5KH7A

Crystal structure of fragment (3-[6-oxo-3-(3-pyridinyl)-1(6h)-pyridazinyl]propanoic acid) bound in the ubiquitin binding pocket of the hdac6 zinc-finger domain
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
100
structure length
100
Chain Sequence
PLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKNIAHQNKFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Small Molecule Antagonists of the Interaction between the Histone Deacetylase 6 Zinc-Finger Domain and Ubiquitin.
pubmed doi rcsb
molecule keywords Histone deacetylase 6
molecule tags Hydrolase
source organism Homo sapiens
total genus 30
structure length 100
sequence length 100
ec nomenclature ec 3.5.1.98: Histone deacetylase.
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5kh7A00
5G05B 1WFKA 4ZQLA 2YU4A 4YC9A 2LXPC 3PHDA 2C2LA 4A49A 5LCWB 3EB5A 1VFYA 2KGIA 1Z60A 1CHCA 2H0DA 2MNYA 3HCTA 5DKAA 3HCUA 2KU3A 3M62A 2VJEA 2M85A 2L5UA 2JRJA 4X3GA 1K2FA 2ECJA 3N9MA 2LRIC 5KH3A 4YATA 2UZGA 2CSYA 4R2YA 3PURA 5H1UA 2JMJA 1N87A 3NG2A 2L75A 5TBNA 4YAXA 4LJNA 2RI7A 4BHWA 1WEPA 5AIUA 4N3WA 1LDJB 2QICA 3DPLR 2HDPA 2LN0A 2G45A 1WENA 4C9ZA 4UP5A 2CT2A 5B77A 4O64A 3RTRB 2VPGA 2FSAA 3IHPA 4L58A 4A4BA 4WA6A 3LQJA 4ZUXU 3U5MA 5TDWA 1Z2QA 1WEUA 2F42A 2KWNA 4YBTA 3RPGC 3L1ZB 4AP4A 1JM7B 2JMIA 4V3LC 4B7YC 3DQVR 5I3LA 2KIZA 2LGGA 2YW8A 5H1TA 1BORA 1F62A 5G04B 2FUIA 4MSXA 2EA6A 2C2VS 2E6RA 3O7AA 4QF2A 5TABA 2KYUA 2VNFA 4YADA 3ZNIA 1T1HA 3N9OA 2LGKA 2LDRA 2M3HA 4WZ2A 3O35A 4NN2A 4XI1A 2MD7B 5TDRA 2MNZA 2YHOA 1WEVA 4AYCB 2NAAA 2L43A 3ZVYA 4IC3A 2ECNA 2KWJA 4GNDA 3O70A 3HCSA 5FB1A 1VD4A 3U5PA 3LQIA 4GNEA 3KV6A 4Q6FA 5G0FA 2ECTA 2CKLB 1WILA 1FP0A 1X4JA 2MT5A 2QJ0A 2JMDA 5FERA 5C11A 3LQHA 5JG6A 2HYED 3O37A 2QIZA 4I7CA 3ZPVE 2VJFB 3EB6A 1WEWA 2ECIA 2MUMA 5LKZA 5D1LB 1XWHA 4GB0A 3PUQA 4YBMA 4WZ3B 1HYJA 1V87A 1E4UA 4W4UA 5AITA 2XEUA 4S3OB 4GNGA 4ZDTA 2DX8A 2E6SA 5KH7A 3O36A 1JOCA 1WEEA 4LLBA 2ZETC 1MM2A 2YSJA 3LRQA 2IDAA 5DINA 2VJFA 5B8DA 3U5OA 2L80A 3GL6A 2ECGA 2YURA 2MIQA 2LV9A 4N4FA 1WEOA 4A0CD 5B78A 4CA1A 4LK9A 2YT5A 3N9LA 2AN6A 3FL2A 2M1RA 4FO9A 3MHHA 3ASLA 3M63A 5B79A 4AUQB 4FK5A 4UI9B 2F6JA 3L1XA 3ZYQA 3C6WA 4PPEA 3HTKC 2KWKA 4UP0A 1HYIA 3N9QA 2KFTA 1DVPA 1LDKC 5C13A 2G6QA 1WEMA 5LKTA 2L0BA 3KNVA 3C5KA 4I7BA 1JM7A 3M99A 2H0DB 3V43A 5FEYA 2VPBA 2OXQC 5H1VA 2VJEB 2VPEA 2YUCA 2K17A 1IYMA 2PUYA 4WZ0A 2XB1A 2PNXA 1Z6UA 2LGVA 2VPDA 4B86C 5D1KB 2LGLA 2MD8C 1FBVA 