5KH3A

Crystal structure of fragment (3-(5-chloro-1,3-benzothiazol-2-yl)propanoic acid) bound in the ubiquitin binding pocket of the hdac6 zinc-finger domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
101
structure length
101
Chain Sequence
SPLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Small Molecule Antagonists of the Interaction between the Histone Deacetylase 6 Zinc-Finger Domain and Ubiquitin.
pubmed doi rcsb
molecule keywords Histone deacetylase 6
molecule tags Hydrolase
source organism Homo sapiens
total genus 30
structure length 101
sequence length 101
ec nomenclature ec 3.5.1.98: Histone deacetylase.
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5kh3A00
4AYCA 5KH3A 2PUYA 2OXQC 3EB5A 1G25A 2VPGA 2LQ6A 2G43A 2CSYA 2CKLB 1WEWA 1Z6UA 2YSJA 2EODA 5EYAF 1WEVA 2XEUA 4PTBA 1X4IA 1WEQA 4R2YA 5AIUA 1WEPA 4L7XA 5G0FA 3LRQA 4LK9A 3PHDA 1N87A 2G45A 1Z60A 1MM3A 2VPEA 2JMJA 2JRJA 2H0DB 3C6WA 4GNGA 3ZTGA 3U5MA 4UP0A 4FJCA 3RPGB 2CT2A 3GL6A 3HTKC 5H1TA 4XI1A 5I3LA 1WFKA 2Y1NA 3KV5A 2PNXA 4CCGX 4C9ZA 2YQMA 4L58A 1JOCA 4QF2A 1DVPA 2L43A 1WENA 4N4FA 2QICA 3M63A 4GNEA 3L1ZB 3PURA 5B78A 2KYUA 2L5UA 2L75A 1X4UA 4Q6FA 3O36A 4NN2A 2RSDA 2KGGA 1Z2QA 5H1VA 2MNZA 4ZDTA 4V3KC 3IHPA 5TBNA 4LADB 2K17A 3M99A 4I7CA 1WILA 4P5OB 2E6RA 2M6MA 1JM7B 2K4DA 2K1JA 4TKPB 3PUQA 2VJFB 3U5NA 4WA6A 2YU4A 3LQHA 2HYED 1FP0A 2FSAA 2JMDA 3V43A 3N9QA 2NAAA 5LCWB 2LGLA 5B79A 2F6JA 1XWHA 2KREA 1VFYA 3KNVA 3RPGC 3ZNIA 1WESA 2EA6A 4A49A 1F62A 2VJEB 3GV4A 2KU3A 2KFTA 1LDKC 2RI7A 2YREA 3O37A 2M85A 3ZVYA 4WZ0A 2EGPA 2CSZA 4BBQA 5B76A 5FERA 2YYRA 2ECWA 3N9PA 4FIPA 3N9MA 3O35A 2G6QA 4PPEA 5H1UA 3O7AA 2VPBA 5TRBA 2MD8C 5LKTA 3KQIA 2M3HA 2MNYA 2M1RA 2QJ0A 2K16A 4R7EA 2F42A 3NG2A 4QF3A 2LXHC 4AYCB 4I7DA 3KV6A 4LJNA 2LXPC 3VK6A 5B75A 1U6GB 4X3GA 1WIMA 5JG6A 3L1XA 2UZGA 2L80A 4B7YC 5TDWA 5FB1A 2KE1A 4R8PK 4ZUXU 3U5OA 2QIZA 1WGMA 2MA6A 1RMDA 1VD4A 3O70A 2HDPA 5FEYA 1T1HA 2C2LA 4A4CA 4S3OC 4FK5A 3RTRB 4F52B 4I7BA 5G04B 5FB0A 3SOXA 3C5KA 3HCUA 4MVTA 1X4JA 2VJFA 2XB1A 4YC9A 4IC2A 2YHNA 3T7LA 1K2FA 4GB0A 4A4BA 3DPLR 2I50A 5KH7A 1HYJA 2YHOA 4V3LC 2KWOA 2LV9A 5D1MB 2KWKA 2BAYA 4GNDA 5DKAA 3ZPV1 5D1LB 3T6RA 2JMIA 2CKLA 1CHCA 4UP5A 4YADA 5DINA 4LKAA 3HCTA 3N9LA 2L0BA 2ZETC 2AN6A 2YSMA 2MIQA 3L11A 2ECJA 4IC3A 2E6SA 2FUUA 4CA1A 1ZBDB 3SHBA 3LQJA 2MA5A 3HCSA 3FL2A 3MHSA 4O64A 3QZVA 2H0DA 2LRIC 2YUCA 2LGGA 2DX8A 5H9MA 4UI9B 5J3XA 5LKUA 5TABA 