5KZMA

Crystal structure of tryptophan synthase alpha-beta chain complex from francisella tularensis
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
269
structure length
260
Chain Sequence
b'MTNRYTTLFANLEKRNEGAFIPFVTIGDPNKALSFEIIDTLVSSGADALELGIPFSDPLADGPTIQEANIRALESGITPKDCFDILTKIRAKYPHIPIGLLLYANLVYANGIENFYQKCLDAGVDSILIADVPAHESKEFRDIAKKVGIAQIFIAPPDASESTLKQISELGSGYTYLLSRVGMPVEDVLTKLREYNAPKPVLGFGISKPEQVQQAIKAGAAGAISGSATVKIIQNNISNKQKMLNELTYFVKEMKAATLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptophan synthase alpha chain
publication title Crystal structure of Tryptophan synthase alpha-beta chain complex from Francisella tularensis
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Lyase
total genus 80
structure length 260
sequence length 269
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2016-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 5kzmA00
2RDUA 3QMSA 5EBUA 4WD0A 3MP4A 2A6NA 3W1MA 4C1LA 3ABSA 4RLIA 5CPOA 4LS1A 4JX6A 3DGRA 1KM1A 2QDHA 1AG1O 3HPZA 1L6WA 2EGZA 3CM4A 1G69A 4XBKA 1PE1A 3W9ZA 1TQJA 1D3GA 1G7VA 1OX5A 2EHHA 5AN7A 5K7JA 2FIQA 3NZRA 3PBYA 3B04A 2FQIA 3HOJA 1LLZA 2E6YA 1S5TA 1TTQA 5G1YA 4DBEA 5A8GA 2ZZ7A 1ICQA 2A6LA 3DENA 3W86A 3QJAA 3FOKA 3FJLA 3S5OA 1H62A 1H7WA 2J88A 2YYTA 2CLIA 3EB2A 3A9IA 3M47A 3STGA 1SO3A 1XFBA 1A5CA 2CZ5A 1TO3A 2E77A 2WNQA 4EVZA 5DBUA 3VE9A 3MMTA 1AL8A 1JVNA 1B4EA 3LTYA 1T8XA 4ICNA 1I8JA 1NVMA 3BLIA 3DFSA 4ZQCA 3Q2DA 1EP2A 1SQ7A 3LHWA 3UWWA 1FXPA 2H3BA 1GVOA 2WKJA 4HSOA 1CI1A 4UFHA 1LOLA 4CNOA 1A5BA 4QQ3A 3MHUA 3IGUA 4A22A 1LRQA 1ADOA 2FFCA 2JKAA 1KV8A 4GFSA 3HGJA 3A22A 4PH6A 4J9JA 3QYQA 1IF2A 1KTBA 3NQ7A 3LX9A 4RZ5A 1X1ZA 1JULA 2YYUA 4O15A 1XDLA 4O1DA 1OX4A 3HIJA 3PWAA 4JD4A 1KFCA 4JTUA 2V5BA 3BG3A 4JY8A 1OFOA 1IIHA 4LOCA 1U5JA 3NQ8A 4O4VA 1ZJIA 1FWRA 2JBMA 1MXSA 3F1QA 3SW6A 4OT7A 2QAFA 4R7JA 1QOPA 3W1AA 3W1RA 3O63A 3W7EA 2H3DA 2YGYA 1S3HA 4AF0B 1VRDA 2NX3A 3IVTA 2P0OA 2FTPA 3VKJA 3PUOA 1JUBA 3W88A 4EWND 3R13A 5FEZA 3THAA 4XKYB 3O6CA 2V81A 3IEBA 2Y88A 4IQLA 2FPVA 5H91A 5TQLA 1TSIA 4NZFA 4O0ZA 1EB3A 1GEQA 3KVKA 3SIZA 3W7IA 2Q3OA 1R2RA 3SSJA 3ABOA 1OABA 4O53A 4UFMA 2E09A 2E5CA 4X9SA 3NEVA 3C52A 3G1AA 4BI7A 4MJZA 5LGXA 4NX5A 3UZJA 1LCOA 1JCLA 1YXYA 1ICSA 2WQPA 2QJHA 3QH2A 3G1FA 3MP3A 3TQ0A 2Y85A 5LHEA 5LKYA 3NPVA 3W7GA 1ONRA 1GVRA 7TIMA 1TRDA 4UMCA 3LHTA 4Q32A 4IPJA 4JEQA 3C2EA 1LBMA 3U8GA 3T4CA 4FO4A 3NR0A 5F4SA 1TTIA 1X1OA 2F7FA 3EX2A 4DO5A 3KX6A 4IJBA 4L4MA 5DCDA 1VGAA 3HJZA 2ZRVA 4HSNA 2X1UA 3EKLA 4JTHA 3BARA 3W2MA 1Q45A 5TIMA 4M7SA 1JJKA 4YMZA 3TC7A 3P7YA 3GKFA 1O4UA 1KM4A 4OGZA 2YX0A 1GTHA 1C8VA 3DHFA 4K37A 4I7UA 4RX0A 4FF7A 1JCYA 4MZ1A 5I3KA 2ZFAA 5FF3A 1F74A 1W54A 2C3ZA 3TSDA 2EAWA 2WO5A 5D38A 4O1AA 3NPWA 3KRUA 2FB3A 1ME8A 2GQ8A 3NQFA 4OWGA 3HO8A 4UTHA 1NF0A 3MP5A 2W6RA 1PHQA 3UXDA 4K7VA 3QRHA 3OHIA 4IXXA 1K7FA 3N14A 1GT8A 5DBTA 3TJXA 4NX0A 1XXXA 1H7PA 4UFKA 4PC8A 4MUZA 3CU2A 2VC6A 3EWUA 1BWLA 1H1YA 2A2IA 4RZ6A 1V7YA 1FCBA 1KM2A 3DKLA 3N3MA 2E6DA 1G4SA 3EWXA 4FNPA 3LCIA 4YLWA 3L0KA 4QNWA 4KFPA 4LU0A 4FXSA 3W3OA 3WJXA 5KSWA 3MHGA 3P8JA 3AO0A 1A53A 5DXXA 3L5MA 4YCPA 3QMRA 1FWNA 1THFD 5AYYA 1LTDA 3QPZA 4YCOA 1KFJA 4DEFA 4LVGA 1WA3A 1CX9A 3EWYA 3GKAA 3O05A 1J2WA 1RD5A 5BMXA 4JNMA 3C56A 5G4EA 1SO5A 4IX0A 3W1XA 1W56A 1XBXA 3B4UA 3N2MA 3LB0A 2E6AA 1GJPA 1K03A 3M7WA 4CCDA 3W7CA 3O16A 1IXQA 1BKSA 2EF9A 1H7OA 4JTIA 4IPIA 1TCDA 2QCLA 3V75A 3EXSA 1MEIA 1QPQA 3QPYA 1N55A 1YYAA 4CNPA 5U4NA 3TV8A 4M19A 3L67A 3IIOA 2R94A 1JCXA 4UTWC 1DVJA 4K39A 1YXCA 2VFDA 3EWWA 3BW2A 3IV3A 1K7EA 1FCQA 2WNZA 1XI3A 3TMQA 2AAMA 4LS0A 2RKXA 1TJRA 3HG2A 1VC4A 4Y9AA 1VQTA 2C0AA 4MZYA 2YFOA 2JKEA 3E96A 2QEZA 2VELA 2XN2A 4LY8A 5D33A 4UCGA 4MLJA 2YCEA 1YTKA 4ZVJA 3KXQA 4BWLC 3P74A 4DO6A 1LDCA 3W85A 1D3HA 2ZTKA 3IIXA 5D03A 1OHLA 3H53A 3FKKA 1WOAA 3N9RA 4AWUA 2V8ZA 3W6YA 1FCUA 5KZDA 3PR2A 3MJYA 3P5ZA 1R2TA 3TK7A 3FLUA 2CLKA 3LBCA 1CW2A 3E02A 3DBPA 5LNRA 4X2RA 