4BBQA 2EODA 1G25A 4AYCA 2LQ6A 1RMDA 2KR4A 4R8PK 5B75A 1U6GB 4AVXA 2ECVA 3SOUA 2MA5A 4R7EA 2EGPA 4FIPA 5J3XA 2VP7A 4CCGX 2LXHC 3O33A 4PTBA 2CKLA 4TKPB 3T7LA 5LKUA 2KWOA 2YYRA 1WESA 4S3OC 4I7DA 2Y1NA 2ECWA 2YREA 2D8SA 2M6MA 2KGGA 1WE9A 3I2DA 5TRBA 5H9MA 5KH9A 2K16A 2RSDA 4V3KC 3QZVA 3T6RA 3KQIA 1X4IA 4YBSA 3N9PA 5B76A 2KE1A 1MM3A 3SHBA 2I50A 5LKXA 3RPGB 3ZVZB 1VYXA 1ZBDB 4MVTA 1WEQA 5FB0A 2FUUA 5D1MB 1X4UA 4P5OB 3MHSA 2Y43A 2G43A 4LKAA 2K1JA 1WGMA 3KV5A 4F52B 3VK6A 3GV4A 3ZPV1 2MA6A 4YABA 4GNFA 4L7XA 3N9NA 5EYAF 1WIMA 2K4DA 2KREA 4QF3A 2CSZA 4A4CA 2YQLA 3SOWA 3L11A 3SOXA 3U5NA 2Y1MA 3O34A 4IC2A 2F6NA 4LADB 2YSMA 2BAYA 2YQMA 4FJCA 2YHNA 3ZTGA
chains in the Genus database with same CATH superfamily
2FFWA 5G05B 1WFKA 4ZQLA 2YU4A 4YC9A 2LXPC 3PHDA 2C2LA 4A49A 5LCWB 3EB5A 1VFYA 2KGIA 1Z60A 2CRWA 2KKYA 1CHCA 2H0DA 2MNYA 3HCTA 5DKAA 3HCUA 2KU3A 3T9KA 3M62A 3DDTA 3JUEA 2VJEA 3FJUB 5SVIA 2M85A 2L5UA 2JRJA 4X3GA 1K2FA 2ECJA 2DSMA 3N9MA 2LRIC 2YVRA 5KH3A 4YATA 2UZGA 2CSYA 4R2YA 2JUNA 3PURA 5H1UA 2JMJA 1N87A 3NG2A 2L75A 5TBNA 4YAXA 4LJNA 2RI7A 4BHWA 1WEPA 5AIUA 4N3WA 2B0OE 2JM3A 1LDJB 2QICA 3PLWA 3DPLR 2HDPA 2LN0A 2M13A 2G45A 1WENA 4C9ZA 4UP5A 2CT2A 5B77A 4O64A 3RTRB 2VPGA 5SVXA 3KDEC 2FSAA 3FAOA 3IHPA 4L58A 4A4BA 4WA6A 3LQJA 2CRRA 4ZUXU 3U5MA 5TDWA 1Z2QA 1WEUA 2F42A 2KWNA 4YBTA 3RPGC 3SUBA 3L1ZB 4AP4A 1JM7B 2JMIA 4V3LC 4B7YC 3DQVR 5I3LA 2KIZA 2LGGA 2YW8A 5H1TA 3M7KA 1BORA 1F62A 4Z0RA 5G04B 2D8UA 2FUIA 2MKEA 4MSXA 2EA6A 2C2VS 2E6RA 3O7AA 4QF2A 5TABA 2KYUA 2VNFA 4O62A 4YADA 2OWAA 4QQ4A 3ZNIA 1T1HA 3N9OA 2LGKA 2LDRA 2E61A 2M3HA 4WZ2A 3O35A 4NN2A 4XI1A 2MD7B 5TDRA 2MNZA 2YHOA 1WEVA 5SVYA 4AYCB 2NAAA 2L43A 3ZVYA 4IC3A 2ECNA 3DWDA 2KWJA 4GNDA 3MDBC 3O70A 3HCSA 5FB1A 1VD4A 3U5PA 3LQIA 4GNEA 3KV6A 4Q6FA 5G0FA 2ECTA 2CKLB 1WILA 1FP0A 1X4JA 2MT5A 2QJ0A 3O47A 2XOYA 3LJUX 2JMDA 5FERA 5C11A 3LQHA 5JG6A 2HYED 3O37A 3H7HA 2QIZA 4I7CA 3ZPVE 2VJFB 2EXUA 3EB6A 1WEWA 2ECIA 2MUMA 5LKZA 5D1LB 1XWHA 4H9DA 4GB0A 3PUQA 4YBMA 4WZ3B 2RR4A 1HYJA 1V87A 1E4UA 3LVRE 4W4UA 5AITA 2XEUA 4S3OB 4GNGA 4ZDTA 2DX8A 2E6SA 5KH7A 3O36A 1JOCA 2DJAA 2FD4A 1WEEA 4LLBA 2ZETC 1MM2A 2YSJA 3LRQA 2IDAA 5DINA 2VJFA 5B8DA 3U5OA 2L80A 3GL6A 2ECGA 2YURA 2MIQA 5K3QA 2LV9A 4N4FA 1WEOA 4A0CD 5B78A 4CA1A 4LK9A 2YT5A 3N9LA 2AN6A 3FL2A 2M1RA 4FO9A 3MHHA 3ASLA 3M63A 3E2DA 5B79A 4AUQB 4FK5A 4UI9B 2F6JA 3L1XA 3ZYQA 3C6WA 4PPEA 3HTKC 2KWKA 1MBMA 4UP0A 1HYIA 2KKXA 3N9QA 2KFTA 1DVPA 