5KOIA

Crystal structure of a possible enoyl-(acyl-carrier-protein) reductase from brucella melitensis
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
271
structure length
271
Chain Sequence
b'EGLMQGKRGLIMGVANNHSLAWGIAKQLAAQGAELAFTYQGDALGKRVKPLAEQVGSDFVLPCDVEDIATVDAVFEEIEKKWGGLDFLVHAIGFSDKTELKGRYADVTTRENFSRTMVISAYSFTEVAQRAEKLMKDGGSILTLTYGGSTRTIPNYNVMGVAKAALEAMVRYLAADYGPQGIRVNAISAGPVRTLAGAGIGDARAIFSYQRRNSPLRRTVDIDDVGKSAVYLLSDLSSGVTGEIHFVDSGYNIVSMPTLEELKSSDSERGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH]
publication title Crystal Structure of a Possible Enoyl-(acyl-carrier-protein) Reductase from Brucella melitensis
rcsb
source organism Brucella abortus biovar 1 (strain 9-941)
molecule tags Oxidoreductase
total genus 100
structure length 271
sequence length 271
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2016-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 5koiA00
4ALMA 3O8QB 2NM0A 1P0CA 1YGYA 2VNSA 4HUJA 1EFKA 2V6BA 2X9GA 3DZKA 1OMOA 1BTOA 2ZJ0A 3HN2A 3ON5A 4IUYA 4QX6A 4YJFA 1G1AA 1Z74A 4GBJA 4AVYA 4J0EA 3PHGA 1NWCA 4ALLA 1C14A 3JQGB 3KYDB 4HADA 3GPIA 2X0NA 2O7SA 3WQRA 1NBOA 1B2LA 1MLDA 3B1FA 3HFGA 3WGYA 1A4UA 4RLSA 2O7QA 4HNHA 1UDAA 1VKNA 3DTYA 3QHAA 4TMFA 2QRKA 4HFMA 2FWMX 3E82A 1YQXA 1R37A 3S2EA 4YTEA 3L9WA 2E49A 4C4OA 4EITA 4GVXA 3TZCA 4CM7A 3F5QA 2JD2A 3K30A 5A1TA 1V9LA 1E7WA 4H3VA 4NBRA 1X0XA 1ISIA 4DPKA 5L9AA 1E6UA 4IDGA 4BNTA 4PLVA 3HN7A 4EJ0A 3WYCA 4KUGA 4WUVA 2C59A 2GDZA 4TKMA 2B5VA 2GPTA 1R66A 1Z75A 2Z1NA 3QJ5A 4NZ9A 5JCJA 4YT2A 1EK5A 1QYXA 3R6DA 4OAQA 3W1VA 4TVOA 1LTHR 1NFQA 2UV8A 4ZICA 1IL0A 4PLTA 3W8FA 1A9ZA 4R1UA 3E18A 1K6JA 4BO3A 3OETA 4B4OA 4YAGA 3JQCA 1PR3A 1YXMA 1ADCA 1WP4A 1I3MA 3QV1A 3C24A 1DSSG 4GI2A 4MVJP 1UZLA 1UXGA 1VC2A 4XQGA 1C0KA 2GGSA 3HADA 1CRWG 4XB2A 4NR0A 4J90A 3IUPA 4JBIA 4LGVA 1FDWA 5G0WA 2AEFA 2YFQA 4DQVA 1LRJA 1NAHA 3L77A 2W4QA 1PJQA 3K9QO 7MDHA 3JQ8B 4UVIA 1O9BA 5TJ9A 3KEOA 2UVDA 5T67A 3UKOA 1HT0A 4GGOA 5HA5A 3S2GA 5GMOA 3L4BA 1WDMA 3COSA 2O3UA 3ROKA 2O48X 1C3VA 1OZAA 1E6WA 2AQIA 3CTMA 1A7AA 3FHLA 4LMRA 1A72A 5F1KA 4D46A 2Y66A 4CM8A 2J8ZA 3S2IA 2FPPA 4E12A 2RH4A 3HDJA 1N1EA 2JFFA 2BGLA 2HSDA 2GERA 2YHIB 3QVWA 1FK8A 4XGKA 4CM4B 3Q3CA 4TKLA 4CQMA 2GO1A 1JWAB 3X2FA 1P1RA 1I5RA 1PS9A 1ZBQA 2B0JA 4ILKA 3FI9A 1VJ0A 1YS4A 3ZU2A 4QO8A 4RF2A 4WKGA 4BGIA 1SAYA 4YQYA 3SVTA 3ROPA 2J5QA 2VUTA 3QY9A 3DXFA 4NPCA 3ICCA 3NKLA 1U2GA 2CVZA 1MX3A 2TMGA 5L95A 5B37A 2VQ3A 1QLHA 2DTDA 4JXKA 4N54A 4AJOA 3TRIA 4G65A 4OQZA 3V2UA 3AM3A 3KSDO 2I6TA 1N92A 3S2FA 3V5NA 4JN6B 1O89A 4IDAA 4FJ2A 4GKBA 3BMNA 2ZKLA 4L76A 4WPGA 2YV3A 3TSCA 1B7GO 1B0AA 4BOYA 4DQXA 2EEZA 3IQDB 4GWGA 1P1KA 2FPGA 1Q0HA 4RZIA 4UVHA 2VHZA 3CE6A 1PL6A 1B8VA 4XZ3A 1E3LA 2D3TA 2ZB8A 4IIUA 1VKOA 1XG5A 2RHCA 3EHEA 4MIEA 9LDBA 1JN0A 4W6ZA 3WGIA 1V8BA 1KEPA 2PKRA 3K2EA 3K96A 1RPNA 2CDCA 2Q4EA 4CV0A 1PJBA 4WLEA 4FD3A 1E0DA 1K5HA 4DYDA 3Q1LA 3VC7A 2CDAA 3TNLA 3ENNA 3ZWCA 1ONNA 1ADFA 4OMUA 1VL8A 4L4XA 4ZVVA 3ZNQA 4BNWA 4E5NA 1ZEMA 4RVFA 4GX2A 4I5DA 3VTZA 2Y99A 1GY8A 3D4PA 2C2XA 3T7CA 3TFOA 4XQEA 4AJ4A 2DVMA 4GX0A 5LDHA 1ADGA 3ANMA 1O0SA 2PKQO 3NT2A 4NIMA 5FF9A 5CG1A 4Y6PA 5ENDA 4OIMA 5CDSA 1PGPA 1HTBA 1HDOA 2GD1O 2JCVA 4KMSA 3EAGA 2I5PO 2IYOA 4WOKA 4BNXA 4ND3A 1YOVA 2C2YA 5KVVA 3A14A 1LBEA 4E5KA 1NR1A 1ZO8A 4DMLA 5CG2A 1GADO 1YDWA 4ZU3A 1DLJA 1BGVA 4WLNA 2HUNA 3VPSA 3ZHXA 1ZSYA 4DA9A 2FR0A 5G2OA 4DUPA 5BT9A 5EL0A 3IJPA 4G2NA 4YQZA 1KETA 4XR9A 4CUJA 3JD4A 1LX6A 3L6DA 4BQRA 5EESA 3T4XA 4B8WA 5MGBA 4PFJA 3D1LA 3L4BC 4UAGA 1IZ0A 3ST7A 3I9NA 1KVQA 1KC3A 5HTOA 4L0QA 3WFJA 4DIOA 4NK5A 1NP3A 1QYWA 3GDOA 4II2A 1NQ5A 2Z95A 1BHSA 1SOWA 4MVJF 2ZB7A 3GNQA 2GASA 1NASA 1LI4A 2BHLA 3QWHA 4LCEA 3DC2A 3BYZA 1DRVA 4OKNA 1Y5MA 1BDBA 1ISGA 2HK8A 3MJTA 2VTEA 2VRBA 5JMPA 4WNCA 1P1IA 2CVQA 1QYCA 4Q3BA 3ENKA 4O6VA 2D8AA 5JAZA 4ONEA 1U8FO 4R1NA 4J1QA 3E6AA 3I9KA 4GGPA 4BNVA 3QVXA 1QV6A 3IMFA 1WXDA 4UREA 5IDYA 1I32A 1I36A 2QYTA 2VYNA 2X23A 4MVJH 1MC4A 3MCVA 3TN7A 1Q7GA 1GFSA 3OP4A 2FHSA 2P5UA 2Y93A 4D3SA 4LK3A 4NBUA 4J9UE 3H7AA 2WE8A 2VOEA 3OF2A 3SBOA 1HYEA 3GVCA 3PHJA 1U2DA 4O63O 4PGFA 1KOLA 1JKJA 1MV8A 4GLOA 4NNJA 3WMWA 4WLVA 4Y9DA 2HJSA 4BO6A 1HDCA 3ANLA 5GZ3A 5IXSA 3PP8A 1ZJZA 3VDRA 1HRDA 2G76A 5CP8A 1V0JA 1GDHA 3GN2A 4CMKA 3VH2A 4L74A 1H2BA 1BVRA 4NU5A 3WBBA 5A3VA 3RBVA 4CMIB 2X58A 3EZYA 3RASA 1I3LA 1ONOA 2UYYA 4RJTA 3B70A 1YL5A 2QYSA 4MJLA 3LLSA 1SNYA 1CQJA 4Y8VA 5JO0A 2HKIA 3PQFA 4ZQBA 4TRRA 3TL3A 4CJXA 3OICA 3V2GA 4L73A 3WLEA 2VYVD 4QECA 5A9SB 2E37A 2QZZA 2AMFA 3KRTA 4KZPA 3KEQA 2DBRA 1V3TA 3PQDA 1HE4A 2C82A 1VSUA 3JTMA 1TT5B 4BO1A 3TWOA 2O50A 2EKPA 1E1LA 3L6EA 3OH8A 4FFOA 5JDIA 2VCYA 5KVCA 2DPHA 1KERA 3B1KA 1HZJA 2GNAA 1B8UA 3ZU5A 8ADHA 4FFRA 1BW9A 1EDZA 1HWYA 1LDMA 2BFMA 3AM5A 3FCOA 3PYXA 4PG6A 5IZ4A 3KVOA 1O6ZA 3I9JA 2CNBA 3NRCA 1X15A 1T24A 1BXGB 3AUUA 4E0BA 3V2HA 2ZTUA 5F3RA 4I5GA 4XA8A 4CMGA 1H6DA 3O38A 4HKTA 3JQ6A 4FC6A 3NDJA 3D3EA 4BO5A 3O9ZA 4NI5A 3GY0A 4E32A 3TL2A 4EW6A 3GMSA 1I2CA 4O0LA 2X1HA 3RUCA 1P3DA 2RAFA 1N9GB 1PZGA 1HLDA 2E82A 4Y98A 1LDYA 1PGJA 2Q1SA 1LSJA 4G81A 2BFOA 3FPLA 