2LGKA 3U5PA 4A0CD 1FBVA 2D8SA 2IDAA 2Y1MA 4LLBA 5AITA 1LDJB 2YT5A 3O33A 2KWJA 2C2VS 4WZ3B 2Y43A 3EB6A 4AUQB 1HYIA 5G05B 2VP7A 3I2DA 2VPDA 2YW8A 2LDRA 2YQLA 4YBTA 4ZQLA 2ECIA 4YAXA 2F6NA 1WEUA 5C11A 2KIZA 5B77A 2KWNA 4FO9A 1WEOA 3DQVR 1WEMA 2LN0A 1IYMA 4AP4A 4YABA 1JM7A 2ECNA 5D1KB 4WZ2A 3ASLA 1BORA 4W4UA 5KH9A 4AVXA 3M62A 4GNFA 5LKXA 5C13A 4N3WA 3O34A 2KR4A 4YATA 1WE9A 2MT5A 2ECGA 2VJEA 3MHHA 2ECVA 2YURA 3ZPVE 5B8DA 4BHWA 1WEEA 3ZYQA 1VYXA 1V87A 2MD7B 5LKZA 2ECTA 4B86C 3N9OA 4YBMA 1MM2A 2LGVA 3N9NA 2MUMA 3SOWA 2KGIA 3SOUA 3ZVZB 4YBSA 1E4UA 2VNFA 5TDRA 4MSXA 4S3OB 2FUIA 3LQIA
chains in the Genus database with same CATH superfamily
4AYCA 5KH3A 2PUYA 2OXQC 3EB5A 1G25A 2VPGA 2LQ6A 2G43A 2FD4A 2CSYA 2CKLB 2XOYA 1WEWA 1Z6UA 2YSJA 2EODA 5EYAF 1WEVA 4Z0RA 2XEUA 4PTBA 1X4IA 1WEQA 2FFWA 4R2YA 5AIUA 4F1PA 1WEPA 2XP0A 4L7XA 5G0FA 3LRQA 4LK9A 3PHDA 1N87A 2G45A 1Z60A 1MM3A 2VPEA 2JMJA 3LDYA 2JRJA 2JUNA 2H0DB 3C6WA 4GNGA 3ZTGA 3U5MA 4UP0A 4FJCA 3RPGB 2CT2A 3GL6A 3DWDA 3HTKC 5H1TA 5K3QA 4XI1A 5I3LA 3KV5A 1WFKA 2Y1NA 2PNXA 4CCGX 4C9ZA 2YQMA 4L58A 1JOCA 4QF2A 2CRRA 1DVPA 3JUEA 2L43A 1WENA 4N4FA 2QICA 3M63A 3Q1DA 4GNEA 3L1ZB 3FM8C 3PURA 5B78A 2KYUA 2L5UA 2L75A 1X4UA 4Q6FA 3O36A 4NN2A 2RSDA 2KGGA 1Z2QA 5H1VA 2MNZA 4ZDTA 4V3KC 3IHPA 5TBNA 4LADB 2K17A 3M99A 4I7CA 1WILA 4P5OB 2E6RA 2M6MA 1JM7B 2K4DA 2K1JA 4TKPB 5SVYA 3PUQA 2VJFB 3U5NA 2LAUA 4WA6A 3DDTA 2YU4A 3LQHA 4O62A 2HYED 1FP0A 2FSAA 2JMDA 3V43A 3N9QA 2NAAA 5LCWB 2LGLA 5B79A 2F6JA 3FANA 1XWHA 2KREA 1VFYA 3KNVA 5SVIA 3RPGC 3ZNIA 1WESA 2EA6A 4A49A 1F62A 2VJEB 3GV4A 2KU3A 2KFTA 1LDKC 2RI7A 2YREA 3O37A 2M85A 3ZVYA 4WZ0A 2B0OE 2EGPA 2CSZA 4BBQA 5B76A 3E2DA 5FERA 2YYRA 2ECWA 3N9PA 4FIPA 3N9MA 3O35A 2MKEA 2G6QA 4PPEA 5H1UA 3O7AA 2VPBA 4Z0OA 2M13A 5TRBA 2MD8C 5LKTA 3KQIA 2M3HA 2MNYA 2M1RA 2QJ0A 2K16A 4R7EA 2F42A 3NG2A 4QF3A 2LXHC 4AYCB 4I7DA 3KV6A 2OWAA 4LJNA 2LXPC 3VK6A 5B75A 1U6GB 4X3GA 1WIMA 5JG6A 3L1XA 2UZGA 2L80A 4B7YC 5TDWA 5FB1A 2KE1A 4R8PK 4ZUXU 3U5OA 2CSVA 2QIZA 1WGMA 2MA6A 1RMDA 1VD4A 3O70A 2P57A 2EGMA 2HDPA 5FEYA 1T1HA 2C2LA 4A4CA 4S3OC 2KKXA 4FK5A 3FEHA 3MDBC 3RTRB 4F52B 4I7BA 5G04B 3KDEC 5FB0A 3SOXA 3C5KA 3HCUA 5SVXA 4MVTA 3M7KA 2CRWA 1X4JA 2VJFA 2XB1A 4YC9A 4IC2A 2YHNA 3T7LA 1K2FA 4GB0A 4A4BA 3DPLR 2I50A 5KH7A 1HYJA 2YHOA 4V3LC 2DJAA 2EXUA 2KWOA 2LV9A 5D1MB 2KWKA 2BAYA 3PLWA 4GNDA 5DKAA 3ZPV1 2IQJA 5D1LB 3T6RA 2JMIA 2CKLA 1CHCA 4UP5A 4YADA 5DINA 4LKAA 3HCTA 3O47A 