4F1PA 1LDKC 5C13A 2G6QA 2XP0A 1WEMA 5LKTA 2L0BA 3KNVA 3C5KA 4I7BA 1JM7A 3M99A 2H0DB 3V43A 5FEYA 2VPBA 2OXQC 5H1VA 3LDYA 2VJEB 2VPEA 2YUCA 2K17A 1IYMA 2PUYA 4WZ0A 2XB1A 2PNXA 1Z6UA 2LGVA 2VPDA 4B86C 5D1KB 3LVQE 2LGLA 2MD8C 1FBVA 4BBQA 2EODA 1G25A 4AYCA 2LQ6A 1RMDA 2KR4A 4R8PK 5B75A 1U6GB 4AVXA 2ECVA 3SOUA 2MA5A 4R7EA 2EGPA 4FIPA 5J3XA 2VP7A 4CCGX 2LXHC 3O33A 2P57A 4PTBA 2CKLA 4TKPB 3T7LA 5LKUA 2KWOA 2YYRA 3FM8C 1WESA 4S3OC 4I7DA 2Y1NA 2ECWA 2YREA 2L7PA 2D8SA 2M6MA 2KGGA 1WE9A 3I2DA 5TRBA 5H9MA 5KH9A 2K16A 2RSDA 4V3KC 3QZVA 3T6RA 3KQIA 1X4IA 4YBSA 4Z0OA 4OGCA 3N9PA 5B76A 3Q1DA 2KE1A 1MM3A 3SHBA 2I50A 5LKXA 3RPGB 3ZVZB 1VYXA 1ZBDB 4MVTA 1WEQA 5FB0A 3FANA 2EGMA 2FUUA 5D1MB 1X4UA 4P5OB 3MHSA 2Y43A 4OGEA 2G43A 2IQJA 2LAUA 4LKAA 2K1JA 1WGMA 3KV5A 2CSVA 2XOZA 4F52B 2XOCA 1DCQA 3VK6A 3GV4A 3ZPV1 2MA6A 4YABA 3FEHA 4GNFA 4L7XA 3N9NA 5EYAF 1WIMA 2K4DA 2KREA 4QF3A 2CSZA 5SVIB 4A4CA 2YQLA 3SOWA 3L11A 3SOXA 3U5NA 2Y1MA 3O34A 4IC2A 2F6NA 4LADB 2CONA 2YSMA 2BAYA 2YQMA 4FJCA 2YHNA 3ZTGA
chains in the Genus database with same CATH topology
5G05B 1WFKA 4ZQLA 2YU4A 4YC9A 2LXPC 3PHDA 2C2LA 4A49A 5LCWB 3EB5A 1VFYA 2KGIA 1Z60A 1CHCA 2H0DA 2MNYA 3HCTA 5DKAA 3HCUA 2KU3A 3M62A 2VJEA 2M85A 2L5UA 2JRJA 4X3GA 1K2FA 2ECJA 3N9MA 2LRIC 5KH3A 4YATA 2UZGA 2CSYA 4R2YA 3PURA 5H1UA 2JMJA 1N87A 3NG2A 2L75A 5TBNA 4YAXA 4LJNA 2RI7A 4BHWA 1WEPA 5AIUA 4N3WA 1LDJB 2QICA 3DPLR 2HDPA 2LN0A 2G45A 1WENA 4C9ZA 4UP5A 2CT2A 5B77A 4O64A 3RTRB 2VPGA 2FSAA 3IHPA 4L58A 4A4BA 4WA6A 3LQJA 4ZUXU 3U5MA 5TDWA 1Z2QA 1WEUA 2F42A 2KWNA 4YBTA 3RPGC 3L1ZB 4AP4A 1JM7B 2JMIA 4V3LC 4B7YC 3DQVR 5I3LA 2KIZA 2LGGA 2YW8A 5H1TA 1BORA 1F62A 5G04B 2FUIA 4MSXA 2EA6A 2C2VS 2E6RA 3O7AA 4QF2A 5TABA 2KYUA 2VNFA 4YADA 3ZNIA 1T1HA 3N9OA 2LGKA 2LDRA 2M3HA 4WZ2A 3O35A 4NN2A 4XI1A 2MD7B 5TDRA 2MNZA 2YHOA 1WEVA 4AYCB 2NAAA 2L43A 3ZVYA 4IC3A 2ECNA 2KWJA 4GNDA 3O70A 3HCSA 5FB1A 1VD4A 3U5PA 3LQIA 4GNEA 3KV6A 4Q6FA 5G0FA 2ECTA 2CKLB 1WILA 1FP0A 1X4JA 2MT5A 2QJ0A 2JMDA 5FERA 5C11A 3LQHA 5JG6A 2HYED 3O37A 2QIZA 4I7CA 3ZPVE 2VJFB 3EB6A 1WEWA 2ECIA 2MUMA 5LKZA 5D1LB 1XWHA 4GB0A 3PUQA 4YBMA 4WZ3B 1HYJA 1V87A 1E4UA 4W4UA 5AITA 2XEUA 4S3OB 4GNGA 4ZDTA 2DX8A 2E6SA 5KH7A 3O36A 1JOCA 1WEEA 4LLBA 2ZETC 1MM2A 2YSJA 3LRQA 2IDAA 5DINA 2VJFA 5B8DA 3U5OA 2L80A 3GL6A 2ECGA 2YURA 2MIQA 2LV9A 4N4FA 1WEOA 4A0CD 5B78A 4CA1A 4LK9A 2YT5A 3N9LA 2AN6A 3FL2A 2M1RA 4FO9A 3MHHA 3ASLA 3M63A 5B79A 4AUQB 4FK5A 4UI9B 2F6JA 3L1XA 