3L66A 4DBDA 5EA9A 3IGXA 2QCCA 3CQ0A 2TSYA 1VR6A 5AC7A 2C18A 2O7SA 5D30A 2V0TA 3NQDA 1H51A 1OFDA 2OJPA 3RMJA 2TPSA 5K9CA 1VZWA 3W76A 2VFIA 2XN0A 3UWUA 4YXGA 4O10A 1XBZA 3WFAA 3FIGA 4XTDA 4AVFA 1LM1A 4N9CA 4OE7A 3KOFA 3OA3A 3SI9A 1JRCA 1RV8A 2V82A 4KFOA 1RPXA 2V2CA 2VEPA 3GAKA 1GVFA 1XCFA 1EP3A 1L9WA 2GQ9A 3ZS4A 3EWBX 5FEXA 3RLVA 1QAPA 4H4IA 2OCZA 2XN1A 3PM6A 3M5XA 2ISVA 1H61A 3G3DA 4HNVA 4HPJA 1XDMA 4A2SA 5GVJA 3NQVA 1U83A 5CPMA 1FDYA 4JTGA 2NLIA 4A2RA 3I7QA 3W2NA 4UIOA 4BF9A 4O4WA 2YFNA 2Z1BA 4IXHA 3IIVA 5HINA 5BRBA 4DPQA 2Q8ZA 3LERA 1I2PA 4TO8A 1GYNA 1F7BA 5F1UA 3IVUA 4B5NA 1X8FA 5FF0A 3MYPA 4LT9A 4K7YA 1W5OA 5IBXC 3NL5A 2ZZ1A 3GNNA 3W1TA 3B8DA 4GE8A 3JS3A 3ANYA 3DFPA 1TPB1 1Q6OA 3FFSA 5G2IA 3E49A 4AEOA 2ABBA 1UB3A 4FB7A 5HUPA 4GRSA 1H63A 2QUTA 4JGDA 1KLYA 3SY5A 5I3IA 5LZLA 1GYLA 2ZZ4A 2QKFA 2GPTA 1ZAJA 3ELFA 3FS2A 4LW7A 3DAQA 3BW4A 1PCKA 1FWTA 4ZQOA 1M5WA 2NV2A 3DFOA 4Z0SA 3PB2A 1GPWA 5K4XA 3SGUA 2A1YA 3INPA 6ALDA 4WY0F 4JTFA 2X2GA 4S2BA 5K9DA 3TDFA 1P1XA 2G97A 4MKNA 1OYBA 4O17A 3TFCA 2FLIA 3UWYA 1Z42A 4EOUA 3TW6A 1ZY9A 1SZNA 3M1ZA 3B05A 4FEZA 1T0OA 5HMSA 3LI1A 3USBA 1O5XA 4FIQA 2J9ZA 4LTSA 3FYOA 1A50A 4NUWA 4TU1A 4NJKA 3GXNA 1QWGA 3NL6A 1HFBA 2A85A 1K3UA 3NM1A 3TCEA 1K8ZA 1EPXA 5D37A 4HNNA 1GTEA 4UNKA 3GZ3A 3NM3A 1DQXA 3GR8A 2A5HA 3G18A 1OFQA 1UUMA 4OV9A 1ME9A 3NXFA 2OT1A 2A4AA 4N02A 3O1NA 4WQ6A 4WXYA 5H2ZA 1PL9A 4Z1CA 3W1NA 1FBAA 3BG9A 3G0UA 3C6CA 1JRBA 3OBKA 2Q8LA 1KLZA 1XKYA 4O16A 3GDTA 3NQEA 5K9XA 2C16A 3MI2A 1I2QA 1JQXA 5K3VA 1EIXA 4FXRA 5AHIA 5G2HA 1VHCA 4WUIA 1LROA 1GVSA 4LNYA 5C6MA 2Y61A 1W3TA 3N9SA 2A21A 5LNSA 5D04C 2QUUA 4JYFA 4BI5A 3S9YA 2AQWA 4IMGA 4WY0B 5J5DA 1B9BA 1WYIA 2EKCA 3UY7A 1FDJA 1TV7A 1OFEA 3KRSA 3GNDA 3LHVA 4DELA 3GXTA 1TPFA 4NNAA 2H90A 5G5IA 5HULA 5EPDA 5EYWA 3B03A 3LHUA 4DF0A 2QCNA 3P82A 3QM3A 4CCCA 1PHWA 1B3OA 4JS3A 2NUXA 5CPLA 3GAYA 2DJLA 2H8ZA 3NDOA 3S42A 5LSMA 4UTTA 3L5LA 4A21A 1QPRA 3W1PA 4UR7A 3PY2A 1NSJA 3RK8A 3UNDA 1SW7A 5F4WA 1SUXA 1V5XA 3L9CA 4ZQRA 3DH7A 2YPIA 2YSWA 3DXIA 3PUDA 8TIMA 5DELA 3W1LA 4MZ8A 1R46A 4PCFA 3B0PA 1JCJA 2QCGA 3P62A 5K4ZA 3QF0A 1G67A 3F03K 1R2SA 3LRMA 5CSRA 4N6EA 3UY8A 3NAVA 2KZHA 4Y90A 4UTKA 2ISWA 2VENA 1WXJA 3NPUA 1P4CA 3UWVA 2NV1A 2VFGA 1RQBA 3HMJG 1DBTA 1LBFA 1TIMA 1ML1A 1OFAA 4JDYA 1ZCOA 2UV8G 5FF4A 2J27A 4XTIA 4DF2A 3PAJA 4W9TA 1ZALA 3R12A 2QCDB 5HR7A 3TSMA 4POCA 4ADTA 3HF3A 2TYSA 1JCMP 5HWJA 1WX0A 1Q6LA 3W2LA 1YXDA 1W31A 1TPEA 1H7NA 4I7VA 4NXKA 2JK2A 4AB4A 2Z0IA 5FF7A 4LS2A 1XUZA 3I6RA 4UFIA 3WK0A 3NZ1A 2NWRA 4PEKA 4QISA 1W5QA 2C14A 1G6CA 3W07A 5AB3A 3G1DA 4Z08A 4CLMA 1W8SA 3TSBA 1JCNA 3PG9A 1GQNA 2DZUA 3P81A 3JRKA 4UTIA 2ZBTA 2C13A 2DJXA 1C9DA 4IUOA 5HJLA 3W70A 3I65A 4MFDA 4G1KA 3TMLA 4DO4A 3TQVA 4JTTA 4U28A 1OK4A 3NO5A 1L2UA 3PVFA 3TNOA 4H6KA 1SSGA 4CQ9A 1LOQA 3TU9A 3LRKA 3IVSA 5AHEA 3UD6A 3WJWA 1FXQA 1HTIA 1FQ0A 2X16A 1DV7A 3W7RA 4I7WA 4E2DA 2NXGA 2GQAA 3TJLA 1ZNNA 3MI6A 1W3IA 2R91A 2OZ0A 5EL1A 3EKZA 1LRNA 1Z41A 2WJZA 1QO5A 1RVGA 4XQ6A 3DKJA 3LI0A 4HNUA 3TXZA 1SFJA 1YTEA 4FNUA 2VOMA 4O12A 3Q37A 4O11A 3O6DA 1W3NA 3B0VC 1F73A 4BFAA 4FX6M 2JGQA 3LRLA 3GR7A 4LUJA 3TQKA 3WK2A 1SO4A 1KFKA 3HG4A 2BSLA 1X7FA 3WJSA 3F4WA 4ORMA 3RNDA 5CZJA 4Z1AA 3UZ5A 1RQEA 1FX6A 1OYAA 4FNSA 1H7XA 4TMCA 1EEPA 3LHYA 4HPXA 3NOEA 1NAL1 4UR8A 2ZA3A 1RR2A 4MLRA 5LGZA 4GUFA 5D2WA 4EF9A 3V1PA 2VEIA 2CLLA 1ZFJA 4JTJA 3GDLA 1YDVA 4JXCA 3NQCA 4AH7A 4GUHA 5DY3A 2C15A 3QW4B 3SECA 2RHGA 2ZRYA 3N19B 5AOUA 4U4MA 3M43A 1N7KA 3EXRA 1QPOA 1FY6A 4N2YA 3IIZA 3STFA 4X3ZA 5AHMA 4EIVA 1Y0EA 2ATMA 4IMCA 3QZEA 4K8EA 5CKSA 1LLWA 3C2VA 3DU0A 1Q3NA 4OHQA 2E1DA 4O54A 4ADUA 1DOSA 1I2NA 4N9DA 3DFTA 5FI8A 5DXYA 3KVMA 3B06A 4UTLA 3RU6A 1O94A 3GB6A 1R47A 2YXGA 4S2CA 3W7PA 4O0KA 4O13A 2FB2A 3GIYA 3EX1A 3ATZA 2ZZ6A 3DI0A 1Z44A 4LVBA 4K8HA 4WJEA 3G3MA 2CZDA 2CLHA 3C2OA 4XWUA 1AW5A 1WV2A 3NVTA 1I2OA 3G24A 4LV4A 2DZPA 2GJLA 1KFEA 3EEGA 2F84A 3G1HA 4Q33A 3FJ6A 3R89A 3BO9A 2OMAA 