3N9LA 3FJUB 2L0BA 2ZETC 2AN6A 4OGCA 2YSMA 2MIQA 3L11A 2ECJA 4IC3A 3T9KA 2E6SA 2FUUA 4CA1A 4OGEA 1ZBDB 3SHBA 2L7PA 3LQJA 2XOCA 2MA5A 3HCSA 3LJUX 3FL2A 3MHSA 4O64A 3QZVA 2H0DA 2LRIC 3H7HA 2YUCA 2LGGA 2DX8A 5H9MA 4UI9B 5J3XA 5LKUA 5TABA 2LGKA 3U5PA 3FAOA 4A0CD 2XOZA 1FBVA 2D8SA 2IDAA 2Y1MA 4LLBA 5AITA 5SVIB 1LDJB 2YT5A 3O33A 3LVQE 2KWJA 2C2VS 4WZ3B 2Y43A 2DSMA 3EB6A 2RR4A 4AUQB 1HYIA 5G05B 2VP7A 3I2DA 2VPDA 2YW8A 2LDRA 3SUBA 2YQLA 4YBTA 4ZQLA 3LVRE 2ECIA 4YAXA 2F6NA 1WEUA 5C11A 2KIZA 2D8UA 5B77A 2KWNA 4H9DA 1MBMA 4FO9A 1WEOA 3DQVR 1WEMA 2LN0A 1IYMA 4AP4A 4YABA 1JM7A 1DCQA 2ECNA 5D1KB 4WZ2A 3ASLA 1BORA 4W4UA 5KH9A 4AVXA 2E61A 3M62A 4GNFA 2KKYA 5LKXA 5C13A 4N3WA 3O34A 2JM3A 2KR4A 4YATA 1WE9A 2MT5A 2ECGA 2VJEA 3MHHA 2ECVA 2YURA 3ZPVE 5B8DA 4BHWA 1WEEA 3ZYQA 1VYXA 1V87A 2MD7B 5LKZA 2ECTA 4B86C 3N9OA 4YBMA 1MM2A 2LGVA 3N9NA 2MUMA 4QQ4A 2CONA 3SOWA 2KGIA 3SOUA 2YVRA 3ZVZB 4YBSA 1E4UA 2VNFA 5TDRA 4MSXA 4S3OB 2FUIA 3LQIA
chains in the Genus database with same CATH topology
4AYCA 5KH3A 2PUYA 2OXQC 3EB5A 1G25A 2VPGA 2LQ6A 2G43A 2CSYA 2CKLB 1WEWA 1Z6UA 2YSJA 2EODA 5EYAF 1WEVA 2XEUA 4PTBA 1X4IA 1WEQA 4R2YA 5AIUA 1WEPA 4L7XA 5G0FA 3LRQA 4LK9A 3PHDA 1N87A 2G45A 1Z60A 1MM3A 2VPEA 2JMJA 2JRJA 2H0DB 3C6WA 4GNGA 3ZTGA 3U5MA 4UP0A 4FJCA 3RPGB 2CT2A 3GL6A 3HTKC 5H1TA 4XI1A 5I3LA 1WFKA 2Y1NA 3KV5A 2PNXA 4CCGX 4C9ZA 2YQMA 4L58A 1JOCA 4QF2A 1DVPA 2L43A 1WENA 4N4FA 2QICA 3M63A 4GNEA 3L1ZB 3PURA 5B78A 2KYUA 2L5UA 2L75A 1X4UA 4Q6FA 3O36A 4NN2A 2RSDA 2KGGA 1Z2QA 5H1VA 2MNZA 4ZDTA 4V3KC 3IHPA 5TBNA 4LADB 2K17A 3M99A 4I7CA 1WILA 4P5OB 2E6RA 2M6MA 1JM7B 2K4DA 2K1JA 4TKPB 3PUQA 2VJFB 3U5NA 4WA6A 2YU4A 3LQHA 2HYED 1FP0A 2FSAA 2JMDA 3V43A 3N9QA 2NAAA 5LCWB 2LGLA 5B79A 2F6JA 1XWHA 2KREA 1VFYA 3KNVA 3RPGC 3ZNIA 1WESA 2EA6A 4A49A 1F62A 2VJEB 3GV4A 2KU3A 2KFTA 1LDKC 2RI7A 2YREA 3O37A 2M85A 3ZVYA 4WZ0A 2EGPA 2CSZA 4BBQA 5B76A 5FERA 2YYRA 2ECWA 3N9PA 4FIPA 3N9MA 3O35A 2G6QA 4PPEA 5H1UA 3O7AA 2VPBA 5TRBA 2MD8C 5LKTA 3KQIA 2M3HA 2MNYA 2M1RA 2QJ0A 2K16A 4R7EA 2F42A 3NG2A 4QF3A 2LXHC 4AYCB 4I7DA 3KV6A 4LJNA 2LXPC 3VK6A 5B75A 1U6GB 4X3GA 1WIMA 5JG6A 3L1XA 2UZGA 2L80A 4B7YC 5TDWA 5FB1A 2KE1A 4R8PK 4ZUXU 3U5OA 2QIZA 1WGMA 2MA6A 1RMDA 1VD4A 3O70A 2HDPA 5FEYA 1T1HA 2C2LA 4A4CA 4S3OC 4FK5A 3RTRB 4F52B 4I7BA 5G04B 5FB0A 3SOXA 3C5KA 3HCUA 4MVTA 1X4JA 2VJFA 2XB1A 4YC9A 4IC2A 2YHNA 3T7LA 1K2FA 4GB0A 4A4BA 3DPLR 2I50A 5KH7A 1HYJA 2YHOA 4V3LC 2KWOA 2LV9A 