3ZYQA 3C6WA 4PPEA 3HTKC 2KWKA 4UP0A 1HYIA 3N9QA 2KFTA 1DVPA 1LDKC 5C13A 2G6QA 1WEMA 5LKTA 2L0BA 3KNVA 3C5KA 4I7BA 1JM7A 3M99A 2H0DB 3V43A 5FEYA 2VPBA 2OXQC 5H1VA 2VJEB 2VPEA 2YUCA 2K17A 1IYMA 2PUYA 4WZ0A 2XB1A 2PNXA 1Z6UA 2LGVA 2VPDA 4B86C 5D1KB 2LGLA 2MD8C 1FBVA 4BBQA 2EODA 1G25A 4AYCA 2LQ6A 1RMDA 2KR4A 4R8PK 5B75A 1U6GB 4AVXA 2ECVA 3SOUA 2MA5A 4R7EA 2EGPA 4FIPA 5J3XA 2VP7A 4CCGX 2LXHC 3O33A 4PTBA 2CKLA 4TKPB 3T7LA 5LKUA 2KWOA 2YYRA 1WESA 4S3OC 4I7DA 2Y1NA 2ECWA 2YREA 2D8SA 2M6MA 2KGGA 1WE9A 3I2DA 5TRBA 5H9MA 5KH9A 2K16A 2RSDA 4V3KC 3QZVA 3T6RA 3KQIA 1X4IA 4YBSA 3N9PA 5B76A 2KE1A 1MM3A 3SHBA 2I50A 5LKXA 3RPGB 3ZVZB 1VYXA 1ZBDB 4MVTA 1WEQA 5FB0A 2FUUA 5D1MB 1X4UA 4P5OB 3MHSA 2Y43A 2G43A 4LKAA 2K1JA 1WGMA 3KV5A 4F52B 3VK6A 3GV4A 3ZPV1 2MA6A 4YABA 4GNFA 4L7XA 3N9NA 5EYAF 1WIMA 2K4DA 2KREA 4QF3A 2CSZA 4A4CA 2YQLA 3SOWA 3L11A 3SOXA 3U5NA 2Y1MA 3O34A 4IC2A 2F6NA 4LADB 2YSMA 2BAYA 2YQMA 4FJCA 2YHNA 3ZTGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G05 B;  1WFK A;  4ZQL A;  2YU4 A;  4YC9 A;  2LXP C;  3PHD A;  2C2L A;  4A49 A;  5LCW B;  3EB5 A;  1VFY A;  2KGI A;  1Z60 A;  1CHC A;  2H0D A;  2MNY A;  3HCT A;  5DKA A;  3HCU A;  2KU3 A;  3M62 A;  2VJE A;  2M85 A;  2L5U A;  2JRJ A;  4X3G A;  1K2F A;  2ECJ A;  3N9M A;  2LRI C;  5KH3 A;  4YAT A;  2UZG A;  2CSY A;  4R2Y A;  3PUR A;  5H1U A;  2JMJ A;  1N87 A;  3NG2 A;  2L75 A;  5TBN A;  4YAX A;  4LJN A;  2RI7 A;  4BHW A;  1WEP A;  5AIU A;  4N3W A;  1LDJ B;  2QIC A;  3DPL R;  2HDP A;  2LN0 A;  2G45 A;  1WEN A;  4C9Z A;  4UP5 A;  2CT2 A;  5B77 A;  4O64 A;  3RTR B;  2VPG A;  2FSA A;  3IHP A;  4L58 A;  4A4B A;  4WA6 A;  3LQJ A;  4ZUX U;  3U5M A;  5TDW A;  1Z2Q A;  1WEU A;  2F42 A;  2KWN A;  4YBT A;  3RPG C;  3L1Z B;  4AP4 A;  1JM7 B;  2JMI A;  4V3L C;  4B7Y C;  3DQV R;  5I3L A;  2KIZ A;  2LGG A;  2YW8 A;  5H1T A;  1BOR A;  1F62 A;  5G04 B;  2FUI A;  4MSX A;  2EA6 A;  2C2V S;  2E6R A;  3O7A A;  4QF2 A;  5TAB A;  2KYU A;  2VNF A;  4YAD A;  3ZNI A;  1T1H A;  3N9O A;  2LGK A;  2LDR A;  2M3H A;  4WZ2 A;  3O35 A;  4NN2 A;  4XI1 A;  2MD7 B;  5TDR A;  2MNZ A;  2YHO A;  1WEV A;  4AYC B;  2NAA A;  2L43 A;  3ZVY A;  4IC3 A;  2ECN A;  2KWJ A;  4GND A;  3O70 A;  3HCS A;  5FB1 A;  1VD4 A;  3U5P A;  3LQI A;  4GNE A;  3KV6 A;  4Q6F A;  5G0F A;  2ECT A;  2CKL B;  1WIL A;  1FP0 A;  1X4J A;  2MT5 A;  2QJ0 A;  2JMD A;  5FER A;  5C11 A;  3LQH A;  5JG6 A;  2HYE D;  3O37 A;  2QIZ A;  4I7C A;  