5KKZC

Rhodobacter sphaeroides bc1 with famoxadone
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
179
structure length
179
Chain Sequence
GTRRDFLYYATAGAGAVATGAAVWPLINQMNPSADVQALASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCVPIGGVSGDFGGWFCPCHGSHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
molecule keywords Cytochrome b
total genus 51
structure length 179
sequence length 179
chains with identical sequence G, M, Q
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2016-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00355 Rieske Rieske [2Fe-2S] domain
C PF10399 UCR_Fe-S_N Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 5kkzC01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 5kkzC02
3GL0A 2WSEJ 4NBFD 3CX5E 2HMMA 1L0LE 1O7MA 4NBGD 4H13B 1Q90C 2E76D 4NBHD 4NBBD 5CXMA 2QJKC 3LW5J 2NVGA 4PD4E 2DE5D 2BMRA 2YFIA 2YFJA 1FQTA 2YIUC 1PP9E 4QCKA 2GBWA 4AAYB 4PV1B 2BMOA 1UUVA 1ZRTE 4IL6X 3L75E 1O7NA 2E74B 4NBDD 2QPZA 2YVJB 3H1KE 1P84E 1RIEA 4RKUJ 4QUPA 1JM1A 5HL4A 1BCCE 4QDCA 4Y28J 3AZCA 2HMNA 1KYOE 2WPVB 3GL2A 4HM5A 1SJGA 3H1HE 4KT0J 3GZYA 2DE6D 1BE3E 3H1JE 3FOUA 1KB9E 1UUWA 1O7PA 4H44D 3VMHD 1NTZE 3CWBE 2E4QA 2QSIA 4U3FE 2ZT9D 1NTME 1RFSA 2B1XA 3BCCE 1G8JB 3H1IE 5AEUA 1VM9A 3CXHE 2JO6A 3EN1A 2BMQA 4I7ZB 2XSOA 2ZT9B 4HM0A 4HM3A 1Q90D 2FYUE 3H1LE 4NB9D 1PPJE 1O7GA 4HJLA 2YFLA 2I7FA 2B24A 3GZXA 4HM2A 2O01J 4H0LB 2E76B 5KLVE 4H44B 1NTKE 2HMKA 3DQYA 1ULJA 1EG9A 5KLIC 3L73E 2ZYLA 4H0LD 5L8RJ 3TGUE 3GTEA 1O7WA 2E74D 4HM1A 3VMGD 4P1BH 1NU1E 3GB4A 3N0QA 2CKFA 2HMLA 4QDFA 4OGQB 2Q3WA 4HKVA 2WSCJ 4NBED 2E75D 2XSHA 3VMID 3L71E 5BOKA 4HM4A 1NDOA 3EQQA 3C0DA 1JB0J 3GTSA 3GOBA 4NB8D 2QIWA 2IBZE 2JZAA 3GKEA 3L74E 2NUKA 2QJPC 1VF5B 2A06E 4NBCD 4QDFB 2E4PA 2D2CD 1WQLA 4HM7A 5AEWA 3VCAA 2XR8A 3GCEA 2QJYC 4EMJB 1VF5D 2NWFA 4P1CH 1ULIA 2XRXA 2K9YA 1EZVE 2HMOA 4QURA 1NYKA 4HM6A 2NVFA 1SQBE 2BCCE 2DE7D 3L72E 1L0NE 3D89A 1VCKA 1O7HA 1SQVE 1S5LX 2D2CB 2WSFJ 2NUMA 2NVEA 2E75B 2HMJA 4OGQD 1SQPE 2GBXA 4NBAD 2FYNC 4QUQA 4PV1D 3C8VA 4AIVA 5KKZC 3VCPA 1G8KB 1SQXE 4QDDA 4HM8A 3L70E 1SQQE 4H13D
chains in the Genus database with same CATH superfamily
1FZCA 1YTZT 3B4SA 1S72P 1NTMD 1IFJA 3N7NA 1L2PA 1VQOP 4NBDD 3TGUD 2MJZA 1X9VA 4D6TG 1OZHA 3OA7A 5APWA 1VQNP 3H6PA 4QDCA 3BVHA 3HRNA 3H1HE 3RK3D 5KLVD 4C7NB 3AEGC 5AVYB 1ZMEC 2KP8A 1JTHB 1NU1J 3TNUB 3CWBJ 3L75G 1GK6A 1LT9B 3Q5SA 4A7PA 1HH0A 1NTKJ 1SQQK 1T2KC 3N0QA 4HKZH 4GIFA 3HD7B 1JMBA 1AFOA 2JP3A 2N1TB 3A0HH 2IYPA 2W90A 3IFMA 1NDOA 1USDA 3KXDA 2M3EA 4BRYB 4PD4H 1URQC 2PGDA 1H89A 2KZJA 2OQQA 3MTUE 3TDKA 3BCCG 4I6MC 3VCAA 2QJYC 3WUTA 2K9YA 1YYCA 4QURA 3CL3D 1SQBE 1PPJG 5AW4B 1N86A 4WY4B 1RHZB 1SQQD 5AVXB 3M0AA 3B8EB 2W27A 2G8YA 2ZT9C 2O1JA 1Z56A 4DOJA 3HD7C 4LGDE 1Q81Q 4NBGD 4PD4E 2HODB 1HGZA 3R2PA 2J59M 1K73Q 4AAYB 4IOIH 1U7JA 1RF1B 3H1KJ 1NTMK 4IFDK 2ZYAA 3KYQA 4WBAA 3AE2C 4C7RA 1JY3P 2JR8A 3CMEP 5GTHE 2I1KA 2E4QA 4U3FE 1QL1A 1G8JB 1BE3D 1E79H 3I56P 3H1LG 4HM0A 1JCDA 2R32A 2I1JA 1UIIA 2MKVA 5KAFE 1BE3J 2OYIC 1M1KQ 1QEXA 1VQ6P 3GTEA 2E74D 4HM1A 1RQUA 2H88C 4HKVA 1AQ5A 5CBOA 3TYYA 1IZNB 1QX8A 5CCHC 1MUUA 3KZIH 1RF1A 2XKMA 3FWNA 3SWYA 5M1BA 1LT1A 4YPCA 2NVFA 1FC2C 2FYUD 1DEBA 2NUMA 1LTIC 1JTHA 5KLIB 2E75B 5AVWB 3A2AA 3M9HA 3R4YA 1EXIA 1OW7A 3H1KG 3L72D 3L74J 3PJSK 1VQ8P 1JCCA 1OWAA 2KZIA 3MIWA 1OVUA 3L37A 2R44A 1PV3A 1IFPA 4NBFD 2M5AB 3G9RA 4NBHD 3RK2D 5APSA 2WQYC 1GU4A 3KPEA 2GBWA 4PV1B 2E74B 2QPZA 1X0TA 3WUVA 1SFCB 3L74D 4N6JA 1FBMA 2W6JH 3CX5I 4RKUJ 2Q7CA 3II6A 5APYA 5HL4A 1KYOE 3W68A 1BCCG 1KD1Q 3W67A 1SFCD 3H1JE 1FDOA 1O7PA 3VMHD 3BCCJ 1NTMG 2E75C 2H7HA 3H1HD 1PGPA 2BCCG 1N7SC 2QM7A 5GTIH 1NVOA 1T6AA 2P1JA 5KLVJ 1H0TA 2N1TC 3VMZA 1M1JA 5CJ4A 1FJPA 3E7KA 5H2FH 3JSVC 3H25A 1J1DB 1JOCA 1VQ7P 5APXA 2QJPC 3USSA 1KYOH 3CCMP 1J1EC 4I2LC 2IFNA 4HM7A 5CJ0A 4EMJB 2JEEA 1FZBA 3CCVP 1RE3C 1NYKA 3BRTB 2FYNB 3I55P 3JCUH 3GF7A 5C39A 2Z5HA 2J5UA 3L75D 1DD4A 3CX5E 1L0LE 3KZIE 1D7MA 3CD6P 1SQBJ 4H13B 2IBZD 4EYYQ 2ZJSE 1U57A 4L75A 3L74G 1N7LA 2QVAA 3FGAD 2FXPA 2VRSA 3E1RA 3IAOA 1OVVA 