A;  5C4X J;  2IU5 A;  2UXI A;  2NP5 A;  4ABZ A;  5JLX A;  4RDU A;  4GFK A;  4A69 C;  2FX0 A;  2EQR A;  2JWT A;  1PUF B;  4LOC A;  5BNG A;  1IRZ A;  3BR1 A;  2ZOY A;  1FEX A;  2M0C A;  4L5E A;  3ANG A;  4DYC A;  3VUQ A;  2VKE A;  2VKV A;  2GBY A;  3HOW J;  2JJ7 A;  2XPU A;  3E7Q A;  4W1U A;  2EH3 A;  3LOC A;  3VVZ A;  3F1B A;  4JX5 A;  3GTO J;  3K2A A;  2B63 J;  2TRT A;  5HAW A;  1UG2 A;  5EG0 A;  2LY9 A;  2NP3 A;  1ZKG A;  3Q0W A;  2WB1 N;  2KDZ A;  2COB A;  4JNN A;  3GTK J;  4MO7 A;  3SDG A;  2E19 A;  2IAI A;  3OIO A;  5IP7 J;  2Q24 A;  5AQC A;  5HBU A;  2HOT A;  2FBQ A;  2F07 A;  5D19 A;  2DA1 A;  2ZCM A;  2L9R A;  5E3N A;  3OSF A;  3S1N J;  2NVY J;  2DA4 A;  3DCF A;  5C3E J;  3S1R J;  2E2H J;  3CMY A;  2JA8 J;  3HDD A;  3BR5 A;  1GV5 A;  4M3B A;  3LSP A;  3A01 A;  1XS9 A;  3ZQC A;  1JJ8 C;  4A3L J;  3HGY A;  5FGL A;  2X48 A;  3HIM A;  2M9H A;  3F0C A;  4J19 A;  1BJZ A;  4GFL A;  4NEL A;  3HOZ J;  2GLO A;  1ZK8 A;  4ME9 A;  5M5Y J;  2JA5 J;  2X6O A;  2HDD A;  3BR3 A;  4XRS G;  1RET A;  1GV2 A;  2XB5 A;  1S7E A;  1H88 C;  1U9N A;  1JUS A;  2DN0 A;  3BNI A;  2W48 A;  1A6I A;  1U8B A;  2R5Y A;  1A5J A;  2HXI A;  2EZH A;  3VW2 A;  2DA2 A;  4AC6 A;  5F1J A;  3GTM J;  1JKO C;  2H8R A;  3RKQ A;  3V78 A;  2R92 J;  1LE8 A;  3RQI A;  3HOX J;  1P7I A;  3GTQ J;  5CXG A;  3B6C A;  3EUP A;  4GCL A;  2HYJ A;  2LLK A;  1SFO J;  2LVS A;  2CQQ A;  3S16 J;  2QKO A;  3A01 B;  1GDT A;  3NAR A;  2PZ9 A;  5M5X J;  4A3E J;  4ACI A;  2RHA A;  2Y31 A;  1WI3 A;  2ME6 A;  5C44 J;  1WPK A;  3AQT A;  1JJ6 C;  4JKZ A;  3BG5 A;  3HTI A;  4C3I J;  3PAS A;  4M3D A;  2HKU A;  4M3G A;  4HNV A;  1X58 A;  2M2E A;  1MBG A;  2HOA A;  3Q0U A;  1OCT C;  5J3L A;  4S0H B;  2R5Y B;  5IYD J;  3HKZ N;  1F36 A;  3HE0 A;  2NOG A;  1Z77 A;  2G7L A;  2YVE A;  5K7F A;  1OCP A;  4HKU A;  1ETX A;  2MG4 A;  5FKK A;  1LE8 B;  2HXO A;  1Z0X A;  4A3J J;  1LFB A;  2CU7 A;  3H0G J;  2XPV A;  4IEJ A;  4I76 A;  3M3Y J;  3FIS A;  1G2H A;  3LHQ A;  4XRM A;  2X9D A;  4AC0 A;  1YRN A;  2DA3 A;  4MFD A;  2YS9 A;  4YZE A;  5CXI A;  3PPB A;  4UUS B;  3KKD A;  3TP3 A;  1W0U A;  2XB0 X;  1QPI A;  2O7O A;  5M5W J;  1ETK A;  5EFY A;  4JX4 A;  2L7Z A;  2OER A;  3GBG A;  1HDP A;  3BTC A;  5IP9 J;  4JL3 A;  3ZQI A;  4MK6 A;  2ZB9 A;  3MVP A;  4QSH A;  4PXI A;  4BY1 J;  5EYR A;  1MNM C;  2K9Q A;  5E3L A;  3BG9 A;  1RPW A;  1IDZ A;  2G3B A;  4BBS J;  3G7R A;  4CGR A;  1ETV A;  1RKT A;  5F08 A;  4L62 A;  3KZ9 A;  1O4X A;  2HQ5 A;  2LD5 A;  4BY7 J;  3NPI A;  1JTY A;  1YRN B;  1ZTR A;  9ANT A;  3LJL A;  1AU7 A;  3NXC A;  3TP0 A;  4C3H J;  3ZQF A;  3BT9 A;  2WUI A;  3CQZ J;  3S2D J;  2N8G A;  2Y0S N;  2TCT A;  3ZOB A;  1OJL A;  4A3M J;  2ECB A;  2XGC A;  1F43 A;  4A3C J;  3QKX A;  2JN6 A;  1MBH A;  2FJ1 A;  1U78 A;  3JSJ A;  3HBL A;  2E1O A;  4G12 A;  5HSZ A;  4CYC A;  3IH2 A;  2REK A;  2E2I J;  1JTX A;  3I4N J;  3JRF A;  2DA6 A;  5E3M A;  1K83 J;  2LFB A;  4BBR J;  3BJB