3ZPV E;  2VJF B;  3EB6 A;  1WEW A;  2ECI A;  2MUM A;  5LKZ A;  5D1L B;  1XWH A;  4GB0 A;  3PUQ A;  4YBM A;  4WZ3 B;  1HYJ A;  1V87 A;  1E4U A;  4W4U A;  5AIT A;  2XEU A;  4S3O B;  4GNG A;  4ZDT A;  2DX8 A;  2E6S A;  5KH7 A;  3O36 A;  1JOC A;  1WEE A;  4LLB A;  2ZET C;  1MM2 A;  2YSJ A;  3LRQ A;  2IDA A;  5DIN A;  2VJF A;  5B8D A;  3U5O A;  2L80 A;  3GL6 A;  2ECG A;  2YUR A;  2MIQ A;  2LV9 A;  4N4F A;  1WEO A;  4A0C D;  5B78 A;  4CA1 A;  4LK9 A;  2YT5 A;  3N9L A;  2AN6 A;  3FL2 A;  2M1R A;  4FO9 A;  3MHH A;  3ASL A;  3M63 A;  5B79 A;  4AUQ B;  4FK5 A;  4UI9 B;  2F6J A;  3L1X A;  3ZYQ A;  3C6W A;  4PPE A;  3HTK C;  2KWK A;  4UP0 A;  1HYI A;  3N9Q A;  2KFT A;  1DVP A;  1LDK C;  5C13 A;  2G6Q A;  1WEM A;  5LKT A;  2L0B A;  3KNV A;  3C5K A;  4I7B A;  1JM7 A;  3M99 A;  2H0D B;  3V43 A;  5FEY A;  2VPB A;  2OXQ C;  5H1V A;  2VJE B;  2VPE A;  2YUC A;  2K17 A;  1IYM A;  2PUY A;  4WZ0 A;  2XB1 A;  2PNX A;  1Z6U A;  2LGV A;  2VPD A;  4B86 C;  5D1K B;  2LGL A;  2MD8 C;  1FBV A;  4BBQ A;  2EOD A;  1G25 A;  4AYC A;  2LQ6 A;  1RMD A;  2KR4 A;  4R8P K;  5B75 A;  1U6G B;  4AVX A;  2ECV A;  3SOU A;  2MA5 A;  4R7E A;  2EGP A;  4FIP A;  5J3X A;  2VP7 A;  4CCG X;  2LXH C;  3O33 A;  4PTB A;  2CKL A;  4TKP B;  3T7L A;  5LKU A;  2KWO A;  2YYR A;  1WES A;  4S3O C;  4I7D A;  2Y1N A;  2ECW A;  2YRE A;  2D8S A;  2M6M A;  2KGG A;  1WE9 A;  3I2D A;  5TRB A;  5H9M A;  5KH9 A;  2K16 A;  2RSD A;  4V3K C;  3QZV A;  3T6R A;  3KQI A;  1X4I A;  4YBS A;  3N9P A;  5B76 A;  2KE1 A;  1MM3 A;  3SHB A;  2I50 A;  5LKX A;  3RPG B;  3ZVZ B;  1VYX A;  1ZBD B;  4MVT A;  1WEQ A;  5FB0 A;  2FUU A;  5D1M B;  1X4U A;  4P5O B;  3MHS A;  2Y43 A;  2G43 A;  4LKA A;  2K1J A;  1WGM A;  3KV5 A;  4F52 B;  3VK6 A;  3GV4 A;  3ZPV 1;  2MA6 A;  4YAB A;  4GNF A;  4L7X A;  3N9N A;  5EYA F;  1WIM A;  2K4D A;  2KRE A;  4QF3 A;  2CSZ A;  4A4C A;  2YQL A;  3SOW A;  3L11 A;  3SOX A;  3U5N A;  2Y1M A;  3O34 A;  4IC2 A;  2F6N A;  4LAD B;  2YSM A;  2BAY A;  2YQM A;  4FJC A;  2YHN A;  3ZTG A; 
#chains in the Genus database with same CATH topology