5D1MB 2KWKA 2BAYA 4GNDA 5DKAA 3ZPV1 5D1LB 3T6RA 2JMIA 2CKLA 1CHCA 4UP5A 4YADA 5DINA 4LKAA 3HCTA 3N9LA 2L0BA 2ZETC 2AN6A 2YSMA 2MIQA 3L11A 2ECJA 4IC3A 2E6SA 2FUUA 4CA1A 1ZBDB 3SHBA 3LQJA 2MA5A 3HCSA 3FL2A 3MHSA 4O64A 3QZVA 2H0DA 2LRIC 2YUCA 2LGGA 2DX8A 5H9MA 4UI9B 5J3XA 5LKUA 5TABA 2LGKA 3U5PA 4A0CD 1FBVA 2D8SA 2IDAA 2Y1MA 4LLBA 5AITA 1LDJB 2YT5A 3O33A 2KWJA 2C2VS 4WZ3B 2Y43A 3EB6A 4AUQB 1HYIA 5G05B 2VP7A 3I2DA 2VPDA 2YW8A 2LDRA 2YQLA 4YBTA 4ZQLA 2ECIA 4YAXA 2F6NA 1WEUA 5C11A 2KIZA 5B77A 2KWNA 4FO9A 1WEOA 3DQVR 1WEMA 2LN0A 1IYMA 4AP4A 4YABA 1JM7A 2ECNA 5D1KB 4WZ2A 3ASLA 1BORA 4W4UA 5KH9A 4AVXA 3M62A 4GNFA 5LKXA 5C13A 4N3WA 3O34A 2KR4A 4YATA 1WE9A 2MT5A 2ECGA 2VJEA 3MHHA 2ECVA 2YURA 3ZPVE 5B8DA 4BHWA 1WEEA 3ZYQA 1VYXA 1V87A 2MD7B 5LKZA 2ECTA 4B86C 3N9OA 4YBMA 1MM2A 2LGVA 3N9NA 2MUMA 3SOWA 2KGIA 3SOUA 3ZVZB 4YBSA 1E4UA 2VNFA 5TDRA 4MSXA 4S3OB 2FUIA 3LQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AYC A;  5KH3 A;  2PUY A;  2OXQ C;  3EB5 A;  1G25 A;  2VPG A;  2LQ6 A;  2G43 A;  2CSY A;  2CKL B;  1WEW A;  1Z6U A;  2YSJ A;  2EOD A;  5EYA F;  1WEV A;  2XEU A;  4PTB A;  1X4I A;  1WEQ A;  4R2Y A;  5AIU A;  1WEP A;  4L7X A;  5G0F A;  3LRQ A;  4LK9 A;  3PHD A;  1N87 A;  2G45 A;  1Z60 A;  1MM3 A;  2VPE A;  2JMJ A;  2JRJ A;  2H0D B;  3C6W A;  4GNG A;  3ZTG A;  3U5M A;  4UP0 A;  4FJC A;  3RPG B;  2CT2 A;  3GL6 A;  3HTK C;  5H1T A;  4XI1 A;  5I3L A;  1WFK A;  2Y1N A;  3KV5 A;  2PNX A;  4CCG X;  4C9Z A;  2YQM A;  4L58 A;  1JOC A;  4QF2 A;  1DVP A;  2L43 A;  1WEN A;  4N4F A;  2QIC A;  3M63 A;  4GNE A;  3L1Z B;  3PUR A;  5B78 A;  2KYU A;  2L5U A;  2L75 A;  1X4U A;  4Q6F A;  3O36 A;  4NN2 A;  2RSD A;  2KGG A;  1Z2Q A;  5H1V A;  2MNZ A;  4ZDT A;  4V3K C;  3IHP A;  5TBN A;  4LAD B;  2K17 A;  3M99 A;  4I7C A;  1WIL A;  4P5O B;  2E6R A;  2M6M A;  1JM7 B;  2K4D A;  2K1J A;  4TKP B;  3PUQ A;  2VJF B;  3U5N A;  4WA6 A;  2YU4 A;  3LQH A;  2HYE D;  1FP0 A;  2FSA A;  2JMD A;  3V43 A;  3N9Q A;  2NAA A;  5LCW B;  2LGL A;  5B79 A;  2F6J A;  1XWH A;  2KRE A;  1VFY A;  3KNV A;  3RPG C;  3ZNI A;  1WES A;  2EA6 A;  4A49 A;  1F62 A;  2VJE B;  3GV4 A;  2KU3 A;  2KFT A;  1LDK C;  2RI7 A;  2YRE A;  3O37 A;  2M85 A;  3ZVY A;  4WZ0 A;  2EGP A;  2CSZ A;  4BBQ A;  5B76 A;  5FER A;  2YYR A;  2ECW A;  3N9P A;  4FIP A;  3N9M A;  3O35 A;  2G6Q A;  4PPE A;  5H1U A;  3O7A A;  2VPB A;  5TRB A;  2MD8 C;  5LKT A;  3KQI A;  2M3H A;  2MNY A;  