2M0BA 4LLHA 1VQMP 5TISE 4PJ0H 1GDTA 1VDFA 2ZYGA 3CXHI 2BMQA 3V4WA 2B87A 4PD4I 1L0NG 2O01J 1L4AD 1JY2O 1H88A 2IX7C 1R5SA 4U3FJ 1P84H 5EFWB 1S1CX 4Y99C 1VQ9P 3RK2C 1KQSO 3EQQA 1IFMA 1LP1B 1LTTC 4QDFB 2IFMA 4H44C 1FU1A 2OYHA 4RO0A 1VQ4P 3CMAP 2M8RA 3HTKA 2YNYA 3AE3C 1YQ3C 3L73D 4I1LA 5KLVK 4NBAD 4OH8B 1VPCA 5CHXA 1L0LJ 3ITKA 1NTKK 1SQQJ 5CCGA 1O7MA 4NBBD 1L4AB 3H1JJ 2Q3IA 1CI6A 4WVZA 4JYCA 2O1KA 2V7QJ 1OVRA 3HUSB 1FDIA 4XA4A 2Y0EA 1J1EB 1KYOD 2HMNA 2WITA 1SJGA 4JQ0D 4Z1MH 4C7NA 4D6TD 3LIDA 4HJGH 2QSIA 3RL0B 3P8MC 1LP1A 1VM9A 3CX5H 3A0HE 1GW4A 3D6YA 1JY2N 1LWUA 3PRJA 1SQBK 2RH0A 3Q2YA 1RH5B 2HMKA 1L4AC 2A06G 1IFDA 3HE5B 3RL0C 2XNXA 2CKFA 1NTZK 3CWBD 5BU8B 3VN0A 1MKMA 5BOKA 4HM4A 3HE4B 3WUUA 2BCCD 3EFGA 3ZDMA 1PP9G 4YTPC 1GTWA 3G4SP 3GKEA 5TISH 3S1KA 2WPRA 2FKWB 3GCEA 2IBZI 4QMAA 3FXDA 2HMOA 3MHVA 1FZCC 1Y8AA 2Q6QA 4GT1A 2HMJA 1K9MQ 2WT7B 5B5EH 3AE8C 2LR2A 3E1IA 2I8DA 1SQPD 2HMMA 2K88A 2IZ1A 3LW5J 1HVVA 2DE5D 1LTSC 2P10A 3U1AA 1BDDA 2HPCB 1LTAC 5AVUB 1BGYD 4Y28J 1NKNA 1DIPA 3D71A 3FOUA 1NTZE 3PH0A 5BVZA 4EIJA 1YIJP 1CZQA 5AEUA 3LW5H 1S4XA 3VMYA 1N7SA 2OGUA 3CCSP 4IL6H 3CCRP 3L71J 4WY4D 3SFDC 3QH9A 2LXBA 1KB9D 5KJ7D 1N73C 2HYNA 2R3CA 3TSIA 3H1LD 4DJGA 3C9IA 1IJDB 3VMGD 3O6QA 4NPFX 3RK3B 4XFJA 3CC2P 2E75D 5APQA 1PP9D 3GTSA 1BGYE 1IK9A 5CBNA 4R4LA 2JZAA 1LTJA 4D6TE 2A06E 4IFFA 3EFFK 2OTJP 1SQVE 2KLVA 4EOTA 1L4AA 2W6BA 1LTJC 4OGQD 2O01N 1NTKD 4QUQA 5AW7B 2FYUG 1SLQA 4QDDA 5CCHD 2OYIB 3M0DA 3G71P 1YJWP 2M5AA 4N3YB 4GODA 2NVGA 2KIKA 1FZGA 4QCKA 3S4RA 1KQLA 1VQ5P 1ZN5A 2YVJB 3H1KE 2W8ZA 1PL5A 4DT0A 4KT0J 3P8CD 3GHGC 4H44D 1P84I 3GW6A 2C0WA 2GUVA 3A7OA 3KHUA 3M9QA 1LTGC 5AW1B 1R8EA 3EN1A 1YI2P 3B5NC 4BXLA 3SWFA 4HJLA 4HM2A 4ZKPA 5KAIE 2Z5IA 1RY3A 1W5CE 3L73G 2FBWC 3MGNA 4L73A 2B9BA 3L35A 1FAVA 2K9JA 2WWWA 2SPZA 3EWKA 2WSCJ 3RK2B 5B66H 3O8ZA 2R3SA 1N7SD 2POHA 1QGKB 1S5LH 3TF5A 4NBCD 1K04A 2E76C 2YKQA 1EZVE 1O7HA 4AUWA 4WY4C 1SVFA 2KOGA 3B71A 2KNCB 2GBXA 2R5BA 1AVOA 1RE3A 5KKZC 1G8KB 5CCGC 2IDBA 4L74A 3G3ZA 4GOFA 1YJ9P 1EZVD 3CC7P 2IYOA 1CW5A 5GTHH 3P8CE 3MZWB 1L0LD 3H32B 2PAJA 1H0TB 4ZKUA 1JY2P 1KB9I 4YXWH 2L91A 2XV5A 2HLOA 3GL2A 1R5LA 2WPVB 4HM5A 1FE6A 3S9OA 1SQBD 5TJHA 4NPEA 3CI9A 1PFIA 3CC4P 4XE5B 4I7ZB 2ZT9B 2V7QH 1SQVD 1KQGB 3HUSC 1NGMB 1EDLA 1K8AQ 1BGYG 1AQTA 1NTKE 5AVRB 1KORA 2FY8A 2QM8A 5APUA 1Y9BA 3GB4A 4GDOA 1FZAA 3AECC 1ZW0A 3VMID 4WWIA 2NPSA 2IBZE 1WT6A 4PJ0E 1JNMA 2B89A 3OAKA 1NJIQ 3KDPB 4P1CH 2AXTH 3H1ID 2RKLA 4HM6A 2ZXEB 3AEBC 1S5LX 5E79H 1L0NJ 1IK7A 4YXDC 3L75J 3V2NA 4JYBA 3F5HA 2NRGA 1PZQA 4O9BA 1FZCB 1ZV8A 1HGVA 1NKZB 3G6EP 1NTZJ 2YIUC 1S3JA 3KQGA 3AE5C 3SSUA 1ZOYC 5AW2B 1AJYA 2JJLA 3VMAA 2YIUB 2N9YB 3MUDA 4Y99B 4ZMDA 1SQPG 3Q3DA 2W6AA 2FYUJ 3AE4C 2B24A 5KLVE 4H44B 5KLIC 3TGUE 2RMZA 3MP7B 1Q2NA 4UB6E 1KTMA 1LGHB 1Y47A 3H1LJ 3Q5PA 5KKZB 3RBXA 2YO2A 3OW2O 1KQFB 1HBWA 3V2QA 1NAFA 1BGYJ 3L74E 2C0XA 3PHLA 1KZUB 1GMJA 4K3AA 3H1IG 4EI2A 4HYTB 2P58A 1KC8Q 3RK3C 1G1JA 2OTLP 1EDJA 3L72E 1KILC 4ZNCA 1JY3O 2Y9YA 2WT7A 5AVZB 1KILA 2AEJA 2WSCH 2IBZG 3Q1MA 4HM8A 4JPZB 1L0LK 3L70J 1DEEG 1Q90C 1SP4A 3T97B 1KFNA 1JY3N 1U7MA 2QG4A 1SQPJ 4IL6X 2FYZA 1O7NA 3VTPC 1IFIA 2QJKB 2ZVOB 3ABVC 3CCEP 3VOPA 1OXZA 2KYVA 4IL6E 1JM1A 1RF1C 1NTKG 1L0ND 1KILE 2JWDA 1X8YA 1VQPP 1N2DC 1RQVA 3BCCE 1S2EA 2OYIA 4GKGA 2LKMA 4W7ZA 4LC1A 3H1LE 1PPJE 3GZXA 2ZXXA 1M7LA 2CPBA 3H1HJ 3DQYA 3GHGB 2ZFCA 1NHLA 1ZR4A 1EG9A 1ULJA 5KTBA 3B5ND 3L70D 4AYCA 1SFCA 3Q5RA 4QDFA 2Z4EA 2XSHA 3L71E 1E5WA 1FOSE 3FX0A 3D6ZA 3PLNA 5DJUB 1OW8A 2HR3A 2P2UA 5AW0B 2OYHC 1URQA 2XNDH 2BCCE 1HTLC 3VP8A 2ZAEB 1L0NK 1T3JA 3A3YB 4KHXA 1J2JB 4PV1D 4AIVA 3L70E 2YO3A 2XZRA 1PGQA 3P32A 1SFCC 1T2KD 3WU2H 5BU5A 4AQRD 1PGOA 2BMRA 2KK7A 2CPSA 1EXJA 5KAIH 1XTCC 4N78E 3RBZA 2ZYDA 3QWOC 1NO4A 1RIEA 2JO1A 2ZVNB 3IN6A 1BCCE 1EC5A 1HUCA 3GZYA 2DE6D 2HFED 2WVRA 1VQKP 3CWBE 3HD7D 3VP9A 2ZT9D 3CXHE 1N8RQ 2XSOA 4B86A 3HUSA 3N4XA 3D70A 3V4QA 1LJ2A 5KJ7C 1L0LG 1DH3A 3VMXA 1BCCD 4BRYA 5L8RJ 1SQXD 5E79E 2A45G 1FDMA 2ITAA 5APVA 1Q86Q 2IPPA 5CMZA 2FFDB 2WSSH 2M3BA 2E5YA 1USEA 1OW6A 2AEFA 1NTZD 2IZ0A 3SFEC 1QLED 