A;  3NNR A;  2G7G A;  3WHC A;  3HM5 A;  1NTC A;  4DYQ A;  2GFN A;  4NDL A;  2QWT A;  2EZK A;  5IYC J;  1TWF J;  5FLM J;  1AHD P;  3IH3 A;  4IHV A;  5E3O A;  2RAS A;  5DTD A;  4GCK A;  3LSJ A;  2XRL A;  4MLO A;  5F04 A;  2NS7 A;  2UXH A;  3S14 J;  4AUX A;  1JGG A;  1D5Y A;  3BCG A;  1H89 C;  2XDN A;  4KWA A;  3E7L A;  5IOZ A;  1E3O C;  1MBK A;  1BW5 A;  5FKO A;  2D6Y A;  3OOU A;  4B3A A;  2VUM J;  1RR7 A;  5CW8 A;  4CYC B;  4JYK A;  1R9T J;  2IEK A;  2FD5 A;  3NAU A;  5FKL A;  1MBF A;  1ZGW A;  3VIB A;  1WH7 A;  3CRJ A;  4A93 J;  3VOK A;  4UDS A;  3CCY A;  5K58 A;  3RD3 A;  3S2H J;  2DG7 A;  1JUP A;  2L0K A;  2CRG A;  2MW8 A;  1I3Q J;  4A3G J;  1POG A;  2ZOZ A;  3S1M J;  4D5F A;  5EDN A;  3P9T A;  5F27 A;  2NVT J;  2NX4 A;  2W53 A;  4JP0 A;  4UUS A;  1FTZ A;  5M3M J;  2D5V A;  2Y2Z A;  3MN2 A;  2NVQ J;  5EGO B;  2LK2 A;  3FK7 A;  1HLV A;  1ITY A;  3B6A A;  4A3B J;  5EZH A;  3BTI A;  2JA6 J;  1DU0 A;  5JLW A;  2GEN A;  2QIB A;  3K7A J;  2OPT A;  3PO3 J;  2YVH A;  3L1P A;  3CWR A;  3I4M J;  3C07 A;  5GPC A;  2KT0 A;  2K9S A;  3LSG A;  5HOD A;  3PO2 J;  3JRD A;  5EZG A;  5DS9 A;  3BQY A;  4A3I J;  4GFB A;  4DW6 A;  1XC5 A;  4X6A J;  3Q0V A;  1IC8 A;  5K7H A;  3VOX A;  3C2B A;  3GTP J;  1IUF A;  2UXO A;  1VFC A;  5D18 A;  3QQA A;  1JKP C;  5J1U A;  2ID3 A;  3HTH A;  4ICH A;  1B8I A;  3NRG A;  4X1E A;  2P81 A;  3IUV A;  3GTG J;  5EEA A;  2HOS A;  4XK4 A;  3ZQH A;  3FRQ A;  1P7J A;  3W6V A;  4V2G A;  1TWH J;  2O9L A;  4EEF G;  4IHY A;  1FJL A;  5FKN A;  2XPW A;  3UKG A;  2NVX J;  3ON4 A;  3GEU A;  3JRH A;  2DMU A;  2XGE A;  5J1R A;  2R5Z A;  2GUH A;  3HOY J;  3KKC A;  3Q3S A;  2AO9 A;  3BHQ A;  2ZCX A;  2R0Q C;  4A3F J;  2L7M P;  4BXX J;  2DMT A;  2PMZ N;  1T33 A;  4MFE A;  3H3V K;  3G1O A;  1NK3 P;  1MBE A;  1H8A C;  2JK3 A;  3LWJ A;  2DTZ A;  3KNW A;  3JRE A;  2QTQ A;  1X2M A;  2H1K A;  1WGX A;  1FIP A;  3JRI A;  1B8I B;  1IJW C;  2ECC A;  1AKH B;  2Y30 A;  3HOU J;  1MSE C;  3JRG A;  4B4C A;  4M6V A;  2WGB A;  3PM1 A;  3CDL A;  3HEF A;  1WCM J;  1HF0 A;  2Y9Y A;  1QRY A;  4C3J J;  4XID A;  3HTA A;  3TED A;  1ZR4 A;  5GPA A;  3CJD A;  2R5Z B;  1TWA J;  3RH2 A;  5IP6 A;  1MH4 A;  3VP5 A;  1ZR2 A;  3ZQL A;  1I6H J;  2DA5 A;  4NN1 A;  4XIC A;  3OSG A;  2JA7 J;  2R93 J;  1TWG J;  3VW1 A;  2UXP A;  5J1Y A;  5FKM A;  4IHX A;  2ZCN A;  2WAQ N;  2E2J J;  3GTL J;  4M3E A;  4FCY A;  2OF7 A;  1ENH A;  3EGQ A;  1UHS A;  2EZL A;  3BG3 A;  2EZI A;  3QPS A;  3RZD J;  3MKL A;  3HTJ A;  1Y1V J;  4A3K J;  1B72 B;  3DEW A;  3MNL A;  1VF9 A;  5M3F J;  3TW7 A;  2CQX A;  2CJJ A;  1IDY A;  2CUE A;  2M34 A;  3O8H A;  1FIA A;  3VVX A;  2O8K A;  3JR9 A;  2XSD C;  2Y9Z A;  5EGO A;  1ORK A;  2JMW A;  3LNQ A;  5FMP A;  3D1N I;  2QCO A;  4Y52 J;  3FK6 A;  1JKR C;  3A03 A;  1W0T A;  5IPA A;  1FTT A;  2I10 A;  4V2F A;  3TW6 A;  3JRB A;  2OI8 A;  3G1M A;  1JKQ C;  5F0H A;  2AHQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...