2M1R A;  2QJ0 A;  2K16 A;  4R7E A;  2F42 A;  3NG2 A;  4QF3 A;  2LXH C;  4AYC B;  4I7D A;  3KV6 A;  4LJN A;  2LXP C;  3VK6 A;  5B75 A;  1U6G B;  4X3G A;  1WIM A;  5JG6 A;  3L1X A;  2UZG A;  2L80 A;  4B7Y C;  5TDW A;  5FB1 A;  2KE1 A;  4R8P K;  4ZUX U;  3U5O A;  2QIZ A;  1WGM A;  2MA6 A;  1RMD A;  1VD4 A;  3O70 A;  2HDP A;  5FEY A;  1T1H A;  2C2L A;  4A4C A;  4S3O C;  4FK5 A;  3RTR B;  4F52 B;  4I7B A;  5G04 B;  5FB0 A;  3SOX A;  3C5K A;  3HCU A;  4MVT A;  1X4J A;  2VJF A;  2XB1 A;  4YC9 A;  4IC2 A;  2YHN A;  3T7L A;  1K2F A;  4GB0 A;  4A4B A;  3DPL R;  2I50 A;  5KH7 A;  1HYJ A;  2YHO A;  4V3L C;  2KWO A;  2LV9 A;  5D1M B;  2KWK A;  2BAY A;  4GND A;  5DKA A;  3ZPV 1;  5D1L B;  3T6R A;  2JMI A;  2CKL A;  1CHC A;  4UP5 A;  4YAD A;  5DIN A;  4LKA A;  3HCT A;  3N9L A;  2L0B A;  2ZET C;  2AN6 A;  2YSM A;  2MIQ A;  3L11 A;  2ECJ A;  4IC3 A;  2E6S A;  2FUU A;  4CA1 A;  1ZBD B;  3SHB A;  3LQJ A;  2MA5 A;  3HCS A;  3FL2 A;  3MHS A;  4O64 A;  3QZV A;  2H0D A;  2LRI C;  2YUC A;  2LGG A;  2DX8 A;  5H9M A;  4UI9 B;  5J3X A;  5LKU A;  5TAB A;  2LGK A;  3U5P A;  4A0C D;  1FBV A;  2D8S A;  2IDA A;  2Y1M A;  4LLB A;  5AIT A;  1LDJ B;  2YT5 A;  3O33 A;  2KWJ A;  2C2V S;  4WZ3 B;  2Y43 A;  3EB6 A;  4AUQ B;  1HYI A;  5G05 B;  2VP7 A;  3I2D A;  2VPD A;  2YW8 A;  2LDR A;  2YQL A;  4YBT A;  4ZQL A;  2ECI A;  4YAX A;  2F6N A;  1WEU A;  5C11 A;  2KIZ A;  5B77 A;  2KWN A;  4FO9 A;  1WEO A;  3DQV R;  1WEM A;  2LN0 A;  1IYM A;  4AP4 A;  4YAB A;  1JM7 A;  2ECN A;  5D1K B;  4WZ2 A;  3ASL A;  1BOR A;  4W4U A;  5KH9 A;  4AVX A;  3M62 A;  4GNF A;  5LKX A;  5C13 A;  4N3W A;  3O34 A;  2KR4 A;  4YAT A;  1WE9 A;  2MT5 A;  2ECG A;  2VJE A;  3MHH A;  2ECV A;  2YUR A;  3ZPV E;  5B8D A;  4BHW A;  1WEE A;  3ZYQ A;  1VYX A;  1V87 A;  2MD7 B;  5LKZ A;  2ECT A;  4B86 C;  3N9O A;  4YBM A;  1MM2 A;  2LGV A;  3N9N A;  2MUM A;  3SOW A;  2KGI A;  3SOU A;  3ZVZ B;  4YBS A;  1E4U A;  2VNF A;  5TDR A;  4MSX A;  4S3O B;  2FUI A;  3LQI A; 
#chains in the Genus database with same CATH topology
 4AYC A;  5KH3 A;  2PUY A;  2OXQ C;  3EB5 A;  1G25 A;  2VPG A;  2LQ6 A;  2G43 A;  2FD4 A;  2CSY A;  2CKL B;  2XOY A;  1WEW A;  1Z6U A;  2YSJ A;  2EOD A;  5EYA F;  1WEV A;  4Z0R A;  2XEU A;  4PTB A;  1X4I A;  1WEQ A;  2FFW A;  4R2Y A;  5AIU A;  4F1P A;  1WEP A;  2XP0 A;  4L7X A;  5G0F A;  3LRQ A;  4LK9 A;  3PHD A;  1N87 A;  2G45 A;  1Z60 A;  1MM3 A;  2VPE A;  2JMJ A;  