2HPCA 2E4PA 1K05A 1XTGB 2WSEH 3P7KA 4HB1A 2NWFA 3AEEC 1SQVK 3BRVB 1L0NE 1AV1A 3H1JG 1VCKA 1LWUB 1HJBA 2N9BA 1EDIA 3FWLA 1T3UA 2KSEA 1SQXK 3A0BE 5AW9B 2FYNC 3CCUP 2WZ7A 3HE5A 3VCPA 3C1LA 4W7YA 1GL2D 3AE9C 2UWJE 2YKPA 1CSBA 1TU3F 1VF5C 4DCKA 5CXMA 2QJKC 1S5LE 1T8ZA 3BATA 1SQPK 3H32A 1G2CB 2QEXP 1HJ0A 3JC22 4UB6H 2PFXA 2NZ2A 2K9JB 3RGUA 2NPSD 2FFDA 1GL2B 1YJNP 3MUDC 2H89C 1FOSF 3GHGA 1BSHA 4TLFA 1NYHA 3WU2E 1RFSA 2B1XA 2XU6A 2H43A 4CPGA 5AW3B 3CCLP 4NB9D 4U3FD 1OMIA 1KYOI 2E76B 4U7JA 3VYIA 1BE3G 3T97A 3L73E 4PV1C 5KAFH 3I5CA 2E5TA 1N73A 4K35A 3V5BA 3CWBG 2HMLA 1MFTA 5AVQB 2Q9IA 3L71D 2FXOA 2KS1A 3RL0g 2O01H 2QRXA 2G3AA 1M90Q 4TT3H 2D2CD 3L70G 1X22A 1ULIA 4DZOA 3BASA 1LTJB 2KUBA 2NVEA 3M9BA 2LXCB 2FXMA 4W80A 2OARA 2FYUK 4KJMA 1VQLP 2YKOA 2W83C 1SQXE 4H13D 2WSEJ 3O6QB 1ZRTD 1QVFO 1RF0A 2E76D 1Q7YQ 2QJYB 2YFIA 1CI6B 1A02F 1NU1D 2QJPB 5K5GB 1UUVA 3NMDA 3AEDC 2Q5UA 1W2EA 2NPSB 1KILB 1NAYA 1ZP0C 3H1IJ 2E42A 2V4HA 3TNUA 1DD3A 3IR9A 3GF3A 3RK3E 1HF9A 2K3RA 1Q90D 2OYOA 4ASWA 3L36A 4OVNF 3PP5A 2PP6A 4H0LB 2H8PD 3SWKA 3CX5D 2Y9ZA 2ZYLA 4WB4A 1QVGO 5AVTB 3RL0D 3TK1A 1NU1E 5CCGD 1KILD 3HD7A 1GU5A 4OGQB 2J58A 3PTZA 2O3JA 1YTZI 2KB7P 3V2RA 4C46A 3C0DA 2NPSC 4R4MA 1VF5B 2YMYA 1VL2A 2A06D 2XR8A 1SQQG 2WPSA 1GL2A 1SQVJ 2AEMA 1PGJA 4WY4A 2AXCA 2YXQB 3AEAC 1A02J 1Q82Q 2KI7B 1WMKA 4D6TJ 2B87B 1GL2C 1KMIZ 1LT9C 3M06A 4PD4D 2KNCA 3H1JD 2HODA 1YHQP 3CPWO 2BMOA 2A45I 2WSFH 1PP9J 2PRRA 4UB8H 1FZFA 1SQXG 2KS1B 3U1CA 1BE3E 3L73J 1SQVG 1ZLLA 1KB9E 1RE4C 1UUWA 4EDFA 2K1AA 1NTZG 1NTME 2JKVA 5H2FE 3B5NA 3GLMA 1N73B 4HM3A 2FYUE 1O7GA 3BCCD 1OIPA 1EQ7A 2XDJA 2WMMA 3IF4A 1MV8A 3A0BH 1LTBC 3TGUG 1PPJD 3JCUE 1JMMA 1EDKA 1J1DC 5GTIE 2OTKE 2AXTE 4ASVA 4JF7A 2JWAA 3CXHD 2Q3EA 2P7JA 2E74C 4OGQC 1AA0A 3GOBA 4NB8D 4L76A 1RE4A 5AVVB 2WPQA 3OJAB 1GZLA 3NFQA 4I7ZC 1M8OB 3M0DC 3L72J 3H1KD 3L72G 3A5TA 2D2CB 3L71G 1JEKA 1SQPE 5APTA 2WTYA 1IO4A 1FJKA 1OX3A 4H0LC 5DJTB 3C8VA 2E43A 1SQQE 1G1IA 1LT9A 3GL0A 5KLVG 4RESB 5AVSB 2D2CC 5AW5B 1M57D 2B88A 1JO5A 2YFJA 1ZRTE 3CCQP 1NH4A 1KV4A 3AE6C 4RJTA 1P84E 1X79B 1OFCX 2K37A 2KLUA 2P67A 4IFMA 3AZCA 2C9LY 3CXHH 1BCCJ 1JUNA 3H1IE 1NU1G 1FS0E 1HWTC 5B66E 4MN4C 2L5GB 3GMAA 3GG2A 2I7FA 1KB9H 2HG5D 3AE1C 2N1TD 1O7WA 3U59A 4P1BH 1ZXGA 4H13C 1JM0A 4BWNA 1M1JB 3CCJP 1NOHA 2QA4P 5AW6B 5B5EE 2QIWA 1H8AA 1FZEA 2NUKA 1W2BO 1WQLA 5AEWA 1EZVG 5CCHA 3V6IA 2DE7D 1M56D 3AEFC 2YXRB 1LNQA 1NWQA 1EZVI 1NU1K 1KN7A 1URQD 1QL2A 2GUSA 3H1HG 1M1JC 3K5BA 1SQBG 3CLQA 4OWFA 2N1TA 1P84D 3HE4A 1FQTA 2C9NY 1PP9E 2Y0CA 3L75E 3AE7C 1G2CA 3MD0A 4QUPA 3L4FA 4HH2A 1N7SB 1GD2E 4JBZA 3LIEA 2RN0A 2A45H 1KFMA 2Q1KA 2FFDC 5KJ7A 3FXEA 3V2PA 1LWUC 2JDIH 2JO6A 4M3LA 2YFLA 1YITP 2Y0DA 3TGUJ 1UIXA 3NXSA 2GM4A 4H0LD 4U3FG 1BSNA 3UIAA 3NTNA 1NTMJ 2GA1A 1RF0C 1DX7A 1AVYA 2Q3WA 1IC2A 1WRGA 3F89A 2BCCJ 4NBED 1S9KE 1URQB 1GK4A 1PIXA 1JB0J 2QE7H 2CK3H 2KSJA 5AW8B 2DW3A 1GW3A 4GOEA 3EQ2A 1BDCA 1SS1A 1VF5D 2OYHB 1YBKA 2XRXA 3B5NB 4UB8E 3D89A 1ZR2A 2R5DA 1YQ4C 2BASA 2WSFJ 3HTKB 4N78D 4NPDA 1S9KD 3WMM0 1MZ9A 1SQXJ 1MFZA 1IFNA 2BEZF 2BEQD 2YMKA 2KXPB 3M91A
chains in the Genus database with same CATH topology
2WSEJ 1O7MA 4NBBD 2E76D 2YFIA 2YIUC 1UUVA 4NBDD 2V7QJ 3AE5C 1ZOYC 3AEDC 1FDIA 4QDCA 2HMNA 1AJYA 1SJGA 3H1HE 4Z1MH 3AEGC 1ZP0C 1ZMEC 2QSIA 3Q3DA 1DD3A 1VM9A 3GF3A 3RK3E 1HF9A 1Q90D 3D6YA 3AE4C 2B24A 3Q2YA 4H0LB 5KLVE 3Q5SA 4H44B 2HMKA 5KLIC 2ZYLA 3TGUE 1NU1E 3N0QA 2CKFA 1KTMA 4OGQB 1MKMA 2JP3A 3Q5PA 5BOKA 4HM4A 1NDOA 3C0DA 4YTPC 1KQFB 4R4MA 3GKEA 3L74E 1VF5B 1VL2A 2OQQA 1GMJA 3VCAA 2XR8A 3GCEA 2QJYC 2K9YA 2HMOA 4QURA 3L72E 1SQBE 2HMJA 3AEAC 1WMKA 3AE8C 3Q1MA 2G8YA 1KMIZ 4HM8A 2ZT9C 2HMMA 4NBGD 1Q90C 3T97B 3LW5J 4PD4E 2DE5D 4AAYB 2BMOA 4IL6X 1O7NA 2P10A 3ABVC 3AE2C 1JM1A 4Y28J 1DIPA 1BE3E 3D71A 3FOUA 1KB9E 1UUWA 1KILE 1NTZE 2E4QA 4U3FE 1RQVA 1NTME 3BCCE 1G8JB 5AEUA 3GLMA 4HM0A 4HM3A 2FYUE 3H1LE 1PPJE 1O7GA 3GZXA 2MKVA 3SFDC 3DQYA 1ULJA 1EG9A 3GTEA 2E74D 4HM1A 3Q5RA 3VMGD 1RQUA 4QDFA 2H88C 3O6QA 4HKVA 4XFJA 2E75D 2XSHA 3L71E 2E74C 4OGQC 3GTSA 3GOBA 4NB8D 4R4LA 2JZAA 3D6ZA 2A06E 1OW8A 