4HWKA 1IB6A 1SC6A 1KBZA 2WJPA 3PGXA 1CEQA 2VHWA 1HE2A 1UP4A 2JJYA 3DBRA 3DBHB 4IQGA 3RROA 3GNTA 1X7HA 3LSYA 1EVJA 3ZV4A 1XCBA 3WNVA 4MIOA 2XXJA 1XELA 4EEZA 4XR4A 3SLGA 3GN1A 5BNTA 3EVTA 4TROA 3CH6A 4FSHA 1DC5A 5A02A 4CUZA 1GZ6A 4URFA 3V1UA 4PG5A 1G0NA 1KEUA 3BZUA 4I9HA 4Z9XA 1YBAA 4XYEA 1J6UA 4M54A 3L4SO 3UH1A 4D45A 2C07A 2HU2A 3PWSA 4R5MA 1ZK1A 1ISFA 3DZIA 4K1LA 4MVJE 4CODB 1FDTA 5I9MA 3C8MA 4NH4A 4UUOA 1M66A 2WE7A 2DBQA 4U6SA 4B3IA 2RBEA 1SPXA 2ZYGA 4Z0PA 2NADA 5T57A 4D0SA 3H9EO 4R41A 4CMCA 3GGPA 2Q2QA 1VSVA 3IAHA 4CQMD 4FGSA 4IIVA 5JPIA 4OOFA 2Y05A 4MVJD 3QP9A 1DO8A 2BKAA 1GPDG 2AQKA 2CY0A 1ZK3A 3HDQA 4J49A 1UP6A 1LQTA 3BMOB 4IPTA 4MPDA 4PRKA 3H9QA 3LLVA 1DPGA 3QSGA 5F1PA 3TZHA 4DREA 2PA3A 1JVBA 3D64A 3QWAA 1PJ4A 5LDGA 4BMVA 1MP0A 3SJ7A 4YT8A 1A7KA 4GX5A 3E9MA 4YWJA 3UCEA 4DIFA 3L0DA 4ND2A 4BNYA 3D4OA 1LQUA 1ONPA 2QRJA 4IINA 5B12A 1KY5A 1O94A 3WYEA 3U09A 4M8SA 3TFQA 2O3QA 4IS3A 4IM7A 4YXFA 3EUWA 2FR1A 3DZBA 5JDIC 4LSMA 4TRMA 1M6WA 4U0JA 2P68A 2Y1EA 1FJHA 5IJZA 4XQ9A 1EVIA 2BLLA 3HSKA 5AXDA 1C0IA 5JNLA 2GN8A 4PVDA 4J6FA 1DLIA 4XDZA 1CQIA 4XJSA 1ZSVA 3P7MA 5T64A 2VHVA 1C1XA 4RLHA 4DGSA 1U4OA 1IHXA 1U5CA 1I3NA 4R3NA 3ZWMA 4ZD6A 4FFNA 4DYVA 3I9OA 3ZW9A 4BNUA 4CM1A 1CETA 1YQGA 2HCTA 5AYVA 5JAMA 1GV1A 5DCUA 3DAGA 4WCFB 3JQEA 4DLAA 4CLOA 1PJ2A 3DZFA 1SOVA 2J3IA 2Q1TA 3C7CB 3U4IA 2YHUA 4QO7A 3NYWA 3W6ZA 1P33A 1K6IA 3DFUA 2G1UA 5U9CA 1F8GA 1Y8RB 5C5IA 2P9EA 2HLPA 3E9NA 1ZSNA 3WR5A 3C7AA 4OQYA 1CF2O 1AE1A 2Y0DA 3GUYA 1LXCA 3C1AA 4HFRA 5KTKA 5DBIA 3ZGYA 1YWGO 1YE3A 3GZNA 2R00A 3KSUA 3HQ4O 1A9YA 4G5HA 4DQUA 2BELA 2GCGA 4OSPA 1QV7A 1UAGA 2FN7A 3DQPA 4GH5A 4ZA2A 3JYNA 2CSUA 4OXKA 4ZN6A 1LJ8A 3I9LA 1X1TA 3AJRA 4K6FA 1XLTA 3FPCA 2PGLA 4UUMA 5BQFA 1NX6A 3DZHA 3ZNOA 4JQCA 3QWFA 2Z1MA 4R54A 1ULSA 4I9UA 1KEVA 3HUDA 3V1YA 1M76A 4ALNA 4YYZA 3GVXA 2V7PA 3DL2A 5KIAA 2B83A 2I99A 1EBUA 3ZHBA 4JJIA 1TI7A 1SBYA 3GGGA 1D3AA 3VH1A 3NTRA 3OJLA 3U4CA 3QIVA 4AJJA 2DUUA 1CDOA 7ADHA 2J3KA 5CDUA 5FFFA 1PIWA 4FBGA 4O59O 4CR7A 3JQDA 4IQ8A 3JYQA 4NMHA 5KJFA 1E3WA 4UVEA 4RL6A 2CZCA 4CV3A 3AI1A 1EVYA 2IZZA 3UOGA 1SB8A 1VJ1A 3MZ0A 5JFOA 4XCVA 3DMYA 3ZZNA 3M1LA 3NT5A 4XQCA 4GVLA 3H9JA 1DC3A 4K26A 1LRKA 1V3VA 3ABIA 4DTIA 3Q0EA 2PNFA 2R6JA 4YT5A 3PTZA 3WFIA 4B4WA 5THQA 3KETA 1HYHA 5JXWA 3O8QA 5DT9A 1LC3A 4ZJUA 3FRJA 3TDKA 4JP3A 2CUKA 4BNJA 4E31A 4E5YA 3TZ6A 1IPFA 1B8PA 1O8CA 5B4VA 2W2KB 1I24A 1GD1O 4ZRNA 4EGFA 4F46A 1YB4A 4CLRB 5BNIA 3FR7A 1Y5RA 2O3SA 2X9NA 1CJCA 3ADPA 3E5MA 4FFLA 3JQGA 5DULA 3KYDA 1F8FA 1AGNA 2OOSA 1JLLA 1J0XO 2O3RA 1GR0A 4MINA 4QEDA 5L4LA 2YZ7A 3SX2A 1DRWA 1R6DA 5JCXA 2E6UX 3STHA 2X86A 3HB5X 4NFSA 5HRUA 3OA0A 3AFNA 3BTUA 1TT7A 4OL9A 4RVDA 3ROQA 4J9VA 4CR8A 4BVAA 1EQ2A 3BHIA 2P5YA 2HMWA 4CL3A 1IE3A 1XHLA 2SCUA 4L75A 3FNFA 5G4LA 5K6AA 3IKTA 4DPLA 3AUAA 2Q50A 1XU9A 2VYVA 1DFIA 3OEYA 1T2FA 2R00C 3R1IA 2I3AA 1T25A 3PJEA 3UVEA 1EBFA 2EERA 1JDJA 3WJ7A 8LDHA 1GCUA 1H5QA 1T26A 3JD3A 1K3TA 3QLJA 4FJ1A 3U5TA 2XXBA 1I01A 1LA2A 1Y7TA 2POQX 4BNHA 1Q0LA 2NNLD 2A92A 2BFAA 3DZGA 1NPTO 1DIRA 5IDWA 1PL8A 3DHYA 1P44A 4DXHA 1W8DA 3UCXA 4Z0TA 2X4GA 3CMMA 3FBTA 1T1SA 2YUTA 3MWDB 2HRBA 4YJHB 1PZFA 4OM8A 2DU8A 3RJ9A 3OM9A 5LCXA 4E2XA 3GUCA 1R12A 3WNQA 3CPSA 3ZWBA 3U4HA 2FMUA 5BSGA 1P0FA 4YCAA 3NV9A 4B79A 4ZHSA 3H3JA 4EJMA 4TWRA 1I30A 3JQ8A 2RH8A 4QTZA 4R9SA 4XYBA 3ZWVA 1NTOA 1R4NB 1XA0A 1U3TA 4F45A 4WLOA 1IZ9A 4ZRMA 3WTBA 4UVDA 4FW8A 5IN4A 5GY7A 1W73A 3GH3A 3LC1O 4OH1A 2VZ0A 1ZXBA 4E2ZA 2JKVA 5U4QA 4O1MA 4RVUA 9LDTA 2FZWA 4HXYA 1GYRA 5KNLA 2P4HX 1ZK4A 2YHIA 4GMFA 4N7RA 4CM4A 2WM3A 1DRUA 3MJEA 1CWUA 3F47A 4E6PA 2ZYAA 3OMLA 3QWBA 2YYYA 3KOUA 3U0BA 1ISMA 4MKXA 3ANNA 4WEOA 4J2OA 1EUDA 4BHTA 1R4MB 4PLHA 2D2IA 4JX8A 1UDCA 6LDHA 1CYDA 4M55A 5DN9A 3RIHA 3JQAB 3RC1A 2PGDA 1JVSA 1Z7EA 2FZEA 1UZNA 2A94A 5B1YA 5CAEA 4A27A 2GSDA 1EMDA 3S8MA 2UDPA 1QMGA 5TC4A 1IYZA 1Z73A 3MTJA 4HBGA 5B4TA 1YVEI 3PJGA 1KVUA 1N8KA 2LDBA 3LK7A 3PVZA 3GAFA 1E3JA 4FS3A 1GQQA 4BO0A 1E3SA 1GUYA 4IBOA 3ADOA 4MVJA 1HYGA 3ZH2A 3EDMA 3JQFA 1R0SA 3D3WB 1ZK2A 5ILOA 5TNXA 4OKIA 1MXFA 3F9IA 1B3BA 1Y8QA 2VZ9A 3O4RA 3ZV5A 4HX5A 3E9QA 1Y1PA 3PLNA 4WCDA 3S1LA 2V6FA 1IUKA 1I0ZA 1RM3A 3G0OA 5EJ2A 4IJKA 3FNGA 4QFDA 1RYEA 1BRMA 2D5CA 4AFNA 4J91A 3G49A 3I6QA 4KOAA 2YDXA 3I4CA 5BSFA 4BB5A 3VZSA 4J16A 1UDBA 1H6BA 2PD4A 4R51A 4ALIA 3WBFA 4XKJA 2QQ5A 3ZV3A 1PS0A 4XIYA 5JDCA 2D1YA 1XGKA 3PIDA 4O5OA 1ARZA 4Q3DA 5AQ1A 1OI7A 3INRA 1ZEJA 3GFBA 2F1KA 1C1DB 2ZB4A 3MJCA 5ADHA 1PL7A 2OL4A 2DUWA 2D4AA 3GA0A 3Q11A 1A71A 4KQWA 5AOVA 1GV0A 3VKVA 5AXAA 2PZJA 4D3DA 2NU9A 4FQ8A 2EGGA 4BKPA 2B35A 4XD2A 1P1JA 4PRLA 1E77A 1XU7A 4XX0A 3UAGA 2GF2A 4A0SA 1HDZA 1A27A 4CQLB 5ICMA 1A5ZA 3ETEA 1QSGA 4RGBA 2PGJA 1DOHA 2Z5LA 3VTFA 2FSVA 3KYCB 3UCFA 1SEVA 4KUEA 3RBXA 5TX7A 1Y6JA 1DC6A 4R16A 5JO9A 5CEEA 3BMCB 5ES3A 3VZRA 2DC1A 2GN6A 1E1NA 3FD8A 3WGOA 4PIVA 1GQ2A 1NNUA 4J2HA 4CLHA 2X7HA 1HSOA 2GZ1A 4E2WA 5HS4A 2QHXA 1WW8A 4KQXA 1E7SA 3GFGA 5G0VA 3OSUA 1GZ4A 2VRCA 1PGQA 2OP1A 3VHRA 1S6YA 3GR6A 1OC4A 4J43A 2P9GA 3B1JA 1EEHA 3SEFA 3DDNA 4IMPA 3DAFA 2NTJA 1NHGA 4XYGA 4D43A 2EWMA 1PSDA 2O4CA 4NJMB 3UXYA 1BDMA 2HMTA 