3LDY A;  2JRJ A;  2JUN A;  2H0D B;  3C6W A;  4GNG A;  3ZTG A;  3U5M A;  4UP0 A;  4FJC A;  3RPG B;  2CT2 A;  3GL6 A;  3DWD A;  3HTK C;  5H1T A;  5K3Q A;  4XI1 A;  5I3L A;  3KV5 A;  1WFK A;  2Y1N A;  2PNX A;  4CCG X;  4C9Z A;  2YQM A;  4L58 A;  1JOC A;  4QF2 A;  2CRR A;  1DVP A;  3JUE A;  2L43 A;  1WEN A;  4N4F A;  2QIC A;  3M63 A;  3Q1D A;  4GNE A;  3L1Z B;  3FM8 C;  3PUR A;  5B78 A;  2KYU A;  2L5U A;  2L75 A;  1X4U A;  4Q6F A;  3O36 A;  4NN2 A;  2RSD A;  2KGG A;  1Z2Q A;  5H1V A;  2MNZ A;  4ZDT A;  4V3K C;  3IHP A;  5TBN A;  4LAD B;  2K17 A;  3M99 A;  4I7C A;  1WIL A;  4P5O B;  2E6R A;  2M6M A;  1JM7 B;  2K4D A;  2K1J A;  4TKP B;  5SVY A;  3PUQ A;  2VJF B;  3U5N A;  2LAU A;  4WA6 A;  3DDT A;  2YU4 A;  3LQH A;  4O62 A;  2HYE D;  1FP0 A;  2FSA A;  2JMD A;  3V43 A;  3N9Q A;  2NAA A;  5LCW B;  2LGL A;  5B79 A;  2F6J A;  3FAN A;  1XWH A;  2KRE A;  1VFY A;  3KNV A;  5SVI A;  3RPG C;  3ZNI A;  1WES A;  2EA6 A;  4A49 A;  1F62 A;  2VJE B;  3GV4 A;  2KU3 A;  2KFT A;  1LDK C;  2RI7 A;  2YRE A;  3O37 A;  2M85 A;  3ZVY A;  4WZ0 A;  2B0O E;  2EGP A;  2CSZ A;  4BBQ A;  5B76 A;  3E2D A;  5FER A;  2YYR A;  2ECW A;  3N9P A;  4FIP A;  3N9M A;  3O35 A;  2MKE A;  2G6Q A;  4PPE A;  5H1U A;  3O7A A;  2VPB A;  4Z0O A;  2M13 A;  5TRB A;  2MD8 C;  5LKT A;  3KQI A;  2M3H A;  2MNY A;  2M1R A;  2QJ0 A;  2K16 A;  4R7E A;  2F42 A;  3NG2 A;  4QF3 A;  2LXH C;  4AYC B;  4I7D A;  3KV6 A;  2OWA A;  4LJN A;  2LXP C;  3VK6 A;  5B75 A;  1U6G B;  4X3G A;  1WIM A;  5JG6 A;  3L1X A;  2UZG A;  2L80 A;  4B7Y C;  5TDW A;  5FB1 A;  2KE1 A;  4R8P K;  4ZUX U;  3U5O A;  2CSV A;  2QIZ A;  1WGM A;  2MA6 A;  1RMD A;  1VD4 A;  3O70 A;  2P57 A;  2EGM A;  2HDP A;  5FEY A;  1T1H A;  2C2L A;  4A4C A;  4S3O C;  2KKX A;  4FK5 A;  3FEH A;  3MDB C;  3RTR B;  4F52 B;  4I7B A;  5G04 B;  3KDE C;  5FB0 A;  3SOX A;  3C5K A;  3HCU A;  5SVX A;  4MVT A;  3M7K A;  2CRW A;  1X4J A;  2VJF A;  2XB1 A;  4YC9 A;  4IC2 A;  2YHN A;  3T7L A;  1K2F A;  4GB0 A;  4A4B A;  3DPL R;  2I50 A;  5KH7 A;  1HYJ A;  2YHO A;  4V3L C;  2DJA A;  2EXU A;  2KWO A;  2LV9 A;  5D1M B;  2KWK A;  2BAY A;  3PLW A;  4GND A;  5DKA A;  3ZPV 1;  2IQJ A;  5D1L B;  3T6R A;  2JMI A;  2CKL A;  1CHC A;  4UP5 A;  4YAD A;  5DIN A;  4LKA A;  3HCT A;  3O47 A;  3N9L A;  3FJU B;  2L0B A;  2ZET C;  2AN6 A;  4OGC A;  2YSM A;  2MIQ A;  3L11 A;  2ECJ A;  4IC3 A;  3T9K A;  2E6S A;  2FUU A;  4CA1 A;  4OGE A;  1ZBD B;  