 2FFW A;  5G05 B;  1WFK A;  4ZQL A;  2YU4 A;  4YC9 A;  2LXP C;  3PHD A;  2C2L A;  4A49 A;  5LCW B;  3EB5 A;  1VFY A;  2KGI A;  1Z60 A;  2CRW A;  2KKY A;  1CHC A;  2H0D A;  2MNY A;  3HCT A;  5DKA A;  3HCU A;  2KU3 A;  3T9K A;  3M62 A;  3DDT A;  3JUE A;  2VJE A;  3FJU B;  5SVI A;  2M85 A;  2L5U A;  2JRJ A;  4X3G A;  1K2F A;  2ECJ A;  2DSM A;  3N9M A;  2LRI C;  2YVR A;  5KH3 A;  4YAT A;  2UZG A;  2CSY A;  4R2Y A;  2JUN A;  3PUR A;  5H1U A;  2JMJ A;  1N87 A;  3NG2 A;  2L75 A;  5TBN A;  4YAX A;  4LJN A;  2RI7 A;  4BHW A;  1WEP A;  5AIU A;  4N3W A;  2B0O E;  2JM3 A;  1LDJ B;  2QIC A;  3PLW A;  3DPL R;  2HDP A;  2LN0 A;  2M13 A;  2G45 A;  1WEN A;  4C9Z A;  4UP5 A;  2CT2 A;  5B77 A;  4O64 A;  3RTR B;  2VPG A;  5SVX A;  3KDE C;  2FSA A;  3FAO A;  3IHP A;  4L58 A;  4A4B A;  4WA6 A;  3LQJ A;  2CRR A;  4ZUX U;  3U5M A;  5TDW A;  1Z2Q A;  1WEU A;  2F42 A;  2KWN A;  4YBT A;  3RPG C;  3SUB A;  3L1Z B;  4AP4 A;  1JM7 B;  2JMI A;  4V3L C;  4B7Y C;  3DQV R;  5I3L A;  2KIZ A;  2LGG A;  2YW8 A;  5H1T A;  3M7K A;  1BOR A;  1F62 A;  4Z0R A;  5G04 B;  2D8U A;  2FUI A;  2MKE A;  4MSX A;  2EA6 A;  2C2V S;  2E6R A;  3O7A A;  4QF2 A;  5TAB A;  2KYU A;  2VNF A;  4O62 A;  4YAD A;  2OWA A;  4QQ4 A;  3ZNI A;  1T1H A;  3N9O A;  2LGK A;  2LDR A;  2E61 A;  2M3H A;  4WZ2 A;  3O35 A;  4NN2 A;  4XI1 A;  2MD7 B;  5TDR A;  2MNZ A;  2YHO A;  1WEV A;  5SVY A;  4AYC B;  2NAA A;  2L43 A;  3ZVY A;  4IC3 A;  2ECN A;  3DWD A;  2KWJ A;  4GND A;  3MDB C;  3O70 A;  3HCS A;  5FB1 A;  1VD4 A;  3U5P A;  3LQI A;  4GNE A;  3KV6 A;  4Q6F A;  5G0F A;  2ECT A;  2CKL B;  1WIL A;  1FP0 A;  1X4J A;  2MT5 A;  2QJ0 A;  3O47 A;  2XOY A;  3LJU X;  2JMD A;  5FER A;  5C11 A;  3LQH A;  5JG6 A;  2HYE D;  3O37 A;  3H7H A;  2QIZ A;  4I7C A;  3ZPV E;  2VJF B;  2EXU A;  3EB6 A;  1WEW A;  2ECI A;  2MUM A;  5LKZ A;  5D1L B;  1XWH A;  4H9D A;  4GB0 A;  3PUQ A;  4YBM A;  4WZ3 B;  2RR4 A;  1HYJ A;  1V87 A;  1E4U A;  3LVR E;  4W4U A;  5AIT A;  2XEU A;  4S3O B;  4GNG A;  4ZDT A;  2DX8 A;  2E6S A;  5KH7 A;  3O36 A;  1JOC A;  2DJA A;  2FD4 A;  1WEE A;  4LLB A;  2ZET C;  1MM2 A;  2YSJ A;  3LRQ A;  2IDA A;  5DIN A;  2VJF A;  5B8D A;  3U5O A;  2L80 A;  3GL6 A;  2ECG A;  2YUR A;  2MIQ A;  5K3Q A;  2LV9 A;  4N4F A;  1WEO A;  4A0C D;  5B78 A;  4CA1 A;  4LK9 A;  2YT5 A;  3N9L A;  2AN6 A;  3FL2 A;  2M1R A;  4FO9 A;  3MHH A;  3ASL A;  3M63 A;  3E2D A;  5B79 A;  4AUQ B;  4FK5 A;  4UI9 B;  2F6J A;  3L1X A;  3ZYQ A;  3C6W A;  4PPE A;  3HTK C;  2KWK A;  1MBM A;  4UP0 A;  1HYI A;  2KKX A;  3N9Q A;  2KFT A;  1DVP A;  4F1P A;  1LDK C;  5C13 A;  2G6Q A;  2XP0 A;  1WEM A;  5LKT A;  2L0B A;  3KNV A;  3C5K A;  4I7B A;  1JM7 A;  3M99 A;  2H0D B;  3V43 A;  5FEY A;  2VPB A;  2OXQ C;  5H1V A;  3LDY A;  2VJE B;  2VPE A;  2YUC A;  2K17 A;  1IYM A;  