4CV1A 3OFSA 3VPHA 2JHGA 1NVGA 1TLTA 2V6MA 3JV7A 1KVRA 3RFVA 4EBFA 1I2ZA 4XRGA 2YV2A 3N74A 3ZWXA 3U4DA 2HJRA 2QX7A 2OXIA 3GLQA 1IOLA 1JTVA 3OHSX 5L4SA 3TZKA 2B5WA 3WSVA 2BGKA 1LRLA 3QVOA 3ZWNA 2JAHA 1HDYA 4RPLA 4E4YA 3HJAA 4HY3A 2WD7B 1U8XX 5G4KB 3MJSA 1DFHA 3KV3O 1AXEA 2DQ4A 3M6IA 3JQFC 4BNGA 4A2CA 2O2SA 4MDHA 2EJVA 4KDEA 2EW8A 4AG3A 4R01A 2AE2A 4J3FA 3OQBA 3VZPA 2NVUB 2BI8A 3GG9A 4ITUA 3F4BA 2VZ8A 4A73A 3H5RA 3BHJA 1QRRA 4D0RA 4MP6A 1IHYA 1T1RA 3PWZA 4DRYA 1GU7A 1OOEA 5JAIA 3FSRA 3WGTA 4HFNA 2VWPA 1QKIA 2DBVO 3WQSB 1B16A 1YBVA 2PWZA 3L07A 4NG5A 1OFGA 4CM9A 1D1TA 1KY4A 4HP8A 3MWEB 4IJUA 3IP1A 5JDCC 3F5SA 4P4NA 3JQ7B 3GEMA 4DC1A 1BVUA 1JKFA 4BV9A 2PH5A 1UAYA 1LDBA 4X54A 2AG5A 4CM6A 3AI2A 2DFDA 1ENYA 4GKVA 4YRDA 5KVQA 4CM5A 5HWSA 5A3JA 2FP4A 5A9SA 3ONFA 3KTDA 1JAYA 3WMXA 1EE9A 3INGA 1TT5A 1HL3A 1E3IA 1FDVA 3NX4A 3V1TC 3K73O 3G1TA 2QW8A 4F6CA 1V3UA 3PLRA 4JP2A 3ZNPA 3H8VA 3BMQB 4PG8A 2ZCVA 4JROA 1HSZA 2Q1WA 1DDOA 3L6OO 3OIGA 3LC7O 4RF5A 3JCZA 1BXGA 4CUKA 3A28A 2JL1A 2PY6A 3OJEA 5T8KA 4DBVO 2NVWA 1NVMB 4B3HA 1FF9A 4YJGB 3F1LA 3CUKA 3ZU3A 2X0RA 4B7UA 1ZNQO 2VOJA 1PX0A 2IODA 2ZTMA 3NDRA 3I4FA 4D42A 1MA0A 1S7CA 2HRZA 1L7EA 5A5FA 4N5MA 1N9GA 4NFHA 1D7OA 5LC1A 2Y0CA 1P74A 3FR8A 4E13A 1N5DA 5T5QA 4Z9FA 5C37A 2J5RA 4U6QA 2IXBA 1PJLA 5JBIA 3PZRA 3EC7A 1ZVMA 4R68A 2AW5A 3FBGA 4WE3A 5JW6A 1LSSA 2Q46A 5THKA 3UUWA 3WGQA 4IZIA 3TOXA 4AJNA 3ITDA 4R1SA 3OQ6A 1K2WA 5DBGA 3RC7A 4Z9YA 5KVSA 4FJ0A 4KTVE 3CEAA 1R0KA 3DBHA 2OO5A 2I9PA 4PLWA 3DOCA 4D79A 1H0KA 3PRJA 3GEGA 3W8DA 5IZCA 4TRNA 1NPYA 4QFCA 3LC2O 2OMEA 4WLFA 1UJMA 3F4LA 1DJQA 1VLLA 1H9BA 3ZHYA 3EY4A 1DC4A 4Q3NA 4B7CA 4FR5A 3JQAD 5EQFA 3GOHA 4BO4A 3DTTA 3ZNNA 3PHLA 4JGBA 2EKLA 5TIIA 3QWIA 5G0TA 4GMGA 3OJFA 5H82A 4TVBA 4P38A 1LLCA 5GZ1A 3RI3A 2WMDA 5DOZA 3W8EA 3RUFA 4LRSB 2ZB3A 3PDUA 5TT0A 2G82A 4OO3A 1UXJA 4Z3DA 1DIAA 2AQ8A 3UF0A 3K92A 4U0KA 3RD5A 4DVJA 4CPDA 1SB9A 1DIBA 1NPDA 2GZ3A 4E2YA 1Z82A 3P19A 3GZ4A 1LNQA 2VTDA 4IJWA 3CMCO 2HDHA 4LW8A 1QXSA 1EQUA 3QW2A 2UUOA 4FCCA 4ZQFA 1PS8A 1W0CA 3SJUA 4J1SA 3IL2A 4NU6A 4U7WA 1GYQA 4YDRA 1Y9AA 4OYRA 2EHDA 1DHRA 3NTQA 1ZXLA 4NBVA 3E1KA 1QYDA 5CFZA 3D5TA 1M6HA 4JLWA 4CMAA 2B4TO 1O5IA 2IEBA 3O26A 3Q9NA 1HDXA 1NHWA 2J3JA 3UFXA 3WGGA 4YAIA 3KLPX 3RC9A 4XDYA 5A04A 3I3OA 3VVBA 1MXHA 5K0ZA 3PZBA 2Y1CA 3KLMX 1PQUA 1TA4A 5CPFA 5KJ6A 4BUCA 1DBVO 2C29D 4IMRA 1M75A 3WXBA 5L7WA 3E5RA 2FY8A 1GTMA 3AOGA 4E3ZA 4CMBA 5I9LA 1GAEO 4BGEA 4WCFA 4LSWA 3W6UA 1FDSA 1QLJA 2Y1DA 1NYTA 2Q49A 3WGZA 1NVTA 4B8ZA 3M2TA 2PZMA 4WLUA 2P9CA 4BO8A 1FXSA 3LT4A 1T2DA 3RUEA 4JJFA 4XWYA 4IJVA 1WZIA 1Y8RA 3ZCXA 1LUAA 4D41A 3CIFA 4QSMA 4WASA 4FPXA 5G0SA 1AXGA 4RQUA 2Q3EA 3N7UA 4XEHA 3KSZO 3PFFA 4AICA 2HQ1A 5DDIP 2GLXA 4AJEA 4CMEA 1HE5A 5C7LO 3PI7A 1VI2A 3DBVO 2J3HA 3ETDA 1LDNA 1ISJA 5IXYA 3LYLA 2H5LA 2JD0A 5IZCC 1ISHA 1I2BA 3LF1A 2B36A 1ZKMA 4YB8A 2W98A 3H6KA 1YJQA 4EDFA 3GK3A 4EYEA 2NV6A 1RKXA 3EMKA 1JU9A 1K0UA 3VPXA 1KYQA 1B14A 1N7GA 2JCYA 3R0IA 3SLKA 3ZI0A 3FTPA 1E1KA 3GNSA 3V8BA 4N5NA 3QVSA 5A06A 3K2BA 2O3JA 1WDLA 1YKFA 4FIZA 4GWKA 2CVOA 3GQVA 3MOGA 2C7GA 4MVJG 2ZCUA 5K9ZA 2Q4BA 5CDYA 2QG4A 5I8WA 3LZ6A 2I76A 1W6UA 4YAEA 2JFHA 4B4VA 2VRCD 1LC0A 3WWZA 3DBLB 1AHIA 2VUSA 2X0IA 2PZLA 4PLPA 2DFVA 4NBWA 3OIFA 3ITKA 1K6XA 1L7DA 4B3JA 3RUIA 3JD1A 3OIDA 1GQYA 3RSHA 3AUSA 1P45A 2PD6A 3NGXA 5COQA 4NJOA 1YO6A 1EE2A 3EVNA 4J1NA 1C0PA 3QVTA 4AJ2A 2YFHA 4FN4A 5CEFA 1Q0QA 1P77A 1Y81A 3IJRA 2PKQP 1ZMTA 2HAEA 3M1AA 2VHXA 4TQGA 4WECA 1UXIA 3JSAA 4INAA 1MG5A 2X22A 3G17A 1QR6A 2CDBA 5L45A 4ID9A 1EVZA 2CF5A 3BIOA 3G79A 2GUGA 4PZDA 4C7JA 4J7UA 2AXQA 4BKOA 1PR9A 4OHUA 2J5KA 1FDUA 3G3EA 2PTGA 2HMUA 3INTA 1ENPA 2PFGA 4BGUA 5IFLA 5CPBA 3LT2A 3PXXA 2XPCA 1T4BA 2I65A 1DJNA 4W9NA 4CMHA 4FFMA 1VE9A 2X5KO 2W2KA 3FWZA 3F46A 4J4BA 4FB5A 4P22A 1PWZA 4CLRA 1RWBA 4KUHA 3AOEA 2OUIA 1BWSA 3WB9A 5ILGA 4CM9D 2BFPA 2XF8A 3DZJA 2PZKA 2J6IA 3IKVA 4QUKA 3ASVA 2DBZA 5EPOA 1PWXA 2Q2WA 5IG2A 1RYDA 3GGOA 2CFCA 1OC2A 1YQDA 5CDGA 4DC0A 2R2GA 2FSSA 2VN8A 5J23A 1PJCA 2H1SA 2H63A 1SEPA 4NDNE 5JE8A 4CMEC 1X7GA 5G0UA 5BNFA 2W8ZA 1C0LA 1HKUA 3JD0A 4H15A 2HO5A 5ITWA 4IXTA 3K8ZA 2ET6A 1HETA 3TJRA 1ZFNA 3FF4A 1R0LA 3JQ9A 4WGGA 4D3FA 3NJ4A 3WGHA 4RO0A 3UHAA 5L4NA 3N58A 4J1TA 3I83A 5IDXA 3LQFA 3HFSA 4WNIA 3WQQA 3CINA 1MC5A 3OQ1A 5KJEA 4BNZA 2IYPA 4BQPA 2WTBA 2D0IA 3KYBA 1NXQA 3RWBA 3DOJA 5DBFA 3VOSA 3VH3A 4J4HA 1DIGA 4OSOA 3SC6A 4OXNA 4XIJA 2IRWA 1VRWA 4I1IA 4YJHA 1Y9EA 1HDGO 3DWFA 5A9TA 5IF3A 3D4NA 3AU8A 1QG6A 4FGWA 4NBTA 4DLLA 2Y1OA 3ZU4A 4CL8A 5I9NA 1YBMA 4LVCA 5IAAA 4OOEA 4M1QA 2BRUA 3SC4A 2G5CA 4RV9A 2X5JO 5B4UA 3K5PA 4U8GA 1T2CA 1Z7BA 2PR2A 4Z3KA 1N1GA 5L51A 4GL4A 3HZZA 3Q6IA 1R4NA 4GSKA 1RM4A 3GRPA 1X14A 5HS6A 1LDGA 2OBNA 2A4KA 2AE1A 4EUEA 4L4RA 1U7TA 5FEUA 4R69A 4AJIA 2CMDA 3DHEA 5C7IO 1ULUA 1BG6A 2I3GA 5I7FA 2YDYA 2NVBA 2B69A 2EP5A 3H3FA 4BB6A 1R15A 1B26A 4Y67A 4QT0A 4YT4A 4XJTA 2OZPA 5KCZA 2E48A 3WS7A 2X5OA 4BV8A 1LSUA 3WJAA 3FTNA 2WSBA 4AJHA 2DTEA 2X9VA 4BL5A 1R4MA 4S3MA 3BXXA 1VL6A 1EDOA 2XAAA 1V35A 1T2AA 5EN4A 4BIIA 3JQAA 2I66A 2VWQA 3F6YA 3ONDA 1SO8A 4RZHA 4W9NC 5CDTA 4YJFB 1U5AA 