4C1KA 5AC6A 3W75A 1Q6RA 2B7PA 3CHVA 3CWOX 1RQHA 4AF0A 1NFBA 4O57A 5IM51 3L2IA 3KVLA 3PS7A 2I9EA 1AK5A 2HS8A 4MYXA 2J24A 2Z6IA 3S5ZA 1N8FA 3M0ZA 2WOQA 3F4NA 4XKYA 1LYXA 1LBLA 2A7PA 2NUWA 3PSVA 2X1SA 2VFHA 2PCQA 4RKAA 5D2VA 4AWSA 2ABAA 2YW3A 2RDTA 4LVAA 3HPXA 2ZA2A 4R53A 3TW7A 3EX6A 5D32A 2ZRXA 5EY5A 1KM0A 2DZTA 2QJIA 2DORA 4YWIA 3O07A 2WPBA 4OQVA 3NG3A 3LXBA 3OIXA 5G1TA 2CWNA 1EWEA 1XL9A 3BGJA 1QO2A 1TREA 1TPH1 3W1UA 5U7SA 5DY2A 3FKRA 1F05A 4ZQNA 3TE9A 1H1ZA 2FJKA 3L0GA 4AHQA 1HO4A 2PURA 1DJQA 2B7NA 2CZEA 3STCA 1P0KA 1F6PA 2V9DA 1TRIA 3BPWA 3W83A 3LXAA 5BNKA 1BWKA 2JGYA 1W5NA 2CW6A 2QCHA 2QCEA 4CNNA 3W2JA 1IXNA 3A23A 5I3JA 1PS9A 2ZTJA 3W7HA 1HG3A 3L21A 3P61A 2NXHA 4PA8A 4WXZA 3DFQA 3M41A 4JX5A 3P8IA 4O18A 4UTWA 4ZMGA 1KM5A 5DCBA 5E93A 3S8HA 2ZRZA 1LRTA 2QCMA 3HQ1A 1Q6QA 1S5VA 5FEWA 3VFLA 1M7OA 3M5ZA 2PC4A 3PSWA 3OVQA 2J9YA 2ZRUA 4Z0JA 2RDWA 5F2LA 4BWLA 1IGSA 4ZZ9A 4ORIA 2B7OA 3T44A 3MWAA 3SZ8A 5LNWA 4LRTA 4QAIA 2X1RA 2GUUA 3IIPA 1TPUA 3ABRA 1TTPA 5F4XA 4WX2A 3W7KA 1J5TA 2QJGA 3TAKA 1WBJA 3UWQA 3TUUA 3LM7A 1L6SA 1W0MA 3LDVA 1OX4B 4NJGA 1QOQA 4JYDA 2HTMA 2QAPA 2QDGA 2ZYFA 3M9YA 1G4TA 1QPNA 3G1YA 5F1VA 1KFBA 1P0NA 4S1FA 3WK1A 1AW2A 1YDNA 2TMDA 4KWWA 3W84A 2RH9A 5AFDA 4BR1A 4GWEA 2B7QA 4TX9A 3SGZA 2A0NA 4MVAA 3LGEA 1FWSA 4CCEA 3TR2A 3VCRA 3MYOA 4RK8A 3T7VA 2X30A 4XUGA 5LNUA 1D9EA 3TH6A 2WV8A 3E0IA 2PRMA 5EKYA 1IIGA 2VFFA 4K38A 3MO7A 1XM3A 4NNBA 2B4GA 3WK3A 1DORA 2WSYA 4WOZA 4JIPA 3LHZA 1FDZA 3A21A 1L6YA 3GDKA 3S1WA 3LCXA 1DHPA 2DP3A 4ADSA 5I3HA 1TJPA 1ZAHA 4ZL1A 3GX9A 1HUVA 2BX7A 3LCLA 4JDBA 3ABQA 2ZDRA 1SZFA 1YADA 1MEHA 3PBWA 5MHBA 3W74A 4KFNA 3MI3A 5IBXA 1AW1A 1VHNA 2FPYA 4N9BA 3R2GA 2V5LA 3BW3A 1GZGA 3W2KA 3HG3A 2X1TA 3KFTA 5BMWA 3R5EA 5DLCA 1OYCA 1UJPA 2QF7A 4QSHA 1K7XA 3G1VA 1NF7A 1OX6A 1W1ZA 5HQEA 1T99A 1SR9A 1LORA 2Q3RA 2NUYA 1LZOA 4AMAA 2CLMA 1PIIA 2FPTA 3MBDA 4R33A 3N34A 2ISSA 3L65A 1EA0A 2ZZ2A 4NT0A 5TBOA 3P84A 5C55A 1GOXA 4LVFA 3ZWTA 1R30A 5CSSA 1QMLA 4DXVA 2NX1A 2J6XA 2ZZ3A 1H7RA 4UTMA 3TXVA 3W7QA 1KFLA 1ME7A 5FEPA 1GG0A 3RFAA 4N4PA 3HGSA 4PFMA 3NQGA 3OG3A 2Y7FA 1SO6A 2NWSA 3W87A 5E0KA 1JR1A 2WSQA 3GDMA 3TIMA 1YTDA 4KKXA 4PL2A 4X22A 4M5PA 3NGJA 4TIMA 3BG5A 1OK6A 4QIUA 3TROA 5D02A 2Z6JA 1SW3A 1PVNA 3G1SA 2QCFA 2A7RA 4AHPA 4MFEA 2CZFA 4WZHA 4H3DA 3C2RA 1F76A 3C8FA 4O1BA 4GNJA 4HIBA 3PC0A 3BV4A 1KM6A 3QSRA 4M6QA 1MZHA 4UFJA 3QMTA 1XBYA 2VXNA 4UFLA 4MYAA 4LUIA 1F5ZA 3CEUA 1EWDA 4QM1A 2O7QA 1TPWA 4M7TA 5C2XA 3DZ1A 3LV5A 1M7PA 5CPNA 1YPIA 3PUEA 5AHNA 2P1FA 3P60A 4NVTA 1TB3A 3D0CA 2AGKA 1OFBA 3C4UA 3PG8A 3GVGA 2GJNA 3GYEA 1QNVA 5K2ZA 3QFEA 1UUOA 3NQ2A 2BLEA 2R8WA 2YDAA 4N4QA 1G4EA 3G1XA 3H55A 3P67A 1S5WA 2RFGA 3NQAA 3B0UX 3M5VA 4MY9A 3M6YA 2CFFA 2Y62A 4UTUA 1HO1A 1KV5A 4JIQA 1OJXA 3LTSA 1DJNA 3UPWA 3W71A 3MW7A 3SR7A 1YPFA 3W23A 1H60A 2Y7GA 3G0XA 4MY8A 4GUIA 4UNLA 2Y6ZA 3PF3A 1WDWA 1DL3A 2VFEA 5BOOA 4WOQA 1FUYA 4O52A 4Y8FA 3LV6A 2PRHA 1BEUA 3LLFA 4MOZA 2ATSA 4IGHA 3LXCA 4NXSA 4P2VA 5LNVA 2V2DA 4ZQPA 1K8XA 4UC5A 4N6FA 3SJ3A 2WSRA 1I45A 3P80A 1I4NA 1W5MA 2GVJA 4RZ4A 4O14A 1UCWA 2P10A 3RLUA 3PB0A 1TV8A 1VPXA 2HMCA 1JUKA 5BW6A 2VKZG 4JTLA 3E9AA 5E1QA 4JY9A 3C3NA 2C6QA 2D73A 2QUVA 4IMFA 3NA8A 2ZQ0A 5EMUA 1TPVA 2BTMA 4HKPA 3VNDA 3CTLA 3IGSA 3G8EA 4O1CA 1FCVA 1QDSA 3FEMA 2YZRA 5LHFA 1VYSX 4JN6A 1JUEA 2NXIA 1QFEA 5CZTA 4RXGA 1VCFA 5J5RA 2TRSA 1ZHAA 3I68A 1MSSA 4E0CA 4JX4A 2Y89A 5KINA 3I7SA 1LP6A 1WOBA 2ZA1A 1A5SA 2H6RA 3FYPA 1TYGA 1OFRA 4UMAA 2EPHA 1UASA 2OX1A 3W7JA 4Z1BA 4AXKA 3LCHA 4OBTA 5FESA 1VCGA 3E12A 5F2GA 2CLEA 5HR6A 4RR4A 1H50A 3H54A 4NQ1A 5KTLA 2CLOA 1VH7A 4PODA 1Z48A 2HSAA 5G2WA 3LLDA 1EUAA 4A29A 5FF2A 3BGGA 3NQ6A 1OFPA 4UTJA 1M6JA 5F2MA 2ZZ5A 3KVJA 1ICPA 3DI1A 3KHJA 4R34A 2DZSA 4TMBA 3LBMA 4XZ9A 1QR7A 4WY0A 4Z1DA 4CQ8A 3IRDA 1O60A 1SU5A 2G95A 3KAOA 2ZCGA 3RF9A 1H5YA 2I1OA 5CG7A 1A5AA 1ZENA 3QQ0A 4DF1A 4JTKA 4BI6A 1WQ5A 4LWWA 1AL7A 4QJ1A 3MUXA 2BZNA 3O8AA 1JQVA 2VEKA 3VE7A 2E5DA 