4I7ZC 5M1BA 2NVFA 2BCCE 1SQVE 2D2CB 2NUMA 2E75B 4OGQD 1SQPE 1EXIA 3R4YA 1OW7A 4QUQA 4H0LC 4PV1D 3C8VA 4AIVA 4QDDA 3L70E 1SQQE 1PV3A 3GL0A 4NBFD 3G9RA 4NBHD 2D2CC 2NVGA 2WQYC 2BMRA 2YFJA 4QCKA 2GBWA 1EXJA 4PV1B 1ZRTE 2E74B 2QPZA 3AE6C 2YVJB 3H1KE 1P84E 1RIEA 2JO1A 4RKUJ 3IN6A 5HL4A 1BCCE 3AZCA 1PL5A 1KYOE 4KT0J 3GZYA 2DE6D 3H1JE 1FDOA 4H44D 1O7PA 3VMHD 3CWBE 2E75C 2ZT9D 3H1IE 3CXHE 1R8EA 3EN1A 2XSOA 4HJLA 3GMAA 2I7FA 4HM2A 3D70A 3AE1C 5L8RJ 1O7WA 4P1BH 2FBWC 4H13C 3EWKA 2WSCJ 1OW6A 3H25A 2QIWA 3SFEC 2NUKA 2QJPC 4NBCD 1K04A 2E76C 2E4PA 1WQLA 1K05A 4HM7A 5AEWA 4EMJB 2NWFA 1EZVE 3AEEC 1NYKA 2DE7D 1L0NE 1VCKA 3GF7A 1O7HA 3AEFC 3B71A 2GBXA 2FYNC 5KKZC 3VCPA 1G8KB 3AE9C 2IDBA 2J5UA 1DD4A 3CX5E 1TU3F 1VF5C 1L0LE 4H13B 5CXMA 2QJKC 1FQTA 1PP9E 1U57A 3L75E 3FGAD 3AE7C 2FXPA 4QUPA 3IAOA 1HJ0A 2NZ2A 3GL2A 2WPVB 4HM5A 2H89C 3S9OA 1NYHA 1RFSA 2B1XA 2JO6A 2BMQA 4I7ZB 2ZT9B 4NB9D 1KQGB 1OMIA 2YFLA 1NGMB 2O01J 2E76B 4U7JA 1NTKE 1UIXA 1KORA 3L73E 4H0LD 4PV1C 1Y9BA 3GB4A 4GDOA 2HMLA 2Q3WA 3AECC 1S1CX 4NBED 3VMID 3EQQA 1PIXA 1JB0J 3RL0g 2IBZE 2G3AA 4QDFB 4TT3H 2D2CD 4H44C 1VF5D 4P1CH 1ULIA 2XRXA 4HM6A 3D89A 3AEBC 1S5LX 1YQ4C 2WSFJ 1YQ3C 3AE3C 1IK7A 2NVEA 4YXDC 4NBAD 1SQXE 2BEQD 2BEZF 2YMKA 4H13D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GL0 A;  2WSE J;  4NBF D;  3CX5 E;  2HMM A;  1L0L E;  1O7M A;  4NBG D;  4H13 B;  1Q90 C;  2E76 D;  4NBH D;  4NBB D;  5CXM A;  2QJK C;  3LW5 J;  2NVG A;  4PD4 E;  2DE5 D;  2BMR A;  2YFI A;  2YFJ A;  1FQT A;  2YIU C;  1PP9 E;  4QCK A;  2GBW A;  4AAY B;  4PV1 B;  2BMO A;  1UUV A;  1ZRT E;  4IL6 X;  3L75 E;  1O7N A;  2E74 B;  4NBD D;  2QPZ A;  2YVJ B;  3H1K E;  1P84 E;  1RIE A;  4RKU J;  4QUP A;  1JM1 A;  5HL4 A;  1BCC E;  4QDC A;  4Y28 J;  3AZC A;  2HMN A;  1KYO E;  2WPV B;  3GL2 A;  4HM5 A;  1SJG A;  3H1H E;  4KT0 J;  3GZY A;  2DE6 D;  1BE3 E;  3H1J E;  3FOU A;  1KB9 E;  1UUW A;  1O7P A;  4H44 D;  3VMH D;  1NTZ E;  3CWB E;  2E4Q A;  2QSI A;  4U3F E;  2ZT9 D;  1NTM E;  1RFS A;  2B1X A;  3BCC E;  1G8J B;  3H1I E;  5AEU A;  1VM9 A;  3CXH E;  2JO6 A;  3EN1 A;  2BMQ A;  4I7Z B;  2XSO A;  2ZT9 B;  4HM0 A;  4HM3 A;  1Q90 D;  2FYU E;  3H1L E;  4NB9 D;  1PPJ E;  1O7G A;  4HJL A;  2YFL A;  2I7F A;  2B24 A;  3GZX A;  4HM2 A;  2O01 J;  4H0L B;  2E76 B;  5KLV E;  4H44 B;  1NTK E;  2HMK A;  3DQY A;  1ULJ A;  1EG9 A;  5KLI C;  3L73 E;  2ZYL A;  4H0L D;  5L8R J;  3TGU E;  3GTE A;  1O7W A;  2E74 D;  4HM1 A;  3VMG D;  4P1B H;  1NU1 E;  3GB4 A;  3N0Q A;  2CKF A;  2HML A;  4QDF A;  4OGQ B;  2Q3W A;  4HKV A;  2WSC J;  4NBE D;  2E75 D;  2XSH A;  3VMI D;  3L71 E;  5BOK A;  4HM4 A;  1NDO A;  3EQQ A;  3C0D A;  1JB0 J;  3GTS A;  3GOB A;  4NB8 D;  2QIW A;  2IBZ E;  2JZA A;  3GKE A;  3L74 E;  2NUK A;  2QJP C;  1VF5 B;  2A06 E;  4NBC D;  4QDF B;  2E4P A;  2D2C D;  1WQL A;  4HM7 A;  5AEW A;  3VCA A;  2XR8 A;  3GCE A;  2QJY C;  4EMJ B;  1VF5 D;  2NWF A;  4P1C H;  1ULI A;  2XRX A;  2K9Y A;  1EZV E;  2HMO A;  4QUR A;  1NYK A;  4HM6 A;  2NVF A;  1SQB E;  2BCC E;  2DE7 D;  3L72 E;  1L0N E;  3D89 A;  1VCK A;  1O7H A;  1SQV E;  1S5L X;  2D2C B;  2WSF J;  2NUM A;  2NVE A;  2E75 B;  2HMJ A;  4OGQ D;  1SQP E;  2GBX A;  4NBA D;  2FYN C;  4QUQ A;  4PV1 D;  3C8V A;  4AIV A;  5KKZ C;  3VCP A;  1G8K B;  1SQX E;  4QDD A;  4HM8 A;  3L70 E;  1SQQ E;  4H13 D; 
#chains in the Genus database with same CATH topology
 1FZC A;  1YTZ T;  3B4S A;  1S72 P;  1NTM D;  1IFJ A;  3N7N A;  1L2P A;  1VQO P;  4NBD D;  3TGU D;  2MJZ A;  1X9V A;  4D6T G;  1OZH A;  3OA7 A;  5APW A;  1VQN P;  3H6P A;  4QDC A;  3BVH A;  3HRN A;  3H1H E;  3RK3 D;  5KLV D;  4C7N B;  3AEG C;  5AVY B;  1ZME C;  2KP8 A;  1JTH B;  1NU1 J;  3TNU B;  3CWB J;  3L75 G;  1GK6 A;  1LT9 B;  3Q5S A;  4A7P A;  1HH0 A;  1NTK J;  1SQQ K;  1T2K C;  3N0Q A;  4HKZ H;  4GIF A;  3HD7 B;  1JMB A;  1AFO A;  2JP3 A;  2N1T B;  3A0H H;  2IYP A;  2W90 A;  3IFM A;  1NDO A;  1USD A;  3KXD A;  2M3E A;  4BRY B;  4PD4 H;  1URQ C;  2PGD A;  1H89 A;  2KZJ A;  2OQQ A;  3MTU E;  3TDK A;  3BCC G;  4I6M C;  3VCA A;  