4J7CA 3RBZA 3WDSA 1Q1NA 5A9RA 4KTTE 4DPMA 3HDYA 3D7LA 1E7RA 1HLPA 2WYUA 3AOEC 1ID1A 3H65A 1HZZA 3LF2A 1U1IA 3WYBA 1KVTA 4BKUA 4QXMA 1H2HA 2DKNA 1H6CA 1MFPA 1WMBA 1GPJA 2G0TA 3Q9UA 2Y67A 1Q7BA 3Q2KA 3KHUA 4M86A 1WNTA 1T4DA 4CLXA 3ZWAA 3QA9A 3A9WA 3D3WA 5KKAA 2NLOA 5A03A 4Q9NA 2FOIA 4DIBA 1PGOA 1NFRA 3KB6A 2OFPA 4BNKA 3TQHA 1KVSA 1RM5A 4FC7A 1U9JA 5IDQA 3CZRA 4A5OA 3PGJA 1VJTA 5HM8A 4MOWA 4BNFA 3D5QA 4IDDA 2AG8A 1E92A 3JQ9C 2NU7A 3A4VA 4N18A 5DCYA 1JAXA 1DIHA 4M49A 3RU7A 3MJ4A 3OJOA 3IOYA 4TZTA 3RFTA 3P5SA 2QZ9A 1HE3A 4RDHA 1CIVA 1I8TA 2EGHA 5DZSA 3PHHA 3RKUA 3FN4A 1IPEA 1H93A 3GVHA 3HB4X 3I9MA 1XYGA 1AHHA 3JD2A 1J49A 4UUPA 3UW3A 1TEHA 1C1DA 3LDHA 2EIHA 3ZDFA 3D0OA 1MB4A 1JW9B 4B7XA 3CKYA 4TSKA 5IN5A 4J4TA 4R4JA 2YW9A 5A4DA 5I7VA 4ZQGA 5K6AC 1BXZA 4BGVA 1Q2XA 1Q7CA 4TZKA 3GMDA 4DWVA 3LT0A 5DOVA 4CR6A 1MFZA 1RJWA 4IQ0A 3WTCA 4YA6A 1JKIA 4C7KA 3QQPA 4UULA 4HV4A 3UGKA 1WLYA 1NFFA 4CQLA 1NQAO 5KJCA 3ASUA 2ZTVA 3KYCA 2WD8A 4IDEA 3WICA 1BSVA 3WIDA 5KWEA 2Q1UA 1BXKA 4BMSA 3H4VA 4M87A 3BMCA 3WG9A 5JYDA 2TMDA 4CM8B 1P1HA 1PGNA 2IZ0A 5L3ZA 1HEUA 4XB1A 4FFPA 3ZWPA 5TJHA 1UZMA 4DLBA 2B4QA 1TB4A 2NU6A 4II3A 4ND4A 5L7YA 4CQMB 1GEEA 4LVUA 3O03A 1I33A 3DONA 5DF1A 4CLDA 4ROSA 1KS9A 3I23A 2VHYA 1X7DA 2YQ5A 2FR8A 2JAPA 4E5MA 4D7AA 1T2EA 1YONA 5JC1A 4MP8A 2C0CA 1Y8QB 3C3XA 5EMHA 5ER9A 3WOHA 4JBHA 1Z6ZA 3KBOA 3E48A 3H5NA 4BNIA 5CEJA 4NJMA 2EXXA 2OORA 5I7SA 2D59A 1BMDA 3RCBA 5TRTA 5KKCA 2BD0A 3VPGA 4UEOA 1D1SA 2V65A 1PQPA 3BMNB 2W2LA 3IUSA 4ZQHA 1PJ3A 5AXBA 3HWRA 1X13A 3MTGA 3NGLA 5HBRA 2WD7A 3R3JA 1GYPA 5G4KA 3AI3A 3UICA 2ZQYA 2YY7A 4PG7A 1L1FA 2AQHA 4R9RA 3AY7A 3W4IA 3HE3A 2DM6A 5C3MA 5FI5A 4WEQA 1ZJYA 2ZATA 3TF5A 4KDFA 2OHXA 4W7HA 4NK4A 5JYEA 2NVUA 3AY6A 1GZ3A 3NT4A 3RVDA 1NQOA 1Z45A 3C1OA 3EYWA 4NQZA 4PZCA 5TS3A 1CERA 4WOJA 4IGEA 1ZK0A 3WX0A 3DEYX 1YJ8A 1E3EA 4RPGA 2Q99A 4AJPA 3ZW8A 4GLLA 1H9AA 1X1EA 2DT5A 5L40A 1WAMA 3E03A 4Z6KA 3JQBA 1FMCA 1WPQA 3M2PA 3MJVA 4YR9A 4YRBA 2PH3A 3JQ7A 3HDHA 1PTJA 1M67A 4H7PA 2FPIA 4JK3A 1SZJG 5A5EA 1LLQA 1YOVB 1F17A 3AM4A 1ZZEA 2C5EA 1YRLA 2H9IA 1K89A 5C7OO 5H83A 3R3SA 4RDIA 5GZ6A 3DAPA 4YVFA 4AJLA 1F14A 3L9XA 5KOIA 1J5PA 2AEJA 4FOSA 1OAAA 3I52A 4RORA 1WDKA 1NAIA 1E6EA 1DFGA 2OGUA 3BMQA 4I8XA 4RPJA 2C7VA 5TSDA 4XRRA 4A03A 2VT3A 1JQBA 1LLUA 1ML3A 4DMMA 4PCVA 4CMIA 2CD9A 2RIRA 4MO2A 3S55A 4BNLA 3RKRA 3FWNA 3GEDA 1YDEA 1MGOA 5BSEA 3X2EA 4BMNA 4CM3A 4YJGA 5DP1A 4BO9A 3OEWA 4PLCA 4HFJA 5F1OA 4ALJA 2RHRA 1EUCA 1TVEA 1F0YA 3RUAA 1P9LA 4MVJI 1GCOA 1J4AA 3JYOA 1GL3A 4P8RA 3NTOA 1XDWA 3KM0A 4MIYA 1X0VA 3HNPA 3IS3A 1NWHA 4LN1A 4NFYA 3RUDA 4EJ6A 2AA3A 3Q2IA 5L7TA 2LDXA 3DR3A 3T4EA 4J0FA 1AUPA 1E7YA 3ZWOA 2D5AA 4BS9A 1MG0A 5JSFA 3H2ZA 1B3RA 1U7HA 5F5NA 1HF3A 1U3UA 2WEKA 2RCYA 4ALKA 4IXWA 3BHMA 4JBGA 3F1KA 1PU2A 1MUUA 4RF4A 1G6KA 1PJTA 4BKRA 5CHEA 1ZCJA 1N7HA 4WK6A 2PV7A 2UUPA 3DOOA 2X8LA 1U28A 4E21A 3U62A 3OBBA 2AEMA 4YAKA 4LISA 3DFZA 5EERA 1EK6A 3PWKA 5TGDA 3TZQA 3RFXA 3W4KA 5EQDA 3C85A 4CMJA 2DLDA 2EW2A 2XOXA 3GG2A 3GPDG 3VPFA 4A10A 1AN9A 3A06A 1PEDA 4Q3CA 3IP3A 4K28A 4XGNA 2ZTLA 3HHPA 4DL9A 3H2SA 4W82A 4ZGWA 2GN9A 4YPOA 4A26A 5FWNA 4S1VA 4AL4A 3CSDA 3KXDA 2GN4A 5F5LA 3I5MA 1JA9A 5JMWA 4IGFA 3EZLA 4J7XA 1V6AA 4OJNA 2A35A 3ROMA 2Y0EA 4PN3A 4UVGA 5ITVA 3JQBC 5ENVA 4Q3AA 1O95A 2WDZA 2OBYA 2E4AA 3VKUA 4JJGA 2IXAA 1DHTA 2O4UX 5KJ1A 2CF6A 1RM0A 2VUUA 5FI3A 1D4FA 1E7QA 4R1TA 3B6ZA 3LU1A 5JS6A 2GZ2A 5COBA 3AU9A 1LEHA 4FOOA 3PPIA 3PYMA 1GEGA 2ILTA 4ND5A 5JCJD 3ICPA 1IULA 1DAPA 1BW9B 1NR7A 4R5HA 4JIGA 1YH3A 1YL6A 2Y1FA 3OA2A 3RU9A 2BMAA 2BF7A 1QP8A 1OBFO 1QYVA 3BMOA 1UR5A 3GRKA 4Y6SA 4ESOA 4OGWA 1DXYA 1GUZA 2DAPA 4P4LA 1M2WA 2P4QA 2NU8A 4JCOA 2JHFA 2JFGA 2NACA 4B4UA 4A7PA 2P91A 4EUHA 4I5EA 4IY1A 5DNAA 4IZHA 4EZBA 2B4RO 4IS2A 1UXKA 4NHEA 4RVSA 3OECA 5I8ZA 3RC2A 4GPD1 1P1FA 4E33A 2GRAA 4I08A 3T7EA 4BO2A 4CLEA 3IDSA 3PK0A 4YBZA 1NM5A 2V6GA 4GQAA 2X6TA 1KIFA 1EUZA 2GR9A 1SCUA 1VPDA 2WYWA 3K31A 1SMKA 3LT1A 3DBRB 4L9RA 3SXPA 1UH5A 1GUFA 1ZUD1 1XQ1A 3CXRA 4LMPA 4RCVA 2FRDA 2BI7A 5T8KC 5ICSA 3MEQA 3VH4A 3QRWA 3BTOA 3AFMA 4TRJA 1LLDA 3A1NA 4BKQA 2AHRA 5A05A 2IZ1A 1I10A 4MP3A 2Y1GA 4WJZA 3TPCA 1VL0A 1H94A 3AK4A 1ADBA 1ZW1A 3BTVA 5AXCA 1UP7A 2DPGA 2Y68A 1LSOA 2O2YA 1E5LA 3NUGA 2NUAA 4PLGA 4UEKA 4F6LA 4LCJA 1HDRA 5DCWA 2C20A 2NSDA 3QE3A 5H81A 5BR7A 3KO8A 1LDEA 4MKZA 4GX1A 3U3XA 1PZEA 2DTXA 1N2SA 1F06A 4EI2A 4IDFA 2Q2VA 4KWHA 1XKQA 5COAA 2IEDA 3DBLA 2NTVA 4F3YA 1LU9A 3W4JA 2F00A 2O23A 4YRAA 2JCXA 3GVPA 5L53A 1D8AA 5AVOA 1UUFA 1U3VA 4MVJM 2VNAA 2W90A 1UXHA 3JYLA 2NQTA 4RPHA 1WZEA 4AJKA 5TF4A 4UUNA 3GDGA 2OP0A 1KC1A 2QIOA 3MOIA 2I67A 2EF1A 3PDJA 4N5LA 3NAQA 2W2LD 1ENOA 4KP7A 3DMTA 2BH9A 4L8VA 2PK3A 2VT2A 2IE0A 1E5QA 2G17A 3F3SA 2GYYA 4GAEA 4KWIA 2BGMA 4E5PA 1HXHA 4FDAA 5MDHA 4W4TA 5U1PA 1IY8A 3GVIA 4XYLA 4I9NA 2NQ8A 1W4ZA 1NQTA 3ZV6A 2YJZA 3IC5A 3I6IA 1QORA 3RJ5A 1C1XB 4YACA 2YV1A 4Q39A 3RAJA 1XWFA 3UN1A 5JC8A 1A4IA 1F12A 2C54A 3BA1A 3H9GA 4HNGA 5EINA 3BTSA 4E30A 4R3WA 4PVCA 1B15A 5JLAA 5F21A 3PJDA 1ZIDA 3HG7A 5JAQA 1PJSA 3I1JA 2YQ4A 1DEHA 3CZMA 4QQRA 3DHNA 3NJ8A 2IDZA 1WMAA 5FYDA 4CLOB 3P2OA 