4UMBA 1YDOA 4QNEA 4JTSA 3S6DA 3TA6A 3W22A 3CPRA 4AWTA 4IOTA 4ML9A 1KBIA 3JR2A 4FX7A 4NJHA 1VYRA 3PBVA 3HBLA 3M44A 5D09A 3OEXA 2C19A 5AC8A 1B4KA 1OG0A 2DZWA 3C61A 3DHDA 1OF8A 3GK0A 5D05A 2DU2A 3G8RA 3HB9A 4DPPA 4LRSA 3LCGA 1MO0A 3CLMA 4ONVA 1OVDA 1KA9F 1QCWA 2Y7DA 1SZEA 5HWNA 1VLWA 6TIMA 1KTCA 3S5NA 3ATYA 3PBUA 4ALDA 1O5KA 3LCFA 1VLIA 2B0MA 3A5VA 5KMYA 3HGRA 4YL2A 5AHFA 4IX2A 3W73A 4L4LA 5CGQA 4QITA 2W79A 4O28A 4AHOA 1DKWA 4RV8A 1RZMA 5A5WA 3QW3A 1TMHA 3W72A 1PV8A 3LCWA 4GJ1A 3TKFA 1X6UA 3R8RA 3CT7A 4NZJA 2FDSA 2V2HA 5KZEA 3THQA 3BVJA 3U2OA 4EF8A 2DZVA 2QCDA 1T96A 1G7UA 4GC4A 3S0CA 3GLCA 2HS6A 2ZRWA 3OVPA 4OV4A 2NZLA 4MY1A 3KRZA 3CB8A 3N2XA 1W37A 5KZMA 1XC4A 3Q94A 4E38A 3T78A 3STEA 1VCVA 3YPIA 1EP1A 3UXAA 2E6FA 3Q58A 3SFKA 1TPDA 2G96A 3QSTA 5AYXA 1I2RA 4RXFA 4D2JA 2OT0A 1XBVA 4NJIA 4A3UA 4ZQMA 3CC1A 1LOSA 2QR6A 4MPQA 1GWJA 2E68A 3FA5A 3T55A 1KW1A 2YR1A 4FIRA 4LC6A 3T40A 3S1XA 3UWZA 1KM3A 4O19A 4JYEA 3TX9A 3W2UA 2YW4A 3LOTA 5HNRA 5T26A 2CLFA 5C54A 3HG5A 1WBHA 3QQ1A 1J4EA 2GOUA 4N9EA 3TAOA 1K02A 4M6PA 4LVDA 1TTJA 4LC8A 3W7LA 3HPSA 1SW0A 3AJXA 1KBJA 3CIWA 2VEMA 5D2XA 1G4PA 4BK9A 3NQMA 4RCXA 3C2FA 1HL2A 1YLVA 3N73A 5F2IA 4UXDA 2CU0A 1FWWA 3O6YX 3TFXA 4GUJA 3W7MA 4LV9A 5HWMA 4I9AA 1K8YA 2H8XA 3CIXA 3NL2A 1EUNA 3UQNA 4Y6GA 3NPXA 1AMKA 4MJMA 1DQWA 4FNRA 2W0UA 2GVGA 4HT3A 5KITA 5D2YA 5CZ0A 3UPBA 3TC6A 1TPC1 4O8RA 3W7DA 2R14A 1PCWA 3S1VA 2GVLA 4K36A 1BTMA 4IMEA 4P61A 1XUUA 4GXMA 2G5WA 4IWWA 1F6KA 1TV5A 4MIMA 4RJEA 3GXPA 2ALDA 2BXVA 4IMDA 4HHPA 3A5FA 4FNTA 1EX5A 3G0SA 4TR9A 3W1QA 2E5BA 5G4WA 3S1UA 3CWNA 1SPQA 1E51A 3LTPA 3MBFA 3NL3A 5HUOA 1OF6A 3M5YA 3UYCA 5I3FA 3PULA 4Y96A 3L5AA 1UBSA 5DN1A 1W5PA 3G22A 4OU1A 5C5YA 3EWZA 3EXTA 3WJYA 3K30A 4XBSA 3OVRA 2Y7EA 3O15A 1P5BA 4FNQA 3VI2A 1ZAIA 4NNCA 1C29A 2LLEA 2NX9A 4NJJA 5ABTA 1MEWA 3QC3A 3C0JA 1WAUA 3GDRA 1TQXA 4PL1A 4GUGA 4JR5A 1VYPX 2V30A 5D2TA 3DFNA 3I7RA 1NEYA 2J9XA 3CEPA 3W7OA 4O50A 4M6VA 3P5YA 2Y63A 4FX8A 2PRLA 2XFWA 2Y70A 1KTNA 4PTNA 3MHFA 5DCEA 3EX3A 3WJZA 3L0NA 5AHLA 2PE4A 3HGOA 4Q4KA 1F2JA 3S5YA 1IXOA 2IQTA 1GVQA 3L68A 1O95A 2C1HA 1GG1A 5CZSA 5SWUA 3ZWSA 4GBUA 1ALDA 3BK0A 3NNTA 1VJIA 5AYZA 4HNTA 3BLEA 3O06A 3ZFHA 1SSDA 1SZGA 3A24A 3BLFA 4FHAA 4JICA 4K6AA 1VS1A 4NU7A 1IXPA 4KWVA 2DZXA 2JKPA 2A7NA 4UTTC 3U6WA 4E2BA 3ZR4A 1B57A 2WNNA 4JTEA 5I3GA 3M16A 4CQAA 3NYZA 2BWGA 5L9FA 4DQWA 4HN4A 2I14A 4UUIA 5L6UA 3W7NA 3QEZA 1SFLA 2Z2UA 3EX4A 4AAJA
chains in the Genus database with same CATH superfamily
2RDUA 2XH2A 3QMSA 2YCLA 4PTVA 4IZGA 3IUDA 4WD0A 3W1MA 1W2VA 2VEGA 5CPOA 4LS1A 4PRWA 4KBXA 2NW0A 1L6WA 3E2QA 2P0IA 2DSUA 2R1PA 5FJJA 1G7VA 5AECA 2QLYA 5AN7A 3AHYA 4ZXLA 3H26A 3PWIA 4LH8A 4AMCA 2A6LA 3DENA 3W86A 3QJAA 3FJLA 4R9OA 4G5DA 3QV8A 1H7WA 3N2TA 3I4EA 2J88A 3Q4DA 1UD8A 3M47A 3STGA 1SO3A 4XZNX 1Q2SA 2CZ5A 5FJUA 4MJ2A 3WNPA 4PMJA 4BEUA 2WQDA 2ZXQA 3WFLA 4M24A 2QS8A 4HCHA 4ICNA 4QLKA 1I8JA 4ZO7A 2PDMA 3FXYA 4BQ5A 1FXPA 5CPTA 4DWSA 5H6HA 4W8BA 4UFHA 1LOLA 3CJPA 4IICA 2OZ3A 4A22A 3V5FA 1MQQA 2VO5A 4DZHA 1LRQA 3H2MA 3GVQA 4S3BA 4HOZA 2JKAA 4B3LA 1KV8A 4GFSA 3CQJA 4L56A 3NQ7A 3CBWA 4RZ5A 2YYUA 2Q6ZA 4O15A 4O1DA 2HEJA 2VWSA 3HIJA 1NTHA 1KFCA 4JTUA 1ZBVA 4A8NA 4DZAA 3BG3A 4KIRA 1OFOA 2RJHA 4LOCA 1FHVA 1U5JA 1YX1A 1FWRA 3BLKA 4E6MA 2JBMA 1HKIA 1MXSA 2QW5A 3F1QA 4J2MA 3O63A 3DN5A 4JNZA 3W7EA 2YGYA 4AF0B 4XV0A 3UZXA 3FX4A 1JUBA 1B3WA 4LEFA 1KKRA 5PTDA 2ZX8A 1VFMA 1TMLA 4MDOA 5FEZA 3THAA 3O6CA 3IEBA 4O0ZA 2XFFA 2Q3OA 4WDXA 1R2RA 1E6ZA 4HYRA 3MKVA 1EO7A 2MUCA 1U22A 4GX8A 4B4HA 3WBXA 4C6FA 5TNVA 1BD0A 1JCLA 3OZOA 5I79A 2DQXA 2JFEX 5M17A 3QH2A 3VMOA 4GVGA 3TQ0A 2XH0A 2E9MA 5LHEA 1IWPA 2X0HA 3KOZA 5HNNA 1QI0A 2Y8UA 2PTZA 1G01A 4JEQA 3PZTA 1EYWA 3NR0A 2F7FA 3OPSA 3WLMA 4OIFA 1DIDA 9XIMA 4AZ5A 3GG8A 4YMZA 4KGLA 3TYZA 1O4UA 4OGZA 1OIFA 1Q7ZA 2YX0A 1C8VA 5DRIA 4ZB2A 4K37A 4Q7BA 2WSKA 4I7UA 4IIHA 3GH7A 4FOJA 4RX0A 3ITYA 2C3ZA 3FYYA 2IKIA 3NPWA 1TV4A 5HA7A 3MSDA 1ME8A 