2QJY C;  3WUT A;  2K9Y A;  1YYC A;  4QUR A;  3CL3 D;  1SQB E;  1PPJ G;  5AW4 B;  1N86 A;  4WY4 B;  1RHZ B;  1SQQ D;  5AVX B;  3M0A A;  3B8E B;  2W27 A;  2G8Y A;  2ZT9 C;  2O1J A;  1Z56 A;  4DOJ A;  3HD7 C;  4LGD E;  1Q81 Q;  4NBG D;  4PD4 E;  2HOD B;  1HGZ A;  3R2P A;  2J59 M;  1K73 Q;  4AAY B;  4IOI H;  1U7J A;  1RF1 B;  3H1K J;  1NTM K;  4IFD K;  2ZYA A;  3KYQ A;  4WBA A;  3AE2 C;  4C7R A;  1JY3 P;  2JR8 A;  3CME P;  5GTH E;  2I1K A;  2E4Q A;  4U3F E;  1QL1 A;  1G8J B;  1BE3 D;  1E79 H;  3I56 P;  3H1L G;  4HM0 A;  1JCD A;  2R32 A;  2I1J A;  1UII A;  2MKV A;  5KAF E;  1BE3 J;  2OYI C;  1M1K Q;  1QEX A;  1VQ6 P;  3GTE A;  2E74 D;  4HM1 A;  1RQU A;  2H88 C;  4HKV A;  1AQ5 A;  5CBO A;  3TYY A;  1IZN B;  1QX8 A;  5CCH C;  1MUU A;  3KZI H;  1RF1 A;  2XKM A;  3FWN A;  3SWY A;  5M1B A;  1LT1 A;  4YPC A;  2NVF A;  1FC2 C;  2FYU D;  1DEB A;  2NUM A;  1LTI C;  1JTH A;  5KLI B;  2E75 B;  5AVW B;  3A2A A;  3M9H A;  3R4Y A;  1EXI A;  1OW7 A;  3H1K G;  3L72 D;  3L74 J;  3PJS K;  1VQ8 P;  1JCC A;  1OWA A;  2KZI A;  3MIW A;  1OVU A;  3L37 A;  2R44 A;  1PV3 A;  1IFP A;  4NBF D;  2M5A B;  3G9R A;  4NBH D;  3RK2 D;  5APS A;  2WQY C;  1GU4 A;  3KPE A;  2GBW A;  4PV1 B;  2E74 B;  2QPZ A;  1X0T A;  3WUV A;  1SFC B;  3L74 D;  4N6J A;  1FBM A;  2W6J H;  3CX5 I;  4RKU J;  2Q7C A;  3II6 A;  5APY A;  5HL4 A;  1KYO E;  3W68 A;  1BCC G;  1KD1 Q;  3W67 A;  1SFC D;  3H1J E;  1FDO A;  1O7P A;  3VMH D;  3BCC J;  1NTM G;  2E75 C;  2H7H A;  3H1H D;  1PGP A;  2BCC G;  1N7S C;  2QM7 A;  5GTI H;  1NVO A;  1T6A A;  2P1J A;  5KLV J;  1H0T A;  2N1T C;  3VMZ A;  1M1J A;  5CJ4 A;  1FJP A;  3E7K A;  5H2F H;  3JSV C;  3H25 A;  1J1D B;  1JOC A;  1VQ7 P;  5APX A;  2QJP C;  3USS A;  1KYO H;  3CCM P;  1J1E C;  4I2L C;  2IFN A;  4HM7 A;  5CJ0 A;  4EMJ B;  2JEE A;  1FZB A;  3CCV P;  1RE3 C;  1NYK A;  3BRT B;  2FYN B;  3I55 P;  3JCU H;  3GF7 A;  5C39 A;  2Z5H A;  2J5U A;  3L75 D;  1DD4 A;  3CX5 E;  1L0L E;  3KZI E;  1D7M A;  3CD6 P;  1SQB J;  4H13 B;  2IBZ D;  4EYY Q;  2ZJS E;  1U57 A;  4L75 A;  3L74 G;  1N7L A;  2QVA A;  3FGA D;  2FXP A;  2VRS A;  3E1R A;  3IAO A;  1OVV A;  2M0B A;  4LLH A;  1VQM P;  5TIS E;  4PJ0 H;  1GDT A;  1VDF A;  2ZYG A;  3CXH I;  2BMQ A;  3V4W A;  2B87 A;  4PD4 I;  1L0N G;  2O01 J;  1L4A D;  1JY2 O;  1H88 A;  2IX7 C;  1R5S A;  4U3F J;  1P84 H;  5EFW B;  1S1C X;  4Y99 C;  1VQ9 P;  3RK2 C;  1KQS O;  3EQQ A;  1IFM A;  1LP1 B;  1LTT C;  4QDF B;  2IFM A;  4H44 C;  1FU1 A;  2OYH A;  4RO0 A;  1VQ4 P;  3CMA P;  2M8R A;  3HTK A;  2YNY A;  3AE3 C;  1YQ3 C;  3L73 D;  4I1L A;  5KLV K;  4NBA D;  4OH8 B;  1VPC A;  5CHX A;  1L0L J;  3ITK A;  1NTK K;  1SQQ J;  5CCG A;  1O7M A;  4NBB D;  1L4A B;  3H1J J;  2Q3I A;  1CI6 A;  4WVZ A;  4JYC A;  2O1K A;  2V7Q J;  1OVR A;  3HUS B;  1FDI A;  4XA4 A;  2Y0E A;  1J1E B;  1KYO D;  2HMN A;  2WIT A;  1SJG A;  4JQ0 D;  4Z1M H;  4C7N A;  4D6T D;  3LID A;  4HJG H;  2QSI A;  3RL0 B;  3P8M C;  1LP1 A;  1VM9 A;  3CX5 H;  3A0H E;  1GW4 A;  3D6Y A;  1JY2 N;  1LWU A;  3PRJ A;  1SQB K;  2RH0 A;  3Q2Y A;  1RH5 B;  2HMK A;  1L4A C;  2A06 G;  1IFD A;  3HE5 B;  3RL0 C;  2XNX A;  2CKF A;  1NTZ K;  3CWB D;  5BU8 B;  3VN0 A;  1MKM A;  5BOK A;  4HM4 A;  3HE4 B;  3WUU A;  2BCC D;  3EFG A;  3ZDM A;  1PP9 G;  4YTP C;  1GTW A;  3G4S P;  3GKE A;  5TIS H;  3S1K A;  2WPR A;  2FKW B;  3GCE A;  2IBZ I;  4QMA A;  3FXD A;  2HMO A;  3MHV A;  1FZC C;  1Y8A A;  2Q6Q A;  4GT1 A;  2HMJ A;  1K9M Q;  2WT7 B;  5B5E H;  3AE8 C;  2LR2 A;  3E1I A;  2I8D A;  1SQP D;  2HMM A;  2K88 A;  2IZ1 A;  3LW5 J;  1HVV A;  2DE5 D;  1LTS C;  2P10 A;  3U1A A;  1BDD A;  2HPC B;  1LTA C;  5AVU B;  1BGY D;  4Y28 J;  1NKN A;  1DIP A;  3D71 A;  3FOU A;  1NTZ E;  3PH0 A;  5BVZ A;  4EIJ A;  1YIJ P;  1CZQ A;  5AEU A;  3LW5 H;  1S4X A;  3VMY A;  1N7S A;  2OGU A;  3CCS P;  4IL6 H;  3CCR P;  3L71 J;  4WY4 D;  3SFD C;  3QH9 A;  2LXB A;  1KB9 D;  5KJ7 D;  1N73 C;  2HYN A;  2R3C A;  3TSI A;  3H1L D;  4DJG A;  3C9I A;  1IJD B;  3VMG D;  3O6Q A;  4NPF X;  3RK3 B;  4XFJ A;  3CC2 P;  2E75 