5I7EA 4U5QA 3B20A 3EGOA 1DAOA 4Y6RA 2B37A 2HMSA 2X0JA 2ZYDA 3DO5A 4XYMA 1DB3A 3C7DB 3U49A 4BO7A 5TLSA 1E1MA 1YL7A 3PJFA 1WWKA 4K6CA 1E7MA 3GHYA 4DBZA 2EJWA 2HMVA 2PD3A 4IDCA 3DB2A 4YAJA 4D44A 3KUXA 3K6JA 3C1TA 2WYVA 3TOZA 4ZQEA 2A9FA 4EEXA 1G0OA 2HK9A 3ETGA 1PZHA 3AUTA 2VWGA 3H5AA 4AJ1A 1I3KA 3ORFA 5T6BA 3GF4A 3WLFA 3VVCA 1VM6A 3FNHA 2EV9A 3GZNB 3GAZA 2ZJ1A 3KZVA 4Q3EA 3AY3A 4Z0HO 6ADHA 4PLZA 2EKQA 3ZN2A 5TQVA 3PYLA 1JWBB 4RVHA 1YB1A 1P31A 4W7IA 4PLFA 4WCFC 4BNMA 3PHIA 3FNEA 3PFWO 4BNNA 3OJ0A 4RVGA 3U9LA 1XSEA 1KEWA 4H16A 1XR3A 3P2YA 2NWQA 4GSLA 3WWYA 5EIOA 5BSHA 1EZ4A 3ZWWA 3LVFO 5JY6A 4K9DA 4PG4A 2ZIZA 5ER6A 3ONEA 2ZQZA 4W99A 2UAGA 4LRTB 1R16A 3RQSA 2QRLA 3AW9A 1ORRA 1XQ6A 3EW7A 2Q45A 1ZMOA 2VYND 2ZK7A 3EK2A 4IDBA 4M89A 3RUHA 3JYPA 4OXYA 3IIEA 2JD1A 2EP7A 3GT0A 4YEDA 3WIEA 4CV2A 3VDQA 2PLAA 1WVGA 3AWDA 4P4GA 5DP2A 1YB5A 1U4SA 4UEJA 1EFLA 3H9UA 4RF3A 1H6AA 4MKRA 3BAZA 5JY1A 3VZQA 5TT1A 3ZHZA 1XIVA 3GHHA 2P2SA 4RPKA 1E3WB 2VWHA 3G1UA 3E8XA 2HK7A 3PEFA 4EUFA 1XEAA 1U3WA 4PZEA 1ENZA 3GC6A 4XGIA 3PIIA 3DMTC 3NDIA 2C5AA 2NTNA 3VAZA 4YJDA 1ZH8A 4I5FA 4PLYA 2O3TA 2EG9A 2WWRA 3GDFA 2H6EA 4L4SA 3ULKA 1PQWA 3NEPX 3ZWYA 4JNKA 4ND1A 1TXGA 3WSWA 4RQTA 3PQEA
chains in the Genus database with same CATH superfamily
3E9DA 4R84A 3U4AA 1S3IA 1ORDA 2NM0A 3PUWA 4JBYA 3KUUA 4M99A 1I2DA 4L3WA 3TTSA 4RA6B 1EFKA 1CNMA 4OLJA 4PHTA 3DZKA 2ZXUA 1BTOA 4FNOA 4UW9A 3O1HB 4YJFA 2QXYA 3CRZA 1P80A 2H11A 1U9YA 1Z74A 3E15A 3IEXA 4GBJA 3O4FA 1KEEB 3EC1A 4KN8A 5P8WA 4AVYA 3KNZA 3B2EA 4YAWA 4ALLA 3KYDB 3KSRA 1TA9A 3F7MA 4KLRA 4LTMA 4AYTA 3WQRA 121PA 2MIIA 1WUYA 3CA8A 3MTAA 3PRYA 4A0QA 1AK9A 1K0FA 4E46A 1EWYA 1G2QA 3KC2A 1IHDA 3GJ3A 3V1LA 4BPRA 4WKCA 2IOQA 2AR7A 3NCHA 2Q0HA 2CK3D 2QRKA 1N78A 4HFMA 2FWMX 3I73A 4IMJB 1YFZA 1R37A 3A2NA 4HL6A 1V41E 1P61B 4C4OA 3P9XA 1WCXA 3FBWA 3TZCA 3F5QA 3S68A 2OSVA 2X4IA 2ZGVA 3D0RA 3K30A 5A1TA 3CCFA 2FWNA 5EE5B 4NBRA 1IRXA 1X0XA 1FNSA 4NNOA 5BY2A 1P39A 1TAGA 3K53A 4O2RA 4AY5A 3PNVA 4ENUA 1W0JA 5K7SA 3A1CA 2X8BA 4KUGA 3TX6A 2ZWIA 4KLAA 2DUNA 3WWDA 1NIPA 2GPTA 2GWRA 1Z75A 4FZJA 4K8RB 2C42A 1C7EA 4MWGA 3C5WP 1FNBA 4RANA 5KOJA 4ARCA 3HCEA 2XVZA 3FCCA 1NFQA 4OXXA 4ZICA 4RESA 2P8JA 4PLTA 2DXIA 3WJ1A 1SOUA 4HAXA 4JYBA 4DXAA 5FOXA 3I92A 5C8YF 4BO3A 5ITZB 5H3HA 4HPWA 4L6IA 4B4OA 2AOTA 4RSHA 4F86A 3JQCA 3FFXA 1L4EA 3DDSA 4DR5B 1COWA 1YCDA 4XUGB 4MVJP 1UZLA 1NBEA 1F4LA 1UXGA 4QAJA 5JARA 1WHTA 2BLNA 1E3QA 1CRWG 4PO3X 4B0OA 3HVIA 4JBIA 3KQVA 3U56A 1K6MA 2AEFA 2O6HA 2FN8A 2LCFA 2JLAA 1PJQA 3JR7A 1FPMA 5B55A 3CV3A 3HI4A 3JQ8B 4UVIA 4YMSA 2GM9A 1O9BA 4HB0A 4OEHA 5TJ9A 3NHRA 2J9GA 1RC1A 2YYZA 2UVDA 2AMLA 5T67A 3ZHCA 5KOYA 1RPTA 4ZT5A 2EZ4A 3A4YA 1K1EA 2FSUA 2HSJA 3C6ZA 1Z7WA 3COSA 3MS7A 3BHNA 3DEJA 3MMZA 2AQIA 1E6WA 4CCSA 2TSYB 4NCNA 1A72A 4D46A 2Y66A 4CM8A 4P4SA 1DUVG 3T7KA 2FSHA 3OURA 2NNWB 3JZMA 3FDZB 4KV9A 3S2IA 2CZGA 3CBQA 1SU6A 2IYFA 3M3PA 3HDJA 4GZMA 4LIPD 3SY8A 3FNQA 1GA1A 1Z0UA 4LS3A 5HK8A 3RVJA 1R8SA 1FK8A 4JEUA 4XGKA 4B83A 2HPHA 2H4YA 3HBJA 4TKLA 3GUZA 2C4WA 2GO1A 1TZCA 4ILEA 1JWAB 3KFLA 4TT8A 2VBIA 1U11A 1P1RA 2ZS7A 2GEVA 4P7BA 1I5RA 2B0JA 3M1IA 4XM2A 4ILKA 3FI9A 1VJ0A 3L0BA 4RF2A 4CTJA 1U0HC 3CNLA 4X9XA 1PEYA 3W04A 1L5SA 1SAYA 4YCJA 4YCLA 4NYMR 4QDUA 4WT7A 2J5QA 3ROPA 3WZ2A 2UZIR 3DXFA 1ZU4A 3S2UA 5C8VA 1V4VA 4FLEA 4NPCA 4IYJA 4B48A 1MX3A 1D5CA 3JQQA 4M9RA 3RU3A 4JXKA 3N5KA 5E38A 1C3EA 3H4TA 3TLJA 3BB3A 2P4UA 3EC2A 5FUWA 3CGWA 2HIGA 2I6TA 3I34X 3IQZA 3FUTA 4FZ5A 4KWTA 4QYIB 3IO3A 4C01A 4JN6B 3DMGA 3TLGA 4IDAA 4GKBA 3ZE9A 3LM8A 3TSCA 3CCCA 3ZDCA 2XRYA 3KWLA 5DM1A 1QCZA 1B7GO 1B0AA 3DV2A 4LKOA 5D5HA 1Q1QA 3DV0A 4DQXA 1N33B 2EEZA 1VBMA 2WA1A 1NW4A 4ZO8A 2PJDA 2X15A 1HA3A 4G5RA 2VHZA 3LK6A 1PL6A 5JYCA 3ESXA 3GNLA 1ZGBA 4GGMX 1VKOA 1XG5A 2RHCA 3EHEA 4IIUA 1JN0A 2QVZX 4HNQA 4W6ZA 4UTVA 3WGIA 4A5SA 3RS8A 5AD1A 3K2EA 1X42A 4C0SA 1RPNA 2CDCA 2P3OA 2PWBA 1PJBA 3GJ7A 2XY4A 3EVFA 4RKQA 2QE7A 1ZL0A 4OGGA 4HT3B 4UTRA 4FD3A 4OLBA 3PVCA 5KTOA 5AW9A 4DYDA 3ZQ6A 4UQLA 1UPTA 4XLZA 3H9BA 3ENNA 5JI2E 2J41A 4ZVVA 1NSYA 2JGJA 2DSTA 4OIFA 4ZI3A 1HZZC 1SXJA 2Y99A 3EF0A 4YRFA 2ODNA 2XE7A 2C2XA 3D4PA 3T7CA 5CA1B 3TFOA 4A0RA 2JJ2A 1OWNA 3UJ9A 1O0SA 3NT2A 3GP8A 4NIMA 3WK5A 2BFEB 1OZ0A 4OIMA 1RRCA 5D7NA 3VMMA 3IR7A 4A8JB 4K03A 3HMQA 5JJCA 1Z35A 4ZT4A 1NVDA 4EO9A 4PXYA 4JC0A 4WOKA 4EMBA 4RFLA 3HB7A 5ITSA 3HYNA 4ND3A 3C6BA 1J9ZA 3SXUA 4A1FA 3I2YX 5KVVA 1ZO8A 4J3NA 3RVQA 3CVVA 3VFDA 4E09A 4EI8A 3A1SA 3D1VA 3I58A 4ZU3A 5CG2A 3LAWA 1BGVA 1NYQA 1ZSYA 4RA9B 4DUPA 4G2NA 4EHJA 5I7RA 2YL2A 2ZSBA 2BY4A 1LX6A 3NV7A 3Q0IA 4JJ4A 1WUTA 4BQRA 3N2IA 5EESA 1JR3E 3W2HA 4B8WA 4F71A 5CU7A 5EYPA 3VYRB 3LPLA 2OHOA 2Z2KA 4H6PA 1KVQA 1RI5A 1DG9A 1EFTA 4HWRA 2L2QA 2GILA 4DMUB 4I55A 1FP7A 1GKKA 3HBMA 1E69A 5HIIA 2QU7A 4JSYA 4R2IA 2VPQA 4NK5A 4OUDA 4D8VA 1VP3A 2J7PA 3V4FA 3GDOA 3PPWA 4II2A 2X8AA 3VQTA 1P7PA 3MAGA 2UVPA 5IC4A 1M8FA 4ZXPA 4HAVA 4MVJF 3P2IA 1FNMA 3GNQA 4FDLA 4YPVA 1MRSA 1NASA 4TLEA 1R27A 1ECGA 1LW7A 1XQXA 5DK6A 4U1RA 1X1CA 5DGXA 4TKVA 1U8CB 1ISGA 1E6LA 2GO7A 3MJTA 1DXHA 1Q1BA 3H8SA 1PAUA 2P1RA 2V6JA 2XAUA 3R6GA 2EFJA 4HD8A 4IV8A 