3UXIA 3UT0A 1US3A 2PDKA 3O3RA 3VZYA 3UXDA 2VGIA 3ICJA 3KCLA 3OHIA 1SFSA 1K7FA 3GUGA 2PLMA 3PFRA 2V68A 4I3GA 1GOOA 1H7PA 4H8VA 3UW6A 3AQUA 1BWLA 3TWBA 5GPRA 1KM2A 2CC0A 1T40A 1TV3A 3LCIA 3EB3A 4YLWA 3L0KA 3VDCA 4FXSA 3PJTA 2R1NA 5JH2A 5EU9A 2VL4A 1V77A 3TONA 1X6NA 1QBAA 2D1ZA 1BG4A 5DXXA 3SCNA 4MPKA 1B0IA 1FWEC 4IL2A 1NDYA 1ONWA 3EWYA 2GGIA 1DIKA 3UFYA 5EGRA 5BMXA 4ZO6A 5G4EA 2NSOA 3IS4A 1E0VA 2DFAA 1IEQA 4DUWA 1FWAC 4GHRA 4ACZB 4WK9A 2QZRA 4AZCB 3W0KA 3M7WA 4EXQA 4CU7A 3ITLA 2EF9A 2YL6A 1H7OA 4JTIA 1JXKA 3AISA 2QCLA 1DE6A 1MEIA 1W17A 4CNPA 2R9RA 5U4NA 2WWCA 3UCDA 3L67A 4NAEA 4UTWC 2WMIB 3EWWA 3BW2A 1GVIA 4QXIA 1AJ0A 4UOJA 1OSEA 3BSGA 2GK1A 3E96A 2VELA 3T2OA 4UCGA 3BJFA 2HZGA 4R9XA 4D71A 1EOMA 1A5UA 4BWLC 3HV8A 6ENLA 1JDDA 4DO6A 1D3HA 5LIKX 2DUAA 3IIXA 5D03A 1BF6A 1WOAA 2EPLX 3N9RA 2ZC1A 4AWUA 4HK6A 4G56A 1FCUA 3D6NA 3LSCA 3PR2A 2NT0A 4YTTA 1YRRA 3LBCA 2QDDA 2Y0FA 3QYSA 4DBDA 4Q4QA 2I56A 5AC7A 1WKFA 2Z00A 2ZX9A 2O7SA 3KM8A 4D6DA 3L4WA 2OJPA 4YNGA 1EC9A 3OJGA 3CMGA 5CBIA 1US2A 1PKMA 4KT2A 1TFVA 2VFIA 3W76A 3TQPA 2WBKA 4YXGA 4O10A 4FS9A 3WFAA 4TV6A 5IOBA 1V7AA 3OO2A 2J7BA 1JRCA 4XK2A 3GXMA 4ZOAA 1XG3A 2GQ9A 3ZS4A 4PRTA 3RLVA 1QAPA 3IJ6A 2VVSA 1W91A 3G3DA 4HPJA 3RXZA 1XDMA 4QHRA 5GVJA 4DWSB 1OWQA 4HOWA 2YZ5A 3HQPA 3FA4A 2PEVA 2FVMA 2HE5A 3DIPA 4BF9A 4PMZA 2O0TA 2YFNA 2Z1BA 3M0LA 4DPQA 5I0DA 3LERA 4TOQA 2GGEA 3ZT5A 3WZ0E 3EOEA 4C6MA 1R7AA 1VIZA 3GNNA 3W1TA 4ATLA 1ZB5A 1TPB1 3WNOA 2WVTA 3JZEA 3FXGA 4S3CA 3SO7A 1EZ2A 4QLJA 3MSGA 3MKCA 2QUTA 4JGDA 1ZAJA 4IUGA 3OG2A 1FWTA 1M5WA 4OECA 4UQEA 2AL2B 3SGUA 3RIKA 6ALDA 1WPCA 4JTFA 2YOCA 5K9DA 1OYBA 4ZCWA 3C2YA 2GL5A 4EOUA 4K68A 1ZY9A 4H9MA 1XGZA 5CSUA 5HMSA 3LI1A 3N4AA 4FIQA 5D9OA 2FH6A 3MKKA 3WNLA 3GXNA 1HFBA 3WLHA 1VFUA 3WD2A 4O8AA 4JQ2A 1QU4A 4HNNA 3C86A 1DQXA 3IJLA 3G18A 1OFQA 3BLDA 3S83A 2OT1A 4N02A 3O1NA 4PUJA 3WQ4A 3BG9A 1HJQA 3G0UA 1XLLA 2Q8LA 4J35A 2VYOA 5K9XA 3VCCA 5G1MA 1I2QA 4C6OA 1TR1A 5K3VA 5AHIA 3PPCA 1TE6A 4ZO9A 4AD1A 1LROA 4RV3A 1GVSA 5C6MA 1SZRA 2Y61A 1TVNA 2GUBA 4W7VA 2WJDA 4GY0A 3LNMA 1V3HA 4LCRA 1WYIA 2EKCA 1V6UA 1FDJA 1TV7A 1IEVA 1OB0A 2INFA 3PZNA 5G5IA 1XICA 3B03A 3LHUA 3SCWA 2QCNA 4DF0A 3P82A 2PDYA 2ASHA 1UWSA 5AZ0A 3UP8A 4IQJA 4CCCA 1PHWA 3Q45A 1A4MA 2V67A 3VIJA 3ARQA 3FN9A 3GAYA 1GOIA 2VNCA 2CETA 3H23A 3VIKA 4IFOA 3PY2A 1NSJA 3TYCA 3S1GA 1SUXA 2YPIA 3G6MA 1HQTA 3GE7A 3LYEA 5DELA 1M53A 3MVIA 1J8VA 1F3WA 7XIMA 2OOFA 3GC5A 4H9VA 2E8ZA 1MFUA 7A3HA 2J6VA 1G67A 3FY1A 5JMUA 3AXXA 3CH9A 4N6EA 3UY8A 3NAVA 4XZBA 2VENA 3NPUA 1P4CA 1XCWA 2OLHA 4WGHA 2VFGA 5ABEA 1RY8A 3HMJG 4ZB5A 2WC7A 1TIMA 1J0ZA 3QBUA 1O7AA 3WF2A 4ML4A 1RBLA 4PMQA 4DF2A 3PZIA 3MVTA 4U5IA 4XAYA 2XG9A 1ZALA 4YVXA 3S2JA 1TJ0A 3CHEA 3CT2A 1JZ4A 1JI1A 4NRSA 2TYSA 4K1WA 5HWJA 1Q6LA 2XVLA 1YXDA 1W31A 3DHUA 1NIUA 3F4VA 2J7GA 3TR9A 2Z7GA 2VM8A 1J5SA 1G6CA 1QRQA 2Q8XA 5AB3A 5GQBA 4GINA 4XZLX 3OP2A 3TOYA 3JRKA 4XD3A 4UTIA 2ZBTA 1JYXA 3B8VA 2DJXA 3K2GA 3IARA 3BH4A 1YMYA 2PDFA 3V5OA 4C6JA 2J7HA 4AQLA 1QHZA 1VBGA 1ONEA 1EXBA 1A80A 1LOQA 4IL0A 1E6NA 3WJWA 4C7GA 1UA7A 2G4JA 1HTIA 5D9PA 4R85A 1Q4WA 4I7WA 4E2DA 1QATA 3WD0A 5HQLA 3VIOA 1EF3A 3O2LA 2EEXA 3WMLA 3GNPA 3ONBA 1W3IA 3N2OA 3EKZA 4Q8UA 2WJZA 1V6WA 5XIAA 1RVGA 1PZ2A 5A6KA 5CLWA 1H3GA 3TXZA 4ZE5A 1YTEA 5H8MA 4DJDD 4P8UA 4C6LA 2ZE3A 2POTA 3GR7A 4R5EA 4IQEA 1UKOA 4H04A 3UR7A 1Y65A 2J4GA 3F4WA 1H41A 4ORMA 1ZBCA 1OC7A 2GGGA 1FKXA 2O9PA 2TODA 2XINA 1E9LA 3CZJA 3LHYA 4B5TA 1PAMA 2ZA3A 1RJRA 2GWGA 5BOEA 5LGZA 4GUFA 4EF9A 1CB7B 3F2CA 4LAOA 2VEIA 3P6LA 1ZFJA 4JTJA 3M0KA 3NQCA 1GW9A 3HU7A 3WBEA 3DG6A 3AYVA 2XIJA 3TW9A 1W3LA 1NDVA 3V0UA 2ZRYA 3N19B 1ZJHA 3E0FA 1Z8AA 3T2QA 2PDIA 4XO7A 2PTYA 5AHMA 1C7SA 1TV2A 2F6UA 3EWDA 4H6EA 4J27A 1V51A 2X0YA 3ABXA 4PSRA 5CKSA 2PU1A 4G7EA 4OHQA 4JFWA 4N9DA 3BCDA 2C1IA 1HZYA 2CESA 3B06A 4HHMA 4MB3A 3SDOA 1R3YA 3GIYA 4LF2A 4US5A 3ZT7A 3PBGA 3N6JA 4WJEA 4X60A 3TYBA 5ABFA 1VJSA 2CLHA 3S3GA 3NVTA 3G24A 4KEMA 