D;  5APQ A;  1PP9 D;  3GTS A;  1BGY E;  1IK9 A;  5CBN A;  4R4L A;  2JZA A;  1LTJ A;  4D6T E;  2A06 E;  4IFF A;  3EFF K;  2OTJ P;  1SQV E;  2KLV A;  4EOT A;  1L4A A;  2W6B A;  1LTJ C;  4OGQ D;  2O01 N;  1NTK D;  4QUQ A;  5AW7 B;  2FYU G;  1SLQ A;  4QDD A;  5CCH D;  2OYI B;  3M0D A;  3G71 P;  1YJW P;  2M5A A;  4N3Y B;  4GOD A;  2NVG A;  2KIK A;  1FZG A;  4QCK A;  3S4R A;  1KQL A;  1VQ5 P;  1ZN5 A;  2YVJ B;  3H1K E;  2W8Z A;  1PL5 A;  4DT0 A;  4KT0 J;  3P8C D;  3GHG C;  4H44 D;  1P84 I;  3GW6 A;  2C0W A;  2GUV A;  3A7O A;  3KHU A;  3M9Q A;  1LTG C;  5AW1 B;  1R8E A;  3EN1 A;  1YI2 P;  3B5N C;  4BXL A;  3SWF A;  4HJL A;  4HM2 A;  4ZKP A;  5KAI E;  2Z5I A;  1RY3 A;  1W5C E;  3L73 G;  2FBW C;  3MGN A;  4L73 A;  2B9B A;  3L35 A;  1FAV A;  2K9J A;  2WWW A;  2SPZ A;  3EWK A;  2WSC J;  3RK2 B;  5B66 H;  3O8Z A;  2R3S A;  1N7S D;  2POH A;  1QGK B;  1S5L H;  3TF5 A;  4NBC D;  1K04 A;  2E76 C;  2YKQ A;  1EZV E;  1O7H A;  4AUW A;  4WY4 C;  1SVF A;  2KOG A;  3B71 A;  2KNC B;  2GBX A;  2R5B A;  1AVO A;  1RE3 A;  5KKZ C;  1G8K B;  5CCG C;  2IDB A;  4L74 A;  3G3Z A;  4GOF A;  1YJ9 P;  1EZV D;  3CC7 P;  2IYO A;  1CW5 A;  5GTH H;  3P8C E;  3MZW B;  1L0L D;  3H32 B;  2PAJ A;  1H0T B;  4ZKU A;  1JY2 P;  1KB9 I;  4YXW H;  2L91 A;  2XV5 A;  2HLO A;  3GL2 A;  1R5L A;  2WPV B;  4HM5 A;  1FE6 A;  3S9O A;  1SQB D;  5TJH A;  4NPE A;  3CI9 A;  1PFI A;  3CC4 P;  4XE5 B;  4I7Z B;  2ZT9 B;  2V7Q H;  1SQV D;  1KQG B;  3HUS C;  1NGM B;  1EDL A;  1K8A Q;  1BGY G;  1AQT A;  1NTK E;  5AVR B;  1KOR A;  2FY8 A;  2QM8 A;  5APU A;  1Y9B A;  3GB4 A;  4GDO A;  1FZA A;  3AEC C;  1ZW0 A;  3VMI D;  4WWI A;  2NPS A;  2IBZ E;  1WT6 A;  4PJ0 E;  1JNM A;  2B89 A;  3OAK A;  1NJI Q;  3KDP B;  4P1C H;  2AXT H;  3H1I D;  2RKL A;  4HM6 A;  2ZXE B;  3AEB C;  1S5L X;  5E79 H;  1L0N J;  1IK7 A;  4YXD C;  3L75 J;  3V2N A;  4JYB A;  3F5H A;  2NRG A;  1PZQ A;  4O9B A;  1FZC B;  1ZV8 A;  1HGV A;  1NKZ B;  3G6E P;  1NTZ J;  2YIU C;  1S3J A;  3KQG A;  3AE5 C;  3SSU A;  1ZOY C;  5AW2 B;  1AJY A;  2JJL A;  3VMA A;  2YIU B;  2N9Y B;  3MUD A;  4Y99 B;  4ZMD A;  1SQP G;  3Q3D A;  2W6A A;  2FYU J;  3AE4 C;  2B24 A;  5KLV E;  4H44 B;  5KLI C;  3TGU E;  2RMZ A;  3MP7 B;  1Q2N A;  4UB6 E;  1KTM A;  1LGH B;  1Y47 A;  3H1L J;  3Q5P A;  5KKZ B;  3RBX A;  2YO2 A;  3OW2 O;  1KQF B;  1HBW A;  3V2Q A;  1NAF A;  1BGY J;  3L74 E;  2C0X A;  3PHL A;  1KZU B;  1GMJ A;  4K3A A;  3H1I G;  4EI2 A;  4HYT B;  2P58 A;  1KC8 Q;  3RK3 C;  1G1J A;  2OTL P;  1EDJ A;  3L72 E;  1KIL C;  4ZNC A;  1JY3 O;  2Y9Y A;  2WT7 A;  5AVZ B;  1KIL A;  2AEJ A;  2WSC H;  2IBZ G;  3Q1M A;  4HM8 A;  4JPZ B;  1L0L K;  3L70 J;  1DEE G;  1Q90 C;  1SP4 A;  3T97 B;  1KFN A;  1JY3 N;  1U7M A;  2QG4 A;  1SQP J;  4IL6 X;  2FYZ A;  1O7N A;  3VTP C;  1IFI A;  2QJK B;  2ZVO B;  3ABV C;  3CCE P;  3VOP A;  1OXZ A;  2KYV A;  4IL6 E;  1JM1 A;  1RF1 C;  1NTK G;  1L0N D;  1KIL E;  2JWD A;  1X8Y A;  1VQP P;  1N2D C;  1RQV A;  3BCC E;  1S2E A;  2OYI A;  4GKG A;  2LKM A;  4W7Z A;  4LC1 A;  3H1L E;  1PPJ E;  3GZX A;  2ZXX A;  1M7L A;  2CPB A;  3H1H J;  3DQY A;  3GHG B;  2ZFC A;  1NHL A;  1ZR4 A;  1EG9 A;  1ULJ A;  5KTB A;  3B5N D;  3L70 D;  4AYC A;  1SFC A;  3Q5R A;  4QDF A;  2Z4E A;  2XSH A;  3L71 E;  1E5W A;  1FOS E;  3FX0 A;  3D6Z A;  3PLN A;  5DJU B;  1OW8 A;  2HR3 A;  2P2U A;  5AW0 B;  2OYH C;  1URQ A;  2XND H;  2BCC E;  1HTL C;  3VP8 A;  2ZAE B;  1L0N K;  1T3J A;  3A3Y B;  4KHX A;  1J2J B;  4PV1 D;  4AIV A;  3L70 E;  2YO3 A;  2XZR A;  1PGQ A;  3P32 A;  1SFC C;  1T2K D;  3WU2 H;  5BU5 A;  4AQR D;  1PGO A;  2BMR A;  2KK7 A;  2CPS A;  1EXJ A;  5KAI H;  1XTC C;  4N78 E;  3RBZ A;  2ZYD A;  3QWO C;  1NO4 A;  1RIE A;  2JO1 A;  2ZVN B;  3IN6 A;  1BCC E;  1EC5 A;  1HUC A;  3GZY A;  2DE6 D;  2HFE D;  2WVR A;  1VQK P;  3CWB E;  3HD7 D;  3VP9 A;  2ZT9 D;  3CXH E;  1N8R Q;  2XSO A;  4B86 A;  3HUS A;  3N4X A;  3D70 A;  3V4Q A;  1LJ2 A;  5KJ7 C;  1L0L G;  1DH3 A;  3VMX A;  1BCC D;  4BRY A;  5L8R J;  1SQX D;  5E79 E;  2A45 G;  1FDM A;  2ITA A;  5APV A;  1Q86 