1Q0PA 1SUWA 4L9SA 3WK4A 4AZ0A 5JAZA 1IZYA 3NHBA 2VNKA 2ENWA 3AP2A 3U60B 5HX7A 1TCCA 3E6AA 3PUKA 3I9KA 2W6NA 4P98A 4BNVA 2BFDB 2DB3A 1SVNA 4M0FA 2DGDA 3TOCA 3ZD9A 3N2ZB 4DKJA 4X7MA 1I32A 1K7YA 1I36A 3THWA 1OJLA 2HFJA 1MC4A 3FOZA 2ZJBA 3TN7A 1GFSA 2FHSA 2Y93A 1E6KA 4UHBA 4D3SA 1IVNA 4NBUA 1TCBA 1V16B 3ZY2A 4UOZA 3GROA 5DGDA 5BMVB 2R87A 2QRVB 5ED0A 3PHJA 1JHOA 1QRAA 2QZSA 3MQFA 2QTZA 5FUBA 1YUNA 2GARA 3KBBA 4O63O 3S5UA 3ZBQA 3LV8A 3COYA 1VE7A 1G60A 3EBPA 4PGFA 2BDTA 5HFJA 4NNJA 3ZE6A 3F3YA 2G6TA 3M4NA 5CVUA 1T4CA 4EMUA 1M7GA 4KV7A 2FDRA 2VH1A 4QLOA 1X19A 4AYXA 1EAMA 2XVXA 2YJGA 4JH0A 5GZ3A 4EPXA 5IXSA 1I94B 5B6PA 4WJLA 5C8DA 1MPXA 3NS7A 5BPHA 3M0EA 1M72A 1H23A 1U5BA 2DWQA 4LJ4A 1TD9A 4L74A 4TTIA 1RI4A 3UK2A 3VH2A 5C2JB 5IRCD 3ZDXB 3WBBA 1NBHA 2DSNA 5CYFA 2NTEA 3AG6A 2CHGA 3RASA 5AIBA 4AZ3A 2UYYA 2WUVA 4KQ9A 4BATA 4H77A 1FMJA 1YL5A 3BFPA 4QQNA 1E2NA 1E9CA 1SNYA 5DE3A 2WTNA 3KVNA 2H31A 3EVBA 2YXBA 1A2OA 3OICA 3IA7A 1X1DA 5F98A 3UUGA 3V7WA 1TAQA 1KI2A 5A9SB 10MHA 2F9LA 5C1IA 2O6LA 2CFIA 2I2WA 3KJHA 4MEJA 1V3TA 3S8EA 2FP3A 3HJRA 2C82A 3JTMA 4RAQA 2OQ2A 4BO1A 3IOEA 3OOHA 2O50A 3KTAB 3P0FA 4K9RA 3C5VA 5G53C 4AZSA 2BDUA 3ONVA 3L6EA 3OH8A 3PHCA 2H17A 5D87A 1RZRA 1DMSA 2P5SA 4P86A 5CBPB 1E9BA 1KERA 1SBCA 2GNAA 2ECFA 1BVYF 1N6HA 3ZKWB 4FFRA 2ZBRA 4BRWA 1EDZA 2BFMA 4EI7A 4LBYA 1GTZA 3FCOA 4JL5A 3H1BA 5HIAA 3UXEA 1QHFA 1OSNA 4U2DA 3R74A 4X41A 2CNBA 3DKRA 3NRCA 4UEWA 5JNWA 1BXGB 4L72A 3V2HA 4PZPA 3QW4B 2DYKA 1MV5A 2VO1A 5FTWA 3VRHA 5BSWA 3IQFA 5F23A 1H6DA 4DLYA 1U2TA 4URXR 5ALQA 5IYZA 1WG8A 3JQ6A 4RTOA 4G5GA 4FC6A 5LMNB 1FUUA 3ASZA 5CFNA 1TFUA 3BK2A 2CVPA 1EDBA 3GY0A 4RGVA 2W42A 3B3GA 3B1YA 1QJCA 4FZVA 3SR0A 2ZWAA 4O0LA 3RUCA 4JYPA 4WK2B 3OZVA 2WU0A 2IYUA 3OPXA 4LHZA 4TLAA 1NONA 1W30A 4FTWA 4UM8B 3VGPA 3HVHA 5GP1A 3DTVA 3OCXA 3LVRE 1PGJA 2Q1SA 3I6MA 1KDRA 3N8HA 3NHUA 3QELB 3KYIB 4Q47A 1G5QA 2FK7A 5IYZB 1JMKC 2VXYA 4RFVA 1RD4A 3PFHA 3GDHA 4PSUA 1IN7A 4JOCA 1YC2A 4GFDA 5I5EA 1M6VB 3DBRA 2PMDA 3WL4A 2GJAA 4IQGA 4RKFA 3QV2A 4Z4FA 1AO3A 2XB6A 5DMXA 3QPWA 2CJYA 4V0QA 5DM2A 1XCBA 2V5UA 3RRZA 3WNVA 2XXJA 1ZY2A 1YZ3A 5B30A 4EEZA 3NI2A 4QM6A 1NG1A 2IY7A 4NV3A 1NULA 4Q1VA 3MA0A 3B51X 4FSHA 1DC5A 3SX0A 4CUZA 4EJSB 2K6GA 821PA 4URFA 4UNNA 4PG5A 2A7XA 1Z68A 3OU7A 1NLYA 2XKBA 4Z9XA 1BVHA 4BP1A 2OVBA 5B57C 2ZYHA 4PQEA 4TQ9A 3P20A 4ZYYA 4UFNA 2GCOB 2ZYRA 3AH8A 4M3NA 5EZ5A 4D3FA 2J9RA 2I6GA 4YPFA 5A4AA 5BN5A 2Y1WA 3IP5A 2AZTA 4UXJA 4ZAXA 4UUOA 2WE7A 3LCJA 3C1UA 5H70A 5AICA 1G1MA 4U6SA 4B3IA 4EKYA 3I2IA 3U37A 3ZE8A 4D0SA 3IVXA 2NADA 4I2VA 2QVXX 4NZNA 4TYNA 3IQWA 5EIHA 1MDBA 5TF0A 3IFSA 3KU1A 1C8LA 5B1IA 3BWBA 2CYAA 3L46A 1S8NA 1BMFA 3HVUA 2GVNA 4JMPA 2BN4A 3DGFC 4Z54A 5AKGA 2J5XA 4FGSA 1PWHA 2MDTA 1NBME 4ARIA 4XGRA 4B3BA 3DDOA 3MW8A 4X1OA 3L82B 5BMOA 2PMBA 2F6RA 4MVJD 3QP9A 1HTWA 4OQLA 1RJFA 4UXHA 2K5UA 3BGIA 1DO8A 3OLYA 5A6VA 5BUQA 5KQLA 2I9KA 2G0AA 4QT4A 4G6ZA 2VDKB 4LUCA 2ANCA 3TR5A 5J2TB 4J49A 1UP6A 4NLLA 3T4UA 5F7OA 3ESQA 4PFKA 4PRYA 4LDPA 2G25A 3TZHA 4DC9A 1L5HA 3E5NA 1FUIA 2H2FA 3W4IA 3SJ7A 2XIJA 2ZAIA 3E9MA 2P0YA 2E87A 2RK6A 3DL0A 4ND2A 3D4OA 4U63A 4LF8B 5JZOA 4OHBA 5B12A 5DI3A 1KY5A 2JFUA 3FVQA 3WYEA 1IN5A 3U09A 3HPQA 3I3SR 4K9NA 1OFUA 2MYUA 2ZT7A 3OO0A 4EVQA 3EXEB 4LSMA 1PDWA 4TRMA 1M6WA 4EW2A 2HPVA 5BVHA 4X64B 2N3ZA 1BWQA 4FB4A 3RYHB 2O8FA 5LUBA 1FX0B 2ZVDA 3RFCA 5CVTA 3D8SA 5JNLA 1XDGA 2W6ZA 4G5FA 3S2ZA 3O90A 4LJ9A 4NBKA 5T64A 7REQA 3TJZA 5LPNA 3BE4A 1IHXA 1X7XA 3EZ7A 1E98A 4MV7A 5E95A 2XNKA 5JSHA 1ULHA 4D8YA 2HOQA 5FPKA 4FFNA 2PL1A 4L8LA 1GFZA 5T4BA 4BNUA 2SBTA 3LXXA 2R7MA 2EFEB 2J6CA 1E2UA 5JAMA 1XJ5A 1N5OX 3GFFA 3N2LA 3R40A 4UD2A 5JBQA 2XUZA 3DAGA 3UXHA 5FNVF 2A5GA 4M9SA 1UPCA 1NR5A 1JJFA 5I51A 3DVAA 2FZVA 2J3IA 5LNK6 2BTQB 5FJIA 5DW3A 3U4IA 5HUQA 2X1VA 4LNUA 1N2ZA 4N5DA 4UFOA 1P33A 1EWRA 3MGAA 1B76A 4JBLA 3A05A 4A15A 3KOMA 3NXKA 4DQDA 1F8GA 1Y8RB 1YZUA 3N0RA 4X95A 1ZXXA 4QDOA 4ENTA 1CZOA 3WR5A 1Z4KA 1P0PA 4L4YA 3WLHA 2F55A 3EA0A 5CM9C 3QKSB 3FMPB 3H5OA 4JGGA 3QYJA 5DN6A 2CV2A 5FADA 3CNEA 2FB9A 3DEIA 3IPRA 3SS9X 2J30A 3WQHA 2H2WA 1LXCA 3PCTA 4HFRA 5FL3A 4JR1A 4ASUA 3KQHA 4B6OA 3TR6A 1M8KA 2OO3A 3BWMA 3IV7A 1QIKA 3GZNA 1MB3A 1I7LA 1V25A 3QK7A 3W2GA 5LJLA 3EIWA 3W0LB 1OI3A 4MVXA 4P33A 4EFLA 5AW8A 3OY7A 2GCGA 5IAKA 1FYDA 2FN7A 2UVQA 1FDRA 4MWSA 3JYNA 5D3MA 3I9LA 2D06A 4Y9TA 1GGEA 3AJRA 1G7CA 1XLTA 2P77A 1FSPA 4UUMA 2QD4A 1ZD3A 2C3PA 3GCGA 3DZHA 1YJAA 3RS2A 3UGTA 2YMPA 2HBRA 4R54A 4OPMA 3VNAA 1FFEA 2DFPA 1KY3A 2C97A 4KIWA 3ER6A 1KEVA 2PUHA 3V1YA 3PGVA 2GK7A 2Z0MA 4K9PA 1Y3DE 4P82A 5A0VA 1AKUA 2IQ5A 3O8NA 3ZEAA 3KX2A 4H4CA 2PT7A 3DL2A 2HCFA 5AK4A 5KIAA 2X2OA 5KMGB 1E5XA 3VDNB 2Q5EA 2WIAA 2RGCA 3FROA 5AW2A 2XGSA 4M88A 1DU4A 3B38A 5E4FA 1TI7A 3EXHB 4MW7A 3IOCA 3VHLB 5H7XA 1GCAA 4AJJA 1FQWA 1FRVA 5BNZA 1CDOA 3M4ZA 4IIHA 2CXHA 1IOVA 3RS9A 1VLQA 2B1GA 1C2TA 4FKZA 4BU1A 3FFTA 4CR7A 4L78A 3JQDA 4EGAA 3JYQA 4MWEA 4A8TA 3HKCB 4ZVPA 2F3TA 4JAVC 1E3WA 1NTRA 3F9CA 3I0NA 5EJ4A 3DVSX 2AZ4A 4AP9A 4YHHB 2R8ZA 2EX1A 1O94C 2ZRCA 3WAKA 1DX4A 2PFSA 2QZ4A 4ZOQI 1E4YA 1MO5A 2Z9BA 4ZWNA 4F6RB 2PUAA 1E4EA 2VF2A 2XNCA 