4PE8A 3TZNA 3B97A 3G1HA 3VGHA 4Q33A 1Q5MA 5AC6A 3BURA 3MDWA 3W75A 4LUYA 2AKZA 4DAFA 1NFBA 3NTYA 2PGEA 5IM51 2WXDM 3L2IA 4PBGA 2C0HA 3OA5A 4MYXA 3KCOA 2CEQA 1V3IA 5C71A 3EPMA 3F4NA 4XKYA 1CXEA 3N29A 4BA0A 3F2DA 4CUCA 3MMWA 1WXYA 4OTKA 3URAA 1TMQA 1MQPA 3UEQA 4YS1A 5DEZA 2DUZA 3EX6A 5CJMA 3CASA 4HMNA 5EY5A 1GKPA 3OZMA 3XISA 1TJ2A 4OQVA 2XVNA 3NG3A 1EWEA 4LUSA 1XL9A 1TREA 3RHGA 1TPH1 3DFYA 5G4HC 1Y8BA 3W1UA 5U7SA 4CEXC 4AZ7A 3LQGA 5DY2A 2P3EA 1F05A 3RRAA 4P5UA 2QYGA 4AD0A 3QHNA 4MB4A 1DJQA 1QW7A 1DYSA 2CZEA 2X0SA 1F6PA 2RGLA 3LXAA 3BLPX 2XHYA 2FFIA 1CIUA 1NWUA 3A23A 2GOKA 2ZTJA 2CITA 1BF2A 2V3EA 4PA8A 4WXZA 1L6FA 4GBDA 4JX5A 1OZQA 4O18A 4UTWA 1KM5A 1J93A 4Y9PA 1ZQ5A 1Q6QA 1KRAC 1S5VA 4F9JA 5FEWA 1SJDA 2WANA 1E56A 3PSWA 3IK2A 4FOKA 3W6LA 4Z0JA 4BWLA 4ORIA 2B7OA 3B9NA 1KBLA 5IFPA 2E3ZA 1XGDA 3GSMA 3DOPA 3SZ8A 3EKGA 2X1RA 3B9AA 1V3LA 3ABRA 1TTPA 3RJXA 3W7KA 1JL8A 2VQUA 2QJGA 1B31A 3LM7A 1L6SA 1W0MA 4H00A 1TZZA 1Q6EA 2E8YA 2ZWZA 3TLQA 3G1YA 4DUXA 1P0NA 3S6OA 3UERA 3WK1A 1AW2A 4E2VA 4ICCX 2EO7A 4I8DA 6TAAA 2RH9A 2YDRA 2CKSA 4AW7A 1RJPA 1E5NA 2B7QA 1ZJAA 4MNKA 3RPDA 2BHYA 5A8MA 4AIUA 4MVAA 4A35A 2REQA 4BY3A 3WYZA 1ZRQA 2G3MA 4RPPA 2A3BA 4TTUA 1X39A 4QG8A 4XUGA 5LNUA 1WZAA 3FHQA 4P8XA 3P93A 1IIGA 2CNCA 4K38A 2VGBA 4NNBA 3HURA 4HZ6A 1XSIA 3RLGA 3QTGA 4WOZA 3LHZA 1QI2A 3V3WA 3ANVA 1L6YA 2ADAA 4J2PA 4O0QA 1TJPA 1ZAHA 1S1PA 4DJDC 2CZVA 4HJFA 3CV1A 3GX9A 4CD4A 2ACRA 1SZFA 2WC3A 1PTGA 3LY0A 1AW1A 2DW6A 2BP1A 3BW3A 3EGJA 2WLYA 1O6IA 3EOLA 1EC8A 3S46A 2RDXA 1OYCA 1TA3B 1MW3A 1CZ1A 1K7XA 1UWAA 1S5MA 1OX6A 1XSJA 3VMPA 1LORA 4D1JA 1EQCA 3MBDA 4AZ6A 5CQ1A 1UC4A 3UPMA 1EA0A 2FYMA 3CV2A 5TBOA 3UU0A 3IPWA 1GOXA 3ZWTA 3AIRA 1QMLA 4DXVA 2NX1A 3H2AA 3KP0A 2PDXA 3TXVA 5CGMA 1KFLA 5FEPA 1GG0A 4OBSA 1BRLB 4HA3A 3HA1A 1OT2A 3OG3A 4IT1A 2Y7FA 3FGCB 1V02E 3GDMA 1UH3A 4KKXA 3WENA 2BY0A 3FCPA 4M5PA 3NGJA 4GIRA 5E9AA 1WZLA 5D02A 2Z6JA 4WVXA 3T0CA 1PVNA 3QV6A 2QCFA 4WR3A 4ATWA 1E5JA 2A7RA 3MZ2A 4AHPA 2B31A 3AUOA 4WZHA 1J11A 2UY2A 3C8FA 3I4KA 1XYCA 1NDZA 2J7FA 3A3WA 3TLLA 3HZ3A 1KM6A 4M6QA 3AHXA 3WH7A 3NUKA 3B9DA 1HJUA 2A3HA 3QGVA 3U7BA 1V6VA 1P0DA 1VFSA 4JCLA 1TPWA 4F79A 1YNYA 3H8AA 1QT1A 5A8NA 2Y2WA 3P60A 2PPGA 1AQ0A 3PG8A 4CVWA 3GYEA 1E4IA 4QCFA 5CC6A 1QNVA 3TTOA 5A8PA 4D6EA 4N4QA 2XIOA 5M03A 2D0GA 3B0UX 1NH6A 3QGAC 4MWAE 2HCVA 1VBHA 4TVUA 3N18A 3L4UA 2VGFA 3LTSA 3PTQA 1YPFA 3W23A 1KCLA 4H83A 2VDGA 3M6DA 1VJZA 4UNLA 3AXHA 2Y6ZA 5FD0A 4NYYA 1DL3A 5ABFB 3K1DA 4YWSA 1XD1A 3UZZA 2BS9A 3WO8A 5ECUA 5F7UA 4C90A 4W7UA 4R3UA 4P2VA 2QVHA 4XSMA 1K8XA 4N6FA 2CIPA 1TV8A 3R1ZA 2AKMA 1L6GA 1H09A 4GVHA 2G3FA 3CO4A 2C6QA 2QJJA 2QUVA 2V38A 4PUUA 3NA8A 2ZQ0A 1TPVA 3CTLA 3OBAA 4WF7A 4E2OA 1QDSA 3WEOA 1EJWC 1B1YA 4PTDA 2WBGA 2NXIA 1SGJA 1XH1A 1YNPA 3AICA 4IGSA 1XYZA 1MSSA 1XISA 4E0CA 2IUZA 4JX4A 2VZSA 2Y89A 1XLJA 4S3GA 2ZA1A 1XIBA 1UASA 3TZFA 1YNQA 4OBTA 2AQVA 3BAXA 3FDKA 3SADA 3AIEA 5HR6A 3H54A 1JIBA 2GYIA 5LXXA 3SCUA 3CQKA 1JPKA 2HSAA 4KQNA 3PBMA 1A3WA 5DQPA 1M6JA 5F2MA 4C6CA 2ZDSA 3KVJA 1ICPA 3IGHX 1D3CA 2DZSA 4TMBA 3LBMA 2WVUA 3UBPC 3EA2A 3KEHA 3IRDA 1ZLPA 1O60A 3KTXA 4AYSA 1VBUA 2G95A 2NV9A 3RF9A 2I1OA 5CG7A 5H8UA 3QQ0A 4DF1A 4KRTA 3DC8A 4L9ZA 1WQ5A 1EYEA 4WSKA 1UWRA 1HJSA 2WK2A 2BZNA 5JXQA 1RK5A 3OLDA 3U9IA 2D0FA 1C7TA 1EIBA 2O92A 1AODA 1WDQA 3U5UA 4NJHA 1WB0A 3SRHA 2Z1SA 4F2UA 1UC5A 2P50A 3M44A 2C19A 2ZXDA 1BYAA 2G0WA 5AC8A 2DZWA 5D05A 1UZ4A 1EJSC 2VCAA 3HB9A 4DPPA 3BMXA 3OGVA 3K8LA 2PTXA 4ZA0A 1BAGA 5FIPA 3K4WA 1DEDA 4B9ZA 6TIMA 1KTCA 3S5NA 3PBUA 4NASA 5I24A 4FR6A 3A5VA 5KMYA 3P0XA 4IX2A 4UQAA 5FSEC 4NI8A 1IE7C 3SQSA 1HL8A 3EPNA 1UP2A 4EPKA 3NSMA 3W72A 1JAKA 3TKFA 1X6UA 1J9YA 5H8PA 4CNUA 1BYDA 1MFVA 4NF7A 2BFGA 5D9MA 1VF8A 3S0CA 1CXFA 1G7UA 1Q85A 1IR2A 1DJZA 2ZRWA 5FKYA 3B8UA 3RN6A 4OV4A 2NZLA 4MY1A 3S9ZA 4X63A 3CB8A 3WY1A 3N2XA 1AD1A 5I02A 4X0VA 4IIDA 4DXXA 3CPGA 1BQGA 4E38A 3STEA 1VCVA 4AAJA 4D6CA 1EP1A 1JDCA 2V3GA 1QXLA 3I10A 3SFKA 