Q;  2IPP A;  5CMZ A;  2FFD B;  2WSS H;  2M3B A;  2E5Y A;  1USE A;  1OW6 A;  2AEF A;  1NTZ D;  2IZ0 A;  3SFE C;  1QLE D;  2HPC A;  2E4P A;  1K05 A;  1XTG B;  2WSE H;  3P7K A;  4HB1 A;  2NWF A;  3AEE C;  1SQV K;  3BRV B;  1L0N E;  1AV1 A;  3H1J G;  1VCK A;  1LWU B;  1HJB A;  2N9B A;  1EDI A;  3FWL A;  1T3U A;  2KSE A;  1SQX K;  3A0B E;  5AW9 B;  2FYN C;  3CCU P;  2WZ7 A;  3HE5 A;  3VCP A;  3C1L A;  4W7Y A;  1GL2 D;  3AE9 C;  2UWJ E;  2YKP A;  1CSB A;  1TU3 F;  1VF5 C;  4DCK A;  5CXM A;  2QJK C;  1S5L E;  1T8Z A;  3BAT A;  1SQP K;  3H32 A;  1G2C B;  2QEX P;  1HJ0 A;  3JC2 2;  4UB6 H;  2PFX A;  2NZ2 A;  2K9J B;  3RGU A;  2NPS D;  2FFD A;  1GL2 B;  1YJN P;  3MUD C;  2H89 C;  1FOS F;  3GHG A;  1BSH A;  4TLF A;  1NYH A;  3WU2 E;  1RFS A;  2B1X A;  2XU6 A;  2H43 A;  4CPG A;  5AW3 B;  3CCL P;  4NB9 D;  4U3F D;  1OMI A;  1KYO I;  2E76 B;  4U7J A;  3VYI A;  1BE3 G;  3T97 A;  3L73 E;  4PV1 C;  5KAF H;  3I5C A;  2E5T A;  1N73 A;  4K35 A;  3V5B A;  3CWB G;  2HML A;  1MFT A;  5AVQ B;  2Q9I A;  3L71 D;  2FXO A;  2KS1 A;  3RL0 g;  2O01 H;  2QRX A;  2G3A A;  1M90 Q;  4TT3 H;  2D2C D;  3L70 G;  1X22 A;  1ULI A;  4DZO A;  3BAS A;  1LTJ B;  2KUB A;  2NVE A;  3M9B A;  2LXC B;  2FXM A;  4W80 A;  2OAR A;  2FYU K;  4KJM A;  1VQL P;  2YKO A;  2W83 C;  1SQX E;  4H13 D;  2WSE J;  3O6Q B;  1ZRT D;  1QVF O;  1RF0 A;  2E76 D;  1Q7Y Q;  2QJY B;  2YFI A;  1CI6 B;  1A02 F;  1NU1 D;  2QJP B;  5K5G B;  1UUV A;  3NMD A;  3AED C;  2Q5U A;  1W2E A;  2NPS B;  1KIL B;  1NAY A;  1ZP0 C;  3H1I J;  2E42 A;  2V4H A;  3TNU A;  1DD3 A;  3IR9 A;  3GF3 A;  3RK3 E;  1HF9 A;  2K3R A;  1Q90 D;  2OYO A;  4ASW A;  3L36 A;  4OVN F;  3PP5 A;  2PP6 A;  4H0L B;  2H8P D;  3SWK A;  3CX5 D;  2Y9Z A;  2ZYL A;  4WB4 A;  1QVG O;  5AVT B;  3RL0 D;  3TK1 A;  1NU1 E;  5CCG D;  1KIL D;  3HD7 A;  1GU5 A;  4OGQ B;  2J58 A;  3PTZ A;  2O3J A;  1YTZ I;  2KB7 P;  3V2R A;  4C46 A;  3C0D A;  2NPS C;  4R4M A;  1VF5 B;  2YMY A;  1VL2 A;  2A06 D;  2XR8 A;  1SQQ G;  2WPS A;  1GL2 A;  1SQV J;  2AEM A;  1PGJ A;  4WY4 A;  2AXC A;  2YXQ B;  3AEA C;  1A02 J;  1Q82 Q;  2KI7 B;  1WMK A;  4D6T J;  2B87 B;  1GL2 C;  1KMI Z;  1LT9 C;  3M06 A;  4PD4 D;  2KNC A;  3H1J D;  2HOD A;  1YHQ P;  3CPW O;  2BMO A;  2A45 I;  2WSF H;  1PP9 J;  2PRR A;  4UB8 H;  1FZF A;  1SQX G;  2KS1 B;  3U1C A;  1BE3 E;  3L73 J;  1SQV G;  1ZLL A;  1KB9 E;  1RE4 C;  1UUW A;  4EDF A;  2K1A A;  1NTZ G;  1NTM E;  2JKV A;  5H2F E;  3B5N A;  3GLM A;  1N73 B;  4HM3 A;  2FYU E;  1O7G A;  3BCC D;  1OIP A;  1EQ7 A;  2XDJ A;  2WMM A;  3IF4 A;  1MV8 A;  3A0B H;  1LTB C;  3TGU G;  1PPJ D;  3JCU E;  1JMM A;  1EDK A;  1J1D C;  5GTI E;  2OTK E;  2AXT E;  4ASV A;  4JF7 A;  2JWA A;  3CXH D;  2Q3E A;  2P7J A;  2E74 C;  4OGQ C;  1AA0 A;  3GOB A;  4NB8 D;  4L76 A;  1RE4 A;  5AVV B;  2WPQ A;  3OJA B;  1GZL A;  3NFQ A;  4I7Z C;  1M8O B;  3M0D C;  3L72 J;  3H1K D;  3L72 G;  3A5T A;  2D2C B;  3L71 G;  1JEK A;  1SQP E;  5APT A;  2WTY A;  1IO4 A;  1FJK A;  1OX3 A;  4H0L C;  5DJT B;  3C8V A;  2E43 A;  1SQQ E;  1G1I A;  1LT9 A;  3GL0 A;  5KLV G;  4RES B;  5AVS B;  2D2C C;  5AW5 B;  1M57 D;  2B88 A;  1JO5 A;  2YFJ A;  1ZRT E;  3CCQ P;  1NH4 A;  1KV4 A;  3AE6 C;  4RJT A;  1P84 E;  1X79 B;  1OFC X;  2K37 A;  2KLU A;  2P67 A;  4IFM A;  3AZC A;  2C9L Y;  3CXH H;  1BCC J;  1JUN A;  3H1I E;  1NU1 G;  1FS0 E;  1HWT C;  5B66 E;  4MN4 C;  2L5G B;  3GMA A;  3GG2 A;  2I7F A;  1KB9 H;  2HG5 D;  3AE1 C;  2N1T D;  1O7W A;  3U59 A;  4P1B H;  1ZXG A;  4H13 C;  1JM0 A;  4BWN A;  1M1J B;  3CCJ P;  1NOH A;  2QA4 P;  5AW6 B;  5B5E E;  2QIW A;  1H8A A;  1FZE A;  2NUK A;  1W2B O;  1WQL A;  5AEW A;  1EZV G;  5CCH A;  3V6I A;  2DE7 D;  1M56 D;  3AEF C;  2YXR B;  1LNQ A;  1NWQ A;  1EZV I;  1NU1 K;  1KN7 A;  1URQ D;  1QL2 A;  2GUS A;  3H1H G;  1M1J C;  3K5B A;  1SQB G;  3CLQ A;  4OWF A;  2N1T A;  1P84 D;  3HE4 A;  1FQT A;  2C9N Y;  1PP9 E;  2Y0C A;  3L75 E;  3AE7 C;  1G2C A;  3MD0 A;  4QUP A;  3L4F A;  4HH2 A;  1N7S B;  1GD2 E;  4JBZ A;  3LIE A;  2RN0 A;  2A45 H;  1KFM A;  2Q1K A;  