3A1TA 3M1LA 2VA8A 3R3VA 4G5XA 3DWGA 5FOSA 1L3BA 3SU8A 2NPFA 2VYFA 4PBSA 2A0KA 2QAGB 3AJ9A 3DCJA 4FI3C 4MI6A 4B4WA 1W36D 4DRXB 1D1PA 2F3QA 3OPYB 3UEOA 2V55B 4IOJA 2R7LA 1K4MA 1MGPA 4MR8B 4UOEA 3O8QA 5JXWA 2MWMA 4C2TA 2EFDB 4GP6A 4HYEA 4U3JA 4ACAA 3KJXA 4EZIA 4BNJA 2YRWA 4BNDB 4OBEA 2XD4A 3DE4X 3R09A 3T3OA 4HLNA 4ZRNA 4XWOA 3UO8B 2XKAA 5LA6A 4HWOA 1Q7EA 1LK7A 2ON6A 2BFNA 2O3SA 3ADPA 5CJ2A 3MC1A 3TQQA 3I04A 2C7QA 1VTKA 2ADFA 1AGNA 4Y1RB 2JGMA 1JLLA 4MINA 4QEDA 1GR0A 1NZJA 4AN0A 5L4LA 3T5PA 3QMPA 1DRWA 5ALJA 3SX2A 3WHIA 3ZV7A 5EWMA 2E6UX 2ZZNA 2X86A 3HB5X 3SZ3A 5KYUB 5BSUA 3W78A 1SHLA 2Z83A 1I6MA 2BGRA 4GPTA 1PLJA 1UK8A 4OL9A 3OPMA 3AR7A 3ROQA 3U48A 3OQNA 3I8SA 3LGAA 1P2SA 3ZDRA 1PDVA 4S05A 1SBIA 3OI7A 5DX8A 1QQ5A 5KWSA 4L22A 4JASB 2P5YA 5KYWB 3UMMA 2O8CB 5KPJA 3H16A 5B4TA 3MAJA 5BQXA 3EFOB 4XB6B 4YRRA 4LF7B 3OPQA 5G4LA 4KQFA 1PFVA 4QNNA 4TZ0A 3RAGA 4DWWA 3IPLA 4DPLA 2Q50A 5CCDA 3DP9A 1Z0SA 3A6DA 4WINA 1LNSA 6PFKA 2XUIA 1QOPB 3QUSA 4J0JA 2R00C 1EUYA 3KUKA 1IJKA 3A2KA 5EP2A 2ECQA 2I3AA 4D4HA 3PJEA 3CT4A 3UVEA 1JFFA 2EERA 3QLUC 1GCUA 2OAGA 2JEYA 1FP4B 3JD3A 5TDHA 5ALMA 1PT8A 3KPUA 3NIDB 2HHHB 1TM3E 2POQX 2PIDA 1Y5NA 1VE6A 4GOKA 2DFNA 1JI3A 2PMKA 2VCEA 3H11A 4MRNA 2NNLD 3RPEA 3UZUA 3F5FA 3X1DA 4CKEB 3KJFA 1SA0A 2F3RA 1DIRA 2KI5A 2QRHA 3DHYA 4HQ0A 1ISRA 1CFZA 1W8DA 3ZCRA 5A6SA 3RT1A 4JSTA 3CMMA 2PAAA 3O7MA 1T1SA 5EZQA 3O8RA 2WRZA 2YUTA 3KXIA 4HX9A 2P6PA 4JITA 1SIWA 4YJHB 2I1LA 4AWAA 4BN0A 4YNBA 5HPYB 4EPTA 2DU8A 1THMA 3RHSA 1FVHA 2JBAB 2RDMA 1UJCA 1J07A 1HFWA 3E7WA 4REQA 3QF4B 2WR8A 3W5UA 2GWHA 2XRFA 4HOYA 2ZUVA 4BZWA 4RXTA 4MV6A 1KOJA 1JR6A 1P0FA 2IFTA 1J22A 3JZAA 1VB3A 1NW3A 4YCAA 2YYSA 1SELA 1YTLA 3HZRA 2E9SA 4ZHSA 3PE4A 13PKA 1Y1QA 1NLMA 5LZ4A 4EA7A 4TWRA 2RH8A 4QTZA 4CYMA 3VHQA 3ZWVA 2A3RA 5KNDD 3C98A 2MHCA 2C61A 3L8EA 2A1IA 2PRJA 4UVDA 4S0ZA 1O6FA 2DY1A 3OLVA 3KXLA 2MINB 4W1PA 4P6VF 1KFEB 1QU2A 3FTFA 3ZLTA 3LC1O 4CQNA 4OH1A 4FHZA 4IIJA 2EFHB 3WRVA 1AK1A 1TVMA 2JKVA 4N03A 1S1CA 5U4QA 4Z51A 1M1NB 3B36A 4NCIA 9LDTA 1DS6A 1IQPA 1GYRA 1Q84A 2FZWA 4HXYA 4ZCQA 4G26A 3VR6A 5KNLA 1UM8A 2GCNA 4GMFA 2WM3A 2J85A 1NJ6A 5E9QA 3W6NA 1XHFA 3F47A 2OILA 2UZ1A 2ZYAA 1YBHA 2YYYA 3ELWA 1QONA 4YMGA 5HM6A 3U0BA 1DINA 1RSZA 1TQ2A 4EECA 1T6YA 1AB5A 1T91A 4KXVA 3DE1X 4W5WA 3RRNA 2D2IA 2C5LA 1Z5PA 3IBGA 2VNJA 2VDMB 5IKEA 4DLNA 1CYDA 1WU8A 1OHHA 4MUGA 1CFJA 3DOEA 4C22A 1DPFA 1T9BA 5EP3A 1JVSA 2QP9X 5AM1A 1YZYA 1UZNA 1FOEB 2A94A 3JSXA 3G8BA 5CUQA 4C4YA 2FZLA 5CAEA 3CKMA 2RAUA 4BX0A 4DTCA 1BCSA 3T1VA 3G0IA 1T5HX 4WXHA 1BU5A 5A5DA 4KQ1A 4OQNA 3MTJA 3V3TA 3O3MB 4MYUA 4W1SA 3E3AA 1NMZA 2XB4A 3AI7A 4JLKA 1KVUA 1N8KA 1KI4A 2FQQA 5DLEA 4RYDA 3AEQA 2FN9A 1GAQA 3AR9A 4ND8A 3T9BA 3RVMA 1GUYA 2B21A 3R0JA 4IBOA 5DWDA 3SF8A 1YR1A 3R0QA 3R24A 2GJKA 1TU0A 3EDMA 3D3WB 1A1VA 3D7MA 4D56A 3PFKA 1T0UA 1CUXA 2VZ9A 1AVTA 4YP0A 1OYVA 2O1SA 3ZV5A 2WWGA 1K98A 4GI3A 4HX5A 3VR4D 1LWNA 4JVMA 1XFAA 3GELA 3S1LA 4F3TA 3M6LA 1KL7A 2ZBGA 1GL6A 1I0ZA 1NUAA 4RSRA 621PA 2GLTA 3FNGA 4KO8A 3JPYA 3WRXC 5M34A 4C03A 3VO1A 4J91A 4AB1A 4DNOA 1MVOA 3G13A 2VP0A 4WBNB 2A5DA 3R5FA 3IXQA 3Q7EA 4HGQA 1AD2A 4IW3B 4O4IF 2W6ID 4ALIA 4EYSA 3LVQE 3ZTWA 4AD8A 1UWKA 2GNPA 2QQ5A 2QJWA 4TLBA 3ZIDA 3ZV3A 1WMEA 3JWGA 1NLZA 3CNBA 1XGKA 2PWAA 2YR0A 4HDKA 3PIDA 4O5OA 1ARZA 4DBLE 1CP3A 1M0TA 5AK5A 1XJQA 1ZEJA 3QFHA 2OSBA 2SKEA 4IRMA 1DEOA 2ZB4A 3MJCA 5L3QA 2ZJ8A 1PL7A 1V71A 3GA0A 2D4AA 2WPDA 4YJ3A 4BMDA 4H0CA 4Q4CA 1V8OA 1ZX1A 4ZJYA 2ZI9A 2JEOA 1U4NA 1YDHA 5AXAA 2NU9A 1YIAA 3CYFA 3LW7A 2EGGA 4IG9A 1A95A 2ZR7A 1GPLA 1KMHB 1EX7A 4OMCA 4WVLA 4X1KB 1Z6QA 3RTGA 1XK7A 3II6X 3UAGA 3CVOA 2GF2A 3TLXA 3N70A 3SMQA 2EBFX 1HDZA 1OZFA 1KI6B 4YXWD 2FZ5A 4Q1DA 2ZJOA 3ETEA 4OQXA 1TCUA 3TXXA 5HIKA 1GGNA 5FOUA 1KAQA 3D7NA 2WIGA 4EW1A 1DOHA 2FSVA 1UOOA 2C3MA 1TECE 4R9VA 2V97A 4L0DA 1T6ZA 1T43A 2QJFA 4JFRA 1I51A 5JO9A 3DE6X 3BMCB 3JATA 4UKDA 1SOAA 3VOTA 4CFYA 4PYIA 1E1NA 2LRHA 1GQ2A 3RYTC 6REQA 1WHSA 2Z1DA 1TMOA 4EKGA 4J2HA 2ZBDA 4RHCA 1HSOA 4C06A 5JPDA 1KZ1A 2GZ1A 4WV3A 4LFAB 1R8QA 1Z3CA 3OT1B 1CD5A 1C8KA 1Z0AA 2XF2A 4K9SA 4UHJA 1TTQB 3G9TA 1GZSA 1NJ5A 5HJ2A 3ZY3A 1FX1A 1IN4A 2OP1A 3M6AA 3G5LA 5F4BA 2XVYA 4GR5A 3VHRA 3GR6A 2HH9A 3NEJA 1AZLA 2W43A 1PK7A 4I6EA 3RABA 3SEFA 1T0IA 3DDNA 5WRFA 3GEEA 2VDUE 1SULA 4O2AB 2NTJA 4GYYA 5FR2A 4IXMA 5IM4A 2HLNA 2R85A 5KWJA 2AR0A 1HOTA 1PSDA 2D1RA 3Q6MA 3K70D 1L4LA 4TV9A 4X1IB 3UXYA 4DV3B 3RB8A 1LF0A 2FJ0A 2HJGA 1AG9A 1AKWA 2OQVA 3ZOZA 4CV1A 3VPHA 3N28A 2QQEA 4F2GA 3GJ5A 4E88A 2JHGA 1FTYA 1NVGA 1XZJA 2V6MA 3OVMA 1J99A 4R9UC 3G7SA 1T1EA 3U4DA 2WBLC 4BLOA 2BEJA 4UDXX 5FAXA 1N9KA 1QX3A 4OQQA 1SH7A 2ODEA 2OXIA 2V1XA 3K71B 1JTVA 1RJDA 3ZQUA 1CE8B 1A04A 2BGKA 1KFKB 4S1NA 4G4SP 2JFZA 4CEJA 1PNQA 1M83A 4BB9A 1IY0A 2YYAA 1JR3D 2OV8A 3QVVA 3LQKA 1DFHA 3C7TA 4IHQA 2DQ4A 3JQFC 4F5DA 1YF3A 3FM9A 1X7ZB 4DSNA 2GCIA 1OVGA 4A2CA 1L5GB 1G3QA 4MDHA 3NDPA 1T1GA 3NPMA 4GSYA 3ANSA 5CIYA 3DSRA 1W47A 4TYQA 4YQFA 4WBSA 5JADA 4GEGA 3D8HA 1QM5A 1ZM2A 4RK7A 3E3OA 4HJRA 4MI1A 2ALJA 2XA1A 1TJ4A 5JNUA 3H5RA 1GN9A 1QRRA 1Q7TA 4LRYA 3DL4A 3PWZA 4UFPA 3FSRA 4N12A 4HFNA 1FSGA 2AKAB 