3SHB A;  2L7P A;  3LQJ A;  2XOC A;  2MA5 A;  3HCS A;  3LJU X;  3FL2 A;  3MHS A;  4O64 A;  3QZV A;  2H0D A;  2LRI C;  3H7H A;  2YUC A;  2LGG A;  2DX8 A;  5H9M A;  4UI9 B;  5J3X A;  5LKU A;  5TAB A;  2LGK A;  3U5P A;  3FAO A;  4A0C D;  2XOZ A;  1FBV A;  2D8S A;  2IDA A;  2Y1M A;  4LLB A;  5AIT A;  5SVI B;  1LDJ B;  2YT5 A;  3O33 A;  3LVQ E;  2KWJ A;  2C2V S;  4WZ3 B;  2Y43 A;  2DSM A;  3EB6 A;  2RR4 A;  4AUQ B;  1HYI A;  5G05 B;  2VP7 A;  3I2D A;  2VPD A;  2YW8 A;  2LDR A;  3SUB A;  2YQL A;  4YBT A;  4ZQL A;  3LVR E;  2ECI A;  4YAX A;  2F6N A;  1WEU A;  5C11 A;  2KIZ A;  2D8U A;  5B77 A;  2KWN A;  4H9D A;  1MBM A;  4FO9 A;  1WEO A;  3DQV R;  1WEM A;  2LN0 A;  1IYM A;  4AP4 A;  4YAB A;  1JM7 A;  1DCQ A;  2ECN A;  5D1K B;  4WZ2 A;  3ASL A;  1BOR A;  4W4U A;  5KH9 A;  4AVX A;  2E61 A;  3M62 A;  4GNF A;  2KKY A;  5LKX A;  5C13 A;  4N3W A;  3O34 A;  2JM3 A;  2KR4 A;  4YAT A;  1WE9 A;  2MT5 A;  2ECG A;  2VJE A;  3MHH A;  2ECV A;  2YUR A;  3ZPV E;  5B8D A;  4BHW A;  1WEE A;  3ZYQ A;  1VYX A;  1V87 A;  2MD7 B;  5LKZ A;  2ECT A;  4B86 C;  3N9O A;  4YBM A;  1MM2 A;  2LGV A;  3N9N A;  2MUM A;  4QQ4 A;  2CON A;  3SOW A;  2KGI A;  3SOU A;  2YVR A;  3ZVZ B;  4YBS A;  1E4U A;  2VNF A;  5TDR A;  4MSX A;  4S3O B;  2FUI A;  3LQI A; 
#chains in the Genus database with same CATH homology
 4AYC A;  5KH3 A;  2PUY A;  2OXQ C;  3EB5 A;  1G25 A;  2VPG A;  2LQ6 A;  2G43 A;  2CSY A;  2CKL B;  1WEW A;  1Z6U A;  2YSJ A;  2EOD A;  5EYA F;  1WEV A;  2XEU A;  4PTB A;  1X4I A;  1WEQ A;  4R2Y A;  5AIU A;  1WEP A;  4L7X A;  5G0F A;  3LRQ A;  4LK9 A;  3PHD A;  1N87 A;  2G45 A;  1Z60 A;  1MM3 A;  2VPE A;  2JMJ A;  2JRJ A;  2H0D B;  3C6W A;  4GNG A;  3ZTG A;  3U5M A;  4UP0 A;  4FJC A;  3RPG B;  2CT2 A;  3GL6 A;  3HTK C;  5H1T A;  4XI1 A;  5I3L A;  1WFK A;  2Y1N A;  3KV5 A;  2PNX A;  4CCG X;  4C9Z A;  2YQM A;  4L58 A;  1JOC A;  4QF2 A;  1DVP A;  2L43 A;  1WEN A;  4N4F A;  2QIC A;  3M63 A;  4GNE A;  3L1Z B;  3PUR A;  5B78 A;  2KYU A;  2L5U A;  2L75 A;  1X4U A;  4Q6F A;  3O36 A;  4NN2 A;  2RSD A;  2KGG A;  1Z2Q A;  5H1V A;  2MNZ A;  4ZDT A;  4V3K C;  3IHP A;  5TBN A;  4LAD B;  2K17 A;  3M99 A;  4I7C A;  1WIL A;  4P5O B;  2E6R A;  2M6M A;  1JM7 B;  2K4D A;  2K1J A;  4TKP B;  3PUQ A;  2VJF B;  3U5N A;  4WA6 A;  2YU4 A;  3LQH A;  2HYE D;  1FP0 A;  2FSA A;  2JMD A;  3V43 A;  3N9Q A;  2NAA A;  5LCW B;  2LGL A;  5B79 A;  2F6J A;  1XWH A;  2KRE