2PUY A;  4WZ0 A;  2XB1 A;  2PNX A;  1Z6U A;  2LGV A;  2VPD A;  4B86 C;  5D1K B;  3LVQ E;  2LGL A;  2MD8 C;  1FBV A;  4BBQ A;  2EOD A;  1G25 A;  4AYC A;  2LQ6 A;  1RMD A;  2KR4 A;  4R8P K;  5B75 A;  1U6G B;  4AVX A;  2ECV A;  3SOU A;  2MA5 A;  4R7E A;  2EGP A;  4FIP A;  5J3X A;  2VP7 A;  4CCG X;  2LXH C;  3O33 A;  2P57 A;  4PTB A;  2CKL A;  4TKP B;  3T7L A;  5LKU A;  2KWO A;  2YYR A;  3FM8 C;  1WES A;  4S3O C;  4I7D A;  2Y1N A;  2ECW A;  2YRE A;  2L7P A;  2D8S A;  2M6M A;  2KGG A;  1WE9 A;  3I2D A;  5TRB A;  5H9M A;  5KH9 A;  2K16 A;  2RSD A;  4V3K C;  3QZV A;  3T6R A;  3KQI A;  1X4I A;  4YBS A;  4Z0O A;  4OGC A;  3N9P A;  5B76 A;  3Q1D A;  2KE1 A;  1MM3 A;  3SHB A;  2I50 A;  5LKX A;  3RPG B;  3ZVZ B;  1VYX A;  1ZBD B;  4MVT A;  1WEQ A;  5FB0 A;  3FAN A;  2EGM A;  2FUU A;  5D1M B;  1X4U A;  4P5O B;  3MHS A;  2Y43 A;  4OGE A;  2G43 A;  2IQJ A;  2LAU A;  4LKA A;  2K1J A;  1WGM A;  3KV5 A;  2CSV A;  2XOZ A;  4F52 B;  2XOC A;  1DCQ A;  3VK6 A;  3GV4 A;  3ZPV 1;  2MA6 A;  4YAB A;  3FEH A;  4GNF A;  4L7X A;  3N9N A;  5EYA F;  1WIM A;  2K4D A;  2KRE A;  4QF3 A;  2CSZ A;  5SVI B;  4A4C A;  2YQL A;  3SOW A;  3L11 A;  3SOX A;  3U5N A;  2Y1M A;  3O34 A;  4IC2 A;  2F6N A;  4LAD B;  2CON A;  2YSM A;  2BAY A;  2YQM A;  4FJC A;  2YHN A;  3ZTG A; 
#chains in the Genus database with same CATH homology
 5G05 B;  1WFK A;  4ZQL A;  2YU4 A;  4YC9 A;  2LXP C;  3PHD A;  2C2L A;  4A49 A;  5LCW B;  3EB5 A;  1VFY A;  2KGI A;  1Z60 A;  1CHC A;  2H0D A;  2MNY A;  3HCT A;  5DKA A;  3HCU A;  2KU3 A;  3M62 A;  2VJE A;  2M85 A;  2L5U A;  2JRJ A;  4X3G A;  1K2F A;  2ECJ A;  3N9M A;  2LRI C;  5KH3 A;  4YAT A;  2UZG A;  2CSY A;  4R2Y A;  3PUR A;  5H1U A;  2JMJ A;  1N87 A;  3NG2 A;  2L75 A;  5TBN A;  4YAX A;  4LJN A;  2RI7 A;  4BHW A;  1WEP A;  5AIU A;  4N3W A;  1LDJ B;  2QIC A;  3DPL R;  2HDP A;  2LN0 A;  2G45 A;  1WEN A;  4C9Z A;  4UP5 A;  2CT2 A;  5B77 A;  4O64 A;  3RTR B;  2VPG A;  2FSA A;  3IHP A;  4L58 A;  4A4B A;  4WA6 A;  3LQJ A;  4ZUX U;  3U5M A;  5TDW A;  1Z2Q A;  1WEU A;  2F42 A;  2KWN A;  4YBT A;  3RPG C;  3L1Z B;  4AP4 A;  1JM7 B;  2JMI A;  4V3L C;  4B7Y C;  3DQV R;  5I3L A;  2KIZ A;  2LGG A;  2YW8 A;  5H1T A;  1BOR A;  1F62 A;  5G04 B;  2FUI A;  4MSX A;  2EA6 A;  2C2V S;  2E6R A;  3O7A A;  4QF2 A;  5TAB A;  2KYU A;  2VNF A;  4YAD A;  3ZNI A;  1T1H A;  3N9O A;  2LGK A;  2LDR A;  2M3H A;  4WZ2 A;  3O35 A;  4NN2 A;  4XI1 A;  2MD7 