2EQBA 4WACA 1M2OA 2VP5A 5CA1F 4B35A 2C8LA 1M2VA 4M76B 4YJKA 1KY4A 4HP8A 3MWEB 4PPGA 3IP1A 4ZYTA 3NMUF 4P4NA 2B82A 5IM5A 1ZN2A 3JQ7B 4LJLA 5IJ0B 1JKFA 1ZLYA 2G1JA 1UAYA 5DTRA 4BNHA 2DFDA 1ENYA 3QU7A 4RDCA 5KVQA 4A8JC 4CM5A 3A6PC 1S9DA 4LXIA 1HT1E 1T2VA 1XVLA 1ND6A 4CF3A 5KKNB 2IXGA 3HRIA 3TTTA 3INGA 1SVUA 1TT5A 4WKPA 3EAFA 1AUVA 4ZYZA 4Q5IA 4KWCA 1FDVA 2KB0A 4DLPA 1PVVA 1II8A 3L1UA 4QU8A 1Z5ZA 1QV9A 1YJXA 4F6CA 1RE1A 2OLEA 3H8VA 4RPIA 1HSZA 3RS3A 1DDOA 3L6OO 2J0UB 3OIGA 3ZCSA 3DVRX 1YACA 4W8HA 5CIQA 1P4AA 3X44A 4ZOBA 1JQLB 5AW4A 1H4SA 2JL1A 2PY6A 2Z9DA 5T8KA 2O52A 4BLRA 1G3MA 2P2YA 2FPXA 3F1LA 3LPMA 4I1OA 2X0RA 4C6TA 2WUEA 2FFHA 1E64A 1ZNQO 4LPSA 1NBAA 3OWOA 1TGVA 1MA0A 1J8DA 2XYVA 1IBCA 3THRA 1JAIA 2EG5A 4V0SA 5LC1A 1UIRA 4UZEA 1R0YA 1F20A 2IHNA 2JB9A 1SUEA 5EVCA 2BEVB 3EC7A 2C77A 4PQFA 4B85A 1ESCA 4F06A 5JBIA 1F7VA 1W7AA 4HH4A 4PZLA 2OAEA 3VNUA 4YMUA 3IDQA 3JQRA 3TOXA 2ZQ5A 3Q8KA 2NT3A 4QLBA 1I2MA 4R1SA 2LD4A 2ZAYA 2D7CA 3UH0A 3EGDB 2GHIA 4QBHA 2PLRA 4IDHA 1EX6A 1OXTA 1TYCA 4M53A 2LV8A 3D7RA 4RMJA 3U4QB 3AIMA 4ZMBA 2M6LA 2VBGA 1JLKA 1ZM7A 1EDDA 1KI9A 3JVUA 3L43A 3LP5A 4N65A 2H2GA 3IELA 4QQKA 5CM8B 1JFSA 2YXNA 2H1OA 1TCAA 2Y76A 4AS3A 2FRVA 2IWHA 4TRNA 1GZDA 3CR7A 4IHJB 4P7JA 4FNGA 3L02A 4HPJB 4F5ZA 4HHEA 4L50A 2I33A 1CSEE 3BFKA 3IBYA 2A86A 2NO5A 1VLLA 3J7TA 1H9BA 2RHJA 3OLQA 1Y6QA 4UUBA 4Q03A 4LHEA 3V4OA 3JQAD 1BFDA 5FBZA 4LF6B 1YZKA 3GOHA 3N5CA 4ZK2A 2QN1A 4Q7LA 8OHMA 4LV6A 3A6KA 4R83A 4AIRA 4AJ9A 3QWIA 1A4RA 1DOZA 1GG2A 5LB2A 4FQ7A 2B20A 4TVBA 4P38A 2H4FA 5GZ1A 2KLBA 3C16C 1G21B 4EW3A 1KH3A 3OTOB 3DGEC 3P26A 3W8EA 4KVGA 3AKZA 1ISSA 5TT0A 4A8PA 2CB9A 5BWLA 9ATCA 2MMCA 2I3ZA 4LXGA 3ZTTA 1IIRA 5IHXA 3A3NA 3H5WA 2OA0A 4Z3DA 3RS5A 3ILVA 3VR1A 4BKRA 4GOXA 1LV8A 4DVJA 4OH7A 1JSXA 1BYUA 2JLUA 1SB9A 3CF6R 1DWPA 1I7DA 1P9WA 1XF9A 3VR3A 1Z82A 2ISQA 3FHJA 1M7HA 3AHEA 1HQCA 1UMCB 1WP9A 4OP1A 2Y4OA 4DLZA 2QLNA 1II0A 1UBLS 3TMYA 4MQFB 4JKOA 3MQ4A 1PD1A 3P9NA 3FB1A 4O4LA 1RAEA 3DE3X 4FCCA 4PO8A 4EQ6A 2EDCA 3DYIA 1W0CA 1OYYA 3NRBA 4U7WA 2VAMA 3QKWA 1CPYA 1I80A 1Q7RA 4YCCA 3AF6A 4G5SA 1H3EA 4OYRA 2EHDA 3NTQA 2P3SA 4EYQA 2WOJA 1QYDA 1B00A 3V7FA 5CFZA 1TM5E 2ESRA 4UNIA 4ZDJA 3BVPA 1BDHA 4AULA 3GLRA 1FFAA 1R3DA 3LHSA 3A32A 1G18A 1KAEA 4N3CA 4Q19A 1U9IC 3C5HA 1C50A 4CT5A 4D99A 4YAIA 3WGGA 3BULA 4J0QA 4YV2A 5HP4A 2QUBA 2YWJA 4XDYA 2V7QD 3E9ZA 5IT0A 4H0NA 3TECE 3E3NA 4LWPA 5HEKA 1X94A 3TDMA 5JQGA 1U2PA 3PFBA 5E0KB 3PEWA 3KZOA 2Y1CA 3KLMX 2MCFA 3VKGA 3SHQA 1JYFA 2JF0A 1JIJA 1RLOA 1V7CA 1UZAA 2KMLA 3DUFB 1FQOA 4BBPA 5SV2A 2RHMA 3ZE0B 3COJA 2V5VA 1ECBA 4X1YA 5A5GA 2NUBA 3AOGA 3JASB 4MWZA 4OXRA 2CC2A 3CNHA 1UBEA 3Q8XB 5E0OA 4IF4A 1Z18A 1WXFA 5ICFA 5FO1A 1Z5WA 3L7DA 4LSWA 2AC4A 3NBMA 5HDBB 5JISA 3HYRA 3PQ7A 1NBIA 4RKRA 2QTMA 4ABTA 1S5PA 1VA4A 1TTTA 1ZOOA 1RHRA 5E6SB 2P9CA 1EFVB 4IJ5A 3LT4A 2PQMA 3VR2D 4DAOA 4IJVA 1AQNA 4FFBA 1RP7A 4QSMA 1YDMA 2IPLA 3QSYA 4RQUA 3NAMA 2Q3EA 2VJMA 3N7UA 4N7JA 4IEEA 4TKUB 1BN7A 2PUJA 5EJAA 4JEMA 3KUCA 5DDIP 1XTKA 2GLXA 1N7JA 4MKIA 1HE5A 4OCZA 3U2QA 4CMEA 1VI2A 2R1TB 3PUXA 3GWZA 5IBRA 4IV5A 5LN1A 4XWWA 3G0HA 3SK0A 2JD0A 3OFJA 3VBCA 5IZCC 3OKFA 1J9EA 2KX7A 3T61A 1IK6A 3VHXB 1RPAA 1I2BA 4XM1A 2O14A 1MAUA 1OX4B 1ZKMA 3QBDA 3E7DA 4EJSC 3H6KA 2JGIA 2JFXA 2FVXA 3S81A 1YJQA 1UBKS 1O57A 5CVVA 1Z83A 3O3OB 4KLNA 2XSZD 3EMKA 4J0CA 1W85B 1KYQA 3SLKA 2JCYA 1U8AA 1U0TA 4CEIB 3GXBA 1FTQA 4O2LA 5TXGA 4N5NA 5FBQB 2W58A 3QVSA 1O0CA 3IIIA 2CVHA 3OQIB 2V5AA 1EKXA 3K2BA 1Q3TA 1WDLA 2CFOA 1FPQA 2CVOA 2CYCA 2PLWA 1DTWA 3MOGA 2ZCUA 4KGVA 3BFVA 2Q4BA 3KZMA 3KZCA 2Y0BA 4Q16A 1DJLA 4UUQA 2XZTA 5DPMA 4F3NA 3EQ6A 3LZ6A 3PC3A 4MMZB 4QKQA 4GG1A 4LZWA 4MQEB 4ZMRA 1EGMB 1NDUA 3DBLB 4ROTA 4INPA 2ZRHA 1EG2A 3MSCA 4MB6A 1ILWA 4O4JA 1C7RA 4CG2A 1L7XA 4KKVA 2NO6A 2BKXA 5IJAA 4E94A 4KU4A 1KPGA 1G7SA 1L7RA 5ESXA 2JDIA 1PKXA 5C0OE 4Y2SA 2HCRA 3P9CA 1JB1A 2CNNA 3OIDA 1RAHA 3RSHA 1QHIA 3SKYA 1QZZA 5EJ9A 3AUSA 2ZKIA 1NMSA 1THTA 2R86A 2JH9A 2WHPA 3MTEA 1YO6A 4NJOA 4D4LA 2ZIXB 4B9AA 3QVTA 2QUIA 3A70A 1GHTA 1C4KA 1I4TD 2XE6A 4XX1A 5HDQA 4MWBA 5I8PA 1Y81A 4I81A 5AOBA 1A82A 2OD2A 2Q5IA 1ZMTA 3KK0A 4V03A 2XWSA 4LFBB 4N5HX 5CLGA 4TQGA 4GRAA 4WECA 1OV6A 1UXIA 2ZDGA 2A57A 1KSGA 2WF8A 2GJ8A 1JHYA 1S9HA 2XUPA 1DP4A 3PQCA 4QWWA 3SYLA 1TQHA 3AETA 2A9QA 2Q3HA 4DV5B 3CEMA 3BZWA 2JIRA 3G79A 3UC9A 4C7JA 2EW1A 3OMXA 2AMJA 1EESA 3MRSA 2M2IA 4MDYA 1QIMA 2GD0A 3G3EA 1JEOA 1S02A 2HMUA 2DWUA 2QW1A 3G2KA 3TQCA 1QGAA 1N8SA 1Y4UA 2VJOA 1GAJA 1J20A 3Q15C 4MZXA 4TTQA 3LT2A 3NOVA 4DDHA 4F4HA 1APBA 4H0FA 3B12A 2GEFA 3FH0A 3CZ5A 2G9VA 1DJNA 1OI4A 4FFMA 2YOHA 4JLMA 1VECA 5CX1B 3FWZA 3AINA 3F46A 5DHRA 3CEPB 2I29A 4FB5A 3SHVA 1PWZA 3V1KA 4Z7QB 2DOKA 2J3LA 5A4KA 2IH4A 3C74A 1RWBA 4U4AA 4KUHA 4POAA 5LOVB 1Q1EA 1O87A 2C3OA 3WB9A 4CM9D 2ZIGA 2JAOA 1MTOA 2XF8A 4KACA 3D3JA 4L6CA 4U2CA 5BVGA 2J6IA 2JFQA 1C8VB 3QNWA 4FYJA 1P6XA 3IKVA 2I78A 3ASVA 3TRJA 1T6XA 2QAIA 5GVSA 2O2CA 1J97A 2QJTA 3DPIA 1XZMA 3C15C 3TBHA 2CFCA 1DNPA 3RUPA 5BOSA 4NARA 3EG9B 1OASA 2R2GA 3AVOA 5KSPA 1KMQA 2VN8A 2BHSA 5KNBD 1LV7A 2H1SA 1SEPA 4YMIA 1X7GA 1XZAA 4YCNA 1KO4A 1HKUA 3JD0A 5LNK1