A;  1VFY A;  3KNV A;  3RPG C;  3ZNI A;  1WES A;  2EA6 A;  4A49 A;  1F62 A;  2VJE B;  3GV4 A;  2KU3 A;  2KFT A;  1LDK C;  2RI7 A;  2YRE A;  3O37 A;  2M85 A;  3ZVY A;  4WZ0 A;  2EGP A;  2CSZ A;  4BBQ A;  5B76 A;  5FER A;  2YYR A;  2ECW A;  3N9P A;  4FIP A;  3N9M A;  3O35 A;  2G6Q A;  4PPE A;  5H1U A;  3O7A A;  2VPB A;  5TRB A;  2MD8 C;  5LKT A;  3KQI A;  2M3H A;  2MNY A;  2M1R A;  2QJ0 A;  2K16 A;  4R7E A;  2F42 A;  3NG2 A;  4QF3 A;  2LXH C;  4AYC B;  4I7D A;  3KV6 A;  4LJN A;  2LXP C;  3VK6 A;  5B75 A;  1U6G B;  4X3G A;  1WIM A;  5JG6 A;  3L1X A;  2UZG A;  2L80 A;  4B7Y C;  5TDW A;  5FB1 A;  2KE1 A;  4R8P K;  4ZUX U;  3U5O A;  2QIZ A;  1WGM A;  2MA6 A;  1RMD A;  1VD4 A;  3O70 A;  2HDP A;  5FEY A;  1T1H A;  2C2L A;  4A4C A;  4S3O C;  4FK5 A;  3RTR B;  4F52 B;  4I7B A;  5G04 B;  5FB0 A;  3SOX A;  3C5K A;  3HCU A;  4MVT A;  1X4J A;  2VJF A;  2XB1 A;  4YC9 A;  4IC2 A;  2YHN A;  3T7L A;  1K2F A;  4GB0 A;  4A4B A;  3DPL R;  2I50 A;  5KH7 A;  1HYJ A;  2YHO A;  4V3L C;  2KWO A;  2LV9 A;  5D1M B;  2KWK A;  2BAY A;  4GND A;  5DKA A;  3ZPV 1;  5D1L B;  3T6R A;  2JMI A;  2CKL A;  1CHC A;  4UP5 A;  4YAD A;  5DIN A;  4LKA A;  3HCT A;  3N9L A;  2L0B A;  2ZET C;  2AN6 A;  2YSM A;  2MIQ A;  3L11 A;  2ECJ A;  4IC3 A;  2E6S A;  2FUU A;  4CA1 A;  1ZBD B;  3SHB A;  3LQJ A;  2MA5 A;  3HCS A;  3FL2 A;  3MHS A;  4O64 A;  3QZV A;  2H0D A;  2LRI C;  2YUC A;  2LGG A;  2DX8 A;  5H9M A;  4UI9 B;  5J3X A;  5LKU A;  5TAB A;  2LGK A;  3U5P A;  4A0C D;  1FBV A;  2D8S A;  2IDA A;  2Y1M A;  4LLB A;  5AIT A;  1LDJ B;  2YT5 A;  3O33 A;  2KWJ A;  2C2V S;  4WZ3 B;  2Y43 A;  3EB6 A;  4AUQ B;  1HYI A;  5G05 B;  2VP7 A;  3I2D A;  2VPD A;  2YW8 A;  2LDR A;  2YQL A;  4YBT A;  4ZQL A;  2ECI A;  4YAX A;  2F6N A;  1WEU A;  5C11 A;  2KIZ A;  5B77 A;  2KWN A;  4FO9 A;  1WEO A;  3DQV R;  1WEM A;  2LN0 A;  1IYM A;  4AP4 A;  4YAB A;  1JM7 A;  2ECN A;  5D1K B;  4WZ2 A;  3ASL A;  1BOR A;  4W4U A;  5KH9 A;  4AVX A;  3M62 A;  4GNF A;  5LKX A;  5C13 A;  4N3W A;  3O34 A;  2KR4 A;  4YAT A;  1WE9 A;  2MT5 A;  2ECG A;  2VJE A;  3MHH A;  2ECV A;  2YUR A;  3ZPV E;  5B8D A;  4BHW A;  1WEE A;  3ZYQ A;  1VYX A;  1V87 A;  2MD7 B;  5LKZ A;  2ECT A;  4B86 C;  3N9O A;  4YBM A;  1MM2 A;  2LGV A;  3N9N A;  2MUM A;  3SOW A;  2KGI A;  3SOU A;  3ZVZ B;  4YBS A;  1E4U A;  2VNF A;  5TDR A;  4MSX A;  4S3O B;  2FUI A;  3LQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...