1HX0A 1ZL1A 2G96A 1WNOA 1S39A 4I9MA 3VAVA 4D2JA 4NJIA 3CC1A 2QR6A 3N04A 1PX3A 3UZWA 4QG9A 4U2YA 1RALA 3AFBA 4LC6A 5M5DA 3UWZA 1ODUA 3EDEA 4JYEA 4NZ3A 2ZUUA 3TX9A 3LOTA 3DESA 5HNRA 4HOXA 1UBPC 5T26A 5I23A 5MKGB 1WBHA 1GK8A 3H21A 1EC7A 4Q8PA 1TTJA 4LC8A 3TJ4A 3HPSA 4C6NA 4RCXA 1HL2A 3AJ7A 4CD7A 3CAKA 2PWVA 1X97A 3N15A 4OJYA 5F2IA 4UXDA 3O6YX 3TFXA 3LSBA 1B5TA 3W7MA 4LV9A 4I9AA 2QUNA 3UF9A 4B5XA 2H8XA 3M0XA 3RJYA 3NL2A 4YYFA 4PMYA 2VDHA 4FXJA 4MJMA 4EKJA 3BOLA 1BVNP 1DQWA 2I5GA 4U5KA 5KITA 5D2YA 5CZ0A 4M1RA 3EPOA 3WLNA 1ECQA 1PCWA 2W61A 5BXSA 2G5WA 1F6KA 1TV5A 1JFXA 1RCQA 3A5FA 1AA1B 1EX5A 3G0SA 4TR9A 6REQB 3LA4A 4GI9A 5G4WA 2HK1A 3S1UA 1CYGA 2XVPA 4B5VA 2D24A 3MBFA 1JZ3A 1XYLA 1X38A 2YBUA 4PYSA 3S2MA 3UYCA 1WZMA 4W5ZA 4M3PA 1E71M 2WHJA 2EPKX 2P88A 1UBSA 5DN1A 4OFCA 3WQ6A 3IAQA 3EWZA 1XWYA 2XGIA 1ISVA 1MXGA 1PZ3A 2ZKMX 7CGTA 3O15A 2OELA 2LLEA 3WMCA 1MEWA 2BGSA 1MXDA 3AMGA 4PL1A 1X6LA 4GZIA 3DFNA 3I7RA 5M2FX 1CB2A 4H8UA 3P5YA 4C6BA 3Q65A 1HF6A 3KWSA 3SN1A 4O1FA 5HQMA 4V28A 4DAIA 3I3BA 1GVEA 5T91A 5AHLA 4Q4KA 2VX7A 3SGGA 4OOZA 1F2JA 3T1GA 3VA8A 1P6BA 1IXOA 1DWIM 1GVQA 1XLDA 5A3HA 2PCEA 1UZHA 4LY4A 3VIFA 1QK2A 1KXVA 1PO9A 3BLEA 2GJPA 1SZGA 3BLFA 4FHAA 4JICA 4NU7A 1VS1A 4PB3A 1GEHA 4TQTA 3WKZA 4KWVA 1F9CA 4M1BA 1T7LA 4IG2B 2PI6A 3KZSA 4UTTC 3ZR4A 1JXJA 4JTEA 4CQAA 4DQWA 2G41A 2VI0A 5EBUA 1LUCB 2A6NA 3ABSA 3KBVA 1UH2A 1Q6DA 4JX6A 3TTYA 1NU5A 1KM1A 1YDYA 1AG1O 3A6OA 1M68A 4IP7A 1UR3M 2EGZA 1G69A 2X7VA 4XBKA 1PE1A 1IZKA 1TQJA 2C91A 5K7JA 3NVDA 3PNUA 2FQIA 3FVDA 3HOJA 1LLZA 3AMDA 2PF0A 5A8GA 2ZZ7A 4PCTA 1E40A 2EG7A 4HA4A 1H62A 3ARSA 2CLIA 4EAMA 1M1BA 4PFHA 3EB2A 3A9IA 4NG3A 3EDFA 3SURA 3AXKA 1MNZA 1Z32X 1A5CA 4DJDA 4EVZA 3MMTA 1T8XA 3TTSA 2CBJA 1ZZMA 3W25A 3GNRA 4IP4A 3VGBA 3DFSA 4ZQCA 1OM0A 3UWWA 2WYSA 2H3BA 3REQA 5CC3A 4XVEA 4XZWA 3P14A 1A5BA 3T6CA 3IGUA 2QVNA 2P3ZA 1ADOA 3GDBA 5HDRA 2PDHA 3PZ9A 2X40A 2FHBA 3KDNA 3HGJA 4GD0A 3D5HA 4S3AA 3UJ2A 1IF2A 3LX9A 3O9NA 1HVQA 1JULA 1E72M 4UZUA 4Q8NA 1OX4A 3PWAA 2PDBA 1OGSA 4JD4A 5HJXA 4ES4A 1V03A 2V5BA 3VOJA 1WAWA 3EEZA 1J18A 2ZC8A 2J7DA 3TTEA 4F8XA 4JY8A 2BDQA 1IIHA 4U10A 1HKMA 3PPGA 3GWQA 2WZTA 1LG1A 1LT7A 4L5ZA 2CXGA 2BOGX 3KP1A 3SW6A 1YEYA 3GC4A 4R7JA 1QOPA 4HTBA 3QR0A 5BU6A 3IVTA 2FTPA 3WDRA 4A05A 5JQ9A 4EWND 1AD4A 1ITUA 5CSYA 2V81A 2WMGA 3BSMA 5H91A 5TQLA 3VM7A 3KOYA 1EB3A 1GEQA 1OD0A 1QASA 1V6YA 3SIZA 3W7IA 1S2AA 4YN5A 1OABA 4O53A 2EPOA 4F0RA 3AAMA 3G1AA 4FPSA 4MJZA 5LGXA 3UZJA 1LCOA 4L9XA 3WBYA 5GJMA 3S5SA 4AC7C 5KEZA 2WQPA 2QJHA 3GQYA 1JYNA 3MP3A 4B2DA 1EX1A 3NPVA 1RCXB 1ONRA 4P7LA 4G7FA 4B3ZA 3LHTA 2OKOA 3AS1A 4IPJA 1MYRA 3TN6A 2IMRA 3U8GA 3T4CA 2Z26A 2CHOA 1W2PA 4EPDC 2PLKA 4DBUA 3LGDA 4L4MA 4P8WA 1LL6A 4YTUA 5DCDA 3CWHA 3HJZA 3IJIA 3MMDA 1UD5A 2WCGA 2X1UA 3VCNA 4JTHA 3VK5A 3W2MA 2DPEA 3CZLA 4HHHA 5TIMA 3QHMA 1JJKA 1A3XA 1UG6A 4F40A 1QI3A 4TVDA 2FZ8A 3DHFA 3AIUA 4FF7A 4MZ1A 5I3KA 3LPOA 2ZFAA 5FF3A 5FAGA 1JYVA 1K1DA 2WMJA 3FA3A 2WO5A 4O1AA 3ONCA 3WUGA 3V1HA 4MHBA 1WKEA 2C71A 4V2XA 3FNDA 3G77A 5CAHA 3TJIA 4DBSA 5FJTA 3GU9A 1KCZA 1T8QA 4UQCA 1GOKA 5EFDA 4W89A 1LJYA 5DX7A 4DRSA 3NDZA 3ITTA 4PC8A 4LPCA 1XIJA 2YDSA 4JHMA 1FCBA 3N13A 3N3MA 1G4SA 5C7VA 4JL1A 4QNWA 1S2UA 3IUHA 3SB0A 3UCQA 1R3WA 3WJXA 5E9XA 1ITCA 3P8JA 2OWWA 1A53A 1LL4A 2HDJA 2IW0A 4W93A 3QPZA 1A0DA 4GA8A 4DEFA 1E0UA 4TX8A 4P7RA 4E3VA 4Q8TA 1RD5A 1SO5A 4IX0A 1W56A 4W5UA 3VNKA 5E0CA 3N2MA 1CXHA 5C9UA 1T5AA 3M64A 4D6JA 2JEQA 1TCDA 4WDWA 4C6DA 3D47A 2HBXA 3B8WA 3WEMA 2F6KA 4QS6A 1XIGA 1FWJC 4M19A 4NZ5A 3IIOA 5C2GA 4K39A 1YXCA 3A4WA 2VFDA 3IV3A 1XI3A 4LS0A 2RKXA 3OIHA 1TVLA 1UZ1A 3AMLA 4PMUA 1C8XA 3LNPA 5A6LA 2PDJA 2C0AA 2JKEA 4ZO8A 3TOPA 1EGVA 4KMQA 4MLJA 3C0QA 4ZVJA 3KXQA 1EA9C 2XSXA 3P74A 3V18A 1QHPA 3CS2A 3H53A 5KZDA 2FGZA 3FLUA 1JPDX 1R3RA 1JNDA 1DXEA 3CUGA 1POJA 2BOEX 3L66A 1R38A 5TD4A 3A4JA 2XIBA 3N17A 5EA9A 4I90A 3WNKA 1W9DM 2TSYA 4W4QA 3CUIA 4HU4A 4J3VA 5D30A 3WDPP 1OFDA 3RMJA 