2FFD C;  5KJ7 A;  3FXE A;  3V2P A;  1LWU C;  2JDI H;  2JO6 A;  4M3L A;  2YFL A;  1YIT P;  2Y0D A;  3TGU J;  1UIX A;  3NXS A;  2GM4 A;  4H0L D;  4U3F G;  1BSN A;  3UIA A;  3NTN A;  1NTM J;  2GA1 A;  1RF0 C;  1DX7 A;  1AVY A;  2Q3W A;  1IC2 A;  1WRG A;  3F89 A;  2BCC J;  4NBE D;  1S9K E;  1URQ B;  1GK4 A;  1PIX A;  1JB0 J;  2QE7 H;  2CK3 H;  2KSJ A;  5AW8 B;  2DW3 A;  1GW3 A;  4GOE A;  3EQ2 A;  1BDC A;  1SS1 A;  1VF5 D;  2OYH B;  1YBK A;  2XRX A;  3B5N B;  4UB8 E;  3D89 A;  1ZR2 A;  2R5D A;  1YQ4 C;  2BAS A;  2WSF J;  3HTK B;  4N78 D;  4NPD A;  1S9K D;  3WMM 0;  1MZ9 A;  1SQX J;  1MFZ A;  1IFN A;  2BEZ F;  2BEQ D;  2YMK A;  2KXP B;  3M91 A; 
#chains in the Genus database with same CATH homology
 2WSE J;  1O7M A;  4NBB D;  2E76 D;  2YFI A;  2YIU C;  1UUV A;  4NBD D;  2V7Q J;  3AE5 C;  1ZOY C;  3AED C;  1FDI A;  4QDC A;  2HMN A;  1AJY A;  1SJG A;  3H1H E;  4Z1M H;  3AEG C;  1ZP0 C;  1ZME C;  2QSI A;  3Q3D A;  1DD3 A;  1VM9 A;  3GF3 A;  3RK3 E;  1HF9 A;  1Q90 D;  3D6Y A;  3AE4 C;  2B24 A;  3Q2Y A;  4H0L B;  5KLV E;  3Q5S A;  4H44 B;  2HMK A;  5KLI C;  2ZYL A;  3TGU E;  1NU1 E;  3N0Q A;  2CKF A;  1KTM A;  4OGQ B;  1MKM A;  2JP3 A;  3Q5P A;  5BOK A;  4HM4 A;  1NDO A;  3C0D A;  4YTP C;  1KQF B;  4R4M A;  3GKE A;  3L74 E;  1VF5 B;  1VL2 A;  2OQQ A;  1GMJ A;  3VCA A;  2XR8 A;  3GCE A;  2QJY C;  2K9Y A;  2HMO A;  4QUR A;  3L72 E;  1SQB E;  2HMJ A;  3AEA C;  1WMK A;  3AE8 C;  3Q1M A;  2G8Y A;  1KMI Z;  4HM8 A;  2ZT9 C;  2HMM A;  4NBG D;  1Q90 C;  3T97 B;  3LW5 J;  4PD4 E;  2DE5 D;  4AAY B;  2BMO A;  4IL6 X;  1O7N A;  2P10 A;  3ABV C;  3AE2 C;  1JM1 A;  4Y28 J;  1DIP A;  1BE3 E;  3D71 A;  3FOU A;  1KB9 E;  1UUW A;  1KIL E;  1NTZ E;  2E4Q A;  4U3F E;  1RQV A;  1NTM E;  3BCC E;  1G8J B;  5AEU A;  3GLM A;  4HM0 A;  4HM3 A;  2FYU E;  3H1L E;  1PPJ E;  1O7G A;  3GZX A;  2MKV A;  3SFD C;  3DQY A;  1ULJ A;  1EG9 A;  3GTE A;  2E74 D;  4HM1 A;  3Q5R A;  3VMG D;  1RQU A;  4QDF A;  2H88 C;  3O6Q A;  4HKV A;  4XFJ A;  2E75 D;  2XSH A;  3L71 E;  2E74 C;  4OGQ C;  3GTS A;  3GOB A;  4NB8 D;  4R4L A;  2JZA A;  3D6Z A;  2A06 E;  1OW8 A;  4I7Z C;  5M1B A;  2NVF A;  2BCC E;  1SQV E;  2D2C B;  2NUM A;  2E75 B;  4OGQ D;  1SQP E;  1EXI A;  3R4Y A;  1OW7 A;  4QUQ A;  4H0L C;  4PV1 D;  3C8V A;  4AIV A;  4QDD A;  3L70 E;  1SQQ E;  1PV3 A;  3GL0 A;  4NBF D;  3G9R A;  4NBH D;  2D2C C;  2NVG A;  2WQY C;  2BMR A;  2YFJ A;  4QCK A;  2GBW A;  1EXJ A;  4PV1 B;  1ZRT E;  2E74 B;  2QPZ A;  3AE6 C;  2YVJ B;  3H1K E;  1P84 E;  1RIE A;  2JO1 A;  4RKU J;  3IN6 A;  5HL4 A;  1BCC E;  3AZC A;  1PL5 A;  1KYO E;  4KT0 J;  3GZY A;  2DE6 D;  3H1J E;  1FDO A;  4H44 D;  1O7P A;  3VMH D;  3CWB E;  2E75 C;  2ZT9 D;  3H1I E;  3CXH E;  1R8E A;  3EN1 A;  2XSO A;  4HJL A;  3GMA A;  2I7F A;  4HM2 A;  3D70 A;  3AE1 C;  5L8R J;  1O7W A;  4P1B H;  2FBW C;  4H13 C;  3EWK A;  2WSC J;  1OW6 A;  3H25 A;  2QIW A;  3SFE C;  2NUK A;  2QJP C;  4NBC D;  1K04 A;  2E76 C;  2E4P A;  1WQL A;  1K05 A;  4HM7 A;  5AEW A;  4EMJ B;  2NWF A;  1EZV E;  3AEE C;  1NYK A;  2DE7 D;  1L0N E;  1VCK A;  3GF7 A;  1O7H A;  3AEF C;  3B71 A;  2GBX A;  2FYN C;  5KKZ C;  3VCP A;  1G8K B;  3AE9 C;  2IDB A;  2J5U A;  1DD4 A;  3CX5 E;  1TU3 F;  1VF5 C;  1L0L E;  4H13 B;  5CXM A;  2QJK C;  1FQT A;  1PP9 E;  1U57 A;  3L75 E;  3FGA D;  3AE7 C;  2FXP A;  4QUP A;  3IAO A;  1HJ0 A;  2NZ2 A;  3GL2 A;  2WPV B;  4HM5 A;  2H89 C;  3S9O A;  1NYH A;  1RFS A;  2B1X A;  2JO6 A;  2BMQ A;  4I7Z B;  2ZT9 B;  4NB9 D;  1KQG B;  1OMI A;  2YFL A;  1NGM B;  2O01 J;  2E76 B;  4U7J A;  1NTK E;  1UIX A;  1KOR A;  3L73 E;  4H0L D;  4PV1 C;  1Y9B A;  3GB4 A;  4GDO A;  2HML A;  2Q3W A;  3AEC C;  1S1C X;  4NBE D;  3VMI D;  3EQQ A;  1PIX A;  1JB0 J;  3RL0 g;  2IBZ E;  2G3A A;  4QDF B;  4TT3 H;  2D2C D;  4H44 C;  1VF5 D;  4P1C H;  1ULI A;  2XRX A;  4HM6 A;  3D89 A;  3AEB C;  1S5L X;  1YQ4 C;  2WSF J;  1YQ3 C;  3AE3 C;  1IK7 A;  2NVE A;  4YXD C;  4NBA D;  1SQX E;  2BEQ D;  2BEZ F;  2YMK A;  4H13 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...