B;  5TDR A;  2MNZ A;  2YHO A;  1WEV A;  4AYC B;  2NAA A;  2L43 A;  3ZVY A;  4IC3 A;  2ECN A;  2KWJ A;  4GND A;  3O70 A;  3HCS A;  5FB1 A;  1VD4 A;  3U5P A;  3LQI A;  4GNE A;  3KV6 A;  4Q6F A;  5G0F A;  2ECT A;  2CKL B;  1WIL A;  1FP0 A;  1X4J A;  2MT5 A;  2QJ0 A;  2JMD A;  5FER A;  5C11 A;  3LQH A;  5JG6 A;  2HYE D;  3O37 A;  2QIZ A;  4I7C A;  3ZPV E;  2VJF B;  3EB6 A;  1WEW A;  2ECI A;  2MUM A;  5LKZ A;  5D1L B;  1XWH A;  4GB0 A;  3PUQ A;  4YBM A;  4WZ3 B;  1HYJ A;  1V87 A;  1E4U A;  4W4U A;  5AIT A;  2XEU A;  4S3O B;  4GNG A;  4ZDT A;  2DX8 A;  2E6S A;  5KH7 A;  3O36 A;  1JOC A;  1WEE A;  4LLB A;  2ZET C;  1MM2 A;  2YSJ A;  3LRQ A;  2IDA A;  5DIN A;  2VJF A;  5B8D A;  3U5O A;  2L80 A;  3GL6 A;  2ECG A;  2YUR A;  2MIQ A;  2LV9 A;  4N4F A;  1WEO A;  4A0C D;  5B78 A;  4CA1 A;  4LK9 A;  2YT5 A;  3N9L A;  2AN6 A;  3FL2 A;  2M1R A;  4FO9 A;  3MHH A;  3ASL A;  3M63 A;  5B79 A;  4AUQ B;  4FK5 A;  4UI9 B;  2F6J A;  3L1X A;  3ZYQ A;  3C6W A;  4PPE A;  3HTK C;  2KWK A;  4UP0 A;  1HYI A;  3N9Q A;  2KFT A;  1DVP A;  1LDK C;  5C13 A;  2G6Q A;  1WEM A;  5LKT A;  2L0B A;  3KNV A;  3C5K A;  4I7B A;  1JM7 A;  3M99 A;  2H0D B;  3V43 A;  5FEY A;  2VPB A;  2OXQ C;  5H1V A;  2VJE B;  2VPE A;  2YUC A;  2K17 A;  1IYM A;  2PUY A;  4WZ0 A;  2XB1 A;  2PNX A;  1Z6U A;  2LGV A;  2VPD A;  4B86 C;  5D1K B;  2LGL A;  2MD8 C;  1FBV A;  4BBQ A;  2EOD A;  1G25 A;  4AYC A;  2LQ6 A;  1RMD A;  2KR4 A;  4R8P K;  5B75 A;  1U6G B;  4AVX A;  2ECV A;  3SOU A;  2MA5 A;  4R7E A;  2EGP A;  4FIP A;  5J3X A;  2VP7 A;  4CCG X;  2LXH C;  3O33 A;  4PTB A;  2CKL A;  4TKP B;  3T7L A;  5LKU A;  2KWO A;  2YYR A;  1WES A;  4S3O C;  4I7D A;  2Y1N A;  2ECW A;  2YRE A;  2D8S A;  2M6M A;  2KGG A;  1WE9 A;  3I2D A;  5TRB A;  5H9M A;  5KH9 A;  2K16 A;  2RSD A;  4V3K C;  3QZV A;  3T6R A;  3KQI A;  1X4I A;  4YBS A;  3N9P A;  5B76 A;  2KE1 A;  1MM3 A;  3SHB A;  2I50 A;  5LKX A;  3RPG B;  3ZVZ B;  1VYX A;  1ZBD B;  4MVT A;  1WEQ A;  5FB0 A;  2FUU A;  5D1M B;  1X4U A;  4P5O B;  3MHS A;  2Y43 A;  2G43 A;  4LKA A;  2K1J A;  1WGM A;  3KV5 A;  4F52 B;  3VK6 A;  3GV4 A;  3ZPV 1;  2MA6 A;  4YAB A;  4GNF A;  4L7X A;  3N9N A;  5EYA F;  1WIM A;  2K4D A;  2KRE A;  4QF3 A;  2CSZ A;  4A4C A;  2YQL A;  3SOW A;  3L11 A;  3SOX A;  3U5N A;  2Y1M A;  3O34 A;  4IC2 A;  2F6N A;  4LAD B;  2YSM A;  2BAY A;  2YQM A;  4FJC A;  2YHN A;  3ZTG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...