2TPSA 3FK4A 5K9CA 3HFYA 2NSXA 4XZHA 4KWSA 3R6IA 4PCSA 4OBRA 1LM1A 2P76A 4OE7A 3SI9A 1FWHC 1E6XM 3WLJA 2V82A 3VIHA 1EP3A 1XYFA 3JVAA 3EWBX 2KX9A 3WELA 2EXOA 4H4IA 3PM6A 3EMQA 3WQPA 3B8SA 3CMJA 1Z9AA 1SYTA 4A2RA 3V4BA 1Q8JA 1QNOA 1FH8A 3CZKA 4RE2A 1XIMA 1RA5A 3WQCA 4HYWA 4CGTA 4TO8A 1GYNA 1DWHM 1JEZA 4JHOA 4B5NA 5FACA 3HPAA 3VOFA 4AIOA 4LT9A 5IBXC 1XR2A 3U5YA 4NL1A 3ANYA 1TELA 2Z4GA 5EMYA 4LQ1A 4IFKB 1AH4A 4AXNA 3BGAA 4AEOA 3CYVA 4C65A 1P7TB 1K9DA 2ABBA 2PLCA 5HUPA 1H63A 1XCXA 5I3IA 2NVCA 4HMEA 4CQCA 2GPTA 4NZCA 4DJED 1U1HA 1A5MC 3DAQA 4AZBA 3S6TA 1E1CB 2Z1XA 1WO2A 2POZA 2NV2A 3DFOA 3INPA 4S2BA 1P1XA 2BVWA 2G97A 4O17A 3DG3A 3GW3A 1FRBA 2FLIA 2ZUWA 1SZNA 2XIIA 3M1ZA 3WLLA 2XM1A 3B05A 1T0OA 3USBA 3FYOA 5AYBA 1A50A 1MZRA 2BNJA 4NUWA 5CH9A 4MUPA 3QR1A 2A85A 1K3UA 1MRAA 2E40A 2VQTA 5D37A 1GTEA 4EAYA 3GZ3A 4NI3A 2A5HA 4UQDA 3S2LA 3PFMA 2HVNA 3ZO9A 4JIIX 4WQ6A 1PL9A 3VOGA 4I6VA 3C6CA 3WD3A 3GG0A 3OBKA 1KLZA 3H70A 1F3XA 3T8QA 4O16A 3NQEA 1JQXA 2NQ5A 3L2MA 5XINA 4FXRA 1HP4A 1ADDA 3DYMA 1W3TA 1R0MA 3N9SA 3I6TA 2A21A 1LT8A 4WY0B 4IMGA 4JQ1A 3ITVA 3RLHA 1J0YA 4PBFA 4AISA 4A3HA 4C5ZA 3RILA 3H4GA 2IKHA 1HKJA 5JVLA 2QMKA 3GM8A 2W62A 2VP8A 4EACA 4BZYA 3WQFA 4AEEA 3ISIX 1V0LA 2OR2A 2INEA 4ZODA 2BB0A 1UQZA 3GH5A 3WD4A 1A5LC 1NM9A 1Z7AA 5CPLA 2DJLA 4UTTA 4B15A 4KF1A 3UG5A 4A21A 4UR7A 1ZUAX 3TC3A 1SW7A 1EO5A 1VFFA 4JIEA 3MUY1 3NXLA 2BOFX 3V35A 4B92A 3P62A 3QF0A 1VIWA 1JCTA 2PSNA 3LRMA 4Y90A 2ISWA 1UR2A 1WXJA 4B4FA 1LWIA 3UWVA 2FDMA 2NV1A 1SM9A 3GTHA 1R9ZA 1T41A 3VNYA 3H2CA 5FF4A 4XTIA 4CD6A 1I1XA 3F4CA 2DH2A 3QVQA 5HR7A 3TSMA 2YXXA 1Z89A 1CGXA 4UOZA 3W2LA 2J78A 2PTDA 3W81A 3CMFA 1W3KA 5RUBA 5FF7A 4LS2A 3GY1A 2XVGA 4PEKA 3GG7A 3F5KA 3KOXA 4XVDA 3AYRA 2QDEA 2C8NA 3R8HA 4Z08A 2V3FA 3PG9A 1E9YB 4EWJA 1P6CA 1C9DA 4PMRA 2HXTA 4IUOA 2RAGA 3W70A 2J75A 2WZMA 4LAMA 4E5TA 4G1KA 2V5KA 3TQVA 2VHLA 3SCSA 3BJSA 3G5EA 1XLIA 3H2NA 5CPQA 3W29A 1OK4A 3D3AA 4XD6A 2GVYA 1SSGA 5IXEA 3LRKA 3IVSA 3UD6A 2OSXA 1C90A 1RP9A 4MDPA 3WQOA 1FTXA 2Z1VA 4CN6A 1X8CA 2WMKA 3NZPA 1VENA 2TAAA 3TJLA 1IWAA 3TNBA 1WCGA 2E28A 2CKRA 2OZ0A 3TYDA 1XH0A 3ITGA 4GQBA 1EGMA 1QO5A 4XZIA 4XQ6A 3DKJA 3LI0A 1SFJA 3DEQA 4O12A 3Q37A 3O6DA 4OVXA 4BFAA 1E4MM 4S3JA 3LRLA 3NQBA 3TQKA 1KFKA 4JNYA 4LUTB 5JBEA 3BMVA 3WJSA 1RQEA 4Q8VA 1EKOA 4TMCA 4QE5A 4HPXA 1K70A 3NOEA 1YBQA 3UYIA 1KCXA 2ZX5A 1RR2A 3E3HA 2CHRA 1AQFA 4KEVA 4Q4MA 2CLLA 4HCDA 3URNA 4JXCA 4GUHA 3ALGA 2RHGA 5FAJA 5AOUA 3M43A 4ZOBA 3EXRA 1IR1A 4X3ZA 1Y0EA 1N8IA 4H6RA 5LXEA 4IMCA 4TV5A 1HKVA 3ZT6A 2ZVRA 1Q3NA 1DTUA 1HL9A 3UJRA 1DOSA 3VZXA 3DFTA 1AJ2A 1CENA 4UTLA 3GB6A 1JF6A 1R47A 1J6OA 1V0MA 3W7PA 4O13A 3UETA 3ATZA 1AZ2A 2V5JA 3NWRA 3FHAA 3V0SA 1I1WA 4KESA 4LAUA 5TF0A 2OGYA 3EEGA 1KBBA 2F84A 4MJ4A 1BPLB 5BYWA 4HNLA 1RD6A 2OMAA 4Q22A 4B16A 4C1KA 1YKWA 1NELA 2B7PA 4DIAA 3CWOX 2WHLA 4AF0A 4C6QA 4O57A 4WLCA 2DZBA 4WSJA 1E15A 2HS8A 2J24A 2J8TA 2WOQA 2V5DA 2A7PA 2NUWA 4HNCA 2DT1A 2VFHA 4HQVA 4HCLA 5D2VA 4AWSA 2ABAA 1UP0A 3HPXA 4R53A 4GQQA 2GDUA 5D32A 4W84A 3JZUA 3ES7A 2ZRXA 1KM0A 1RA0A 1BLIA 4YWIA 1W8GA 5HXMA 3OIXA 4HZMA 2CWNA 3VIMA 3R79A 3TE9A 1H1ZA 1LL7A 4AHQA 1UIPA 1HO4A 4PN2A 2V9DA 5C8BB 3BPWA 4NIRA 4D6IA 5BNKA 3N9KA 4MWAD 2QCEA 4LJ3A 4CNNA 5I3JA 1HG3A 3L21A 1ZTVA 3B4YA 3DFQA 1XIIA 3P8IA 3JW7A 3OVGA 2PBOA 1KRCC 5DCBA 4GK8A 5E93A 3S8HA 4S3FA 3L4ZA 1VBJA 2XGZA 4GKLA 3N6QA 1QHOA 3OBEA 1KRMA 2RDWA 5F2LA 3CH0A 2FGLA 4ZZ9A 1YPXA 1PYMA 3T44A 3MWAA 5CGTA 4GZ7A 3F2BA 3CQIA 4LRTA 1W1VA 5A2CA 1D8CA 1TPUA 4WX2A 4JTQA 3CLWA 4LSBA 1YIXA 3KUMA 3UWQA 1Q7MA 2I57A 2OTDA 1QOQA 1RK6A 1CXLA 2HTMA 2QAPA 2VUNA 1HN1A 1FHLA 4DZIA 3MSRA 1ZU8A 2XFYA 4AD5A 5HMDA 1YDNA 3WNMA 2XZ7A 4FMVA 2PZNA 5FJOA 2DDXA 3W84A 3C0LA 1TZ7A 2QIIA 1XV8A 2YBVA 3L2LA 4GWEA 4V1YA 3SGZA 4AEFA 4HU8A 3TR2A 3M7SA 3MYOA 4RK8A 3T7VA 1XSKA 1JZ7A 2X30A 4S3KA 1D9EA 4IGMA 4HA0A 3TH6A 3DCPA 3E5PA 1GONA 3E0IA 4KRZA 1O1HA 3A3HA 9RUBA 4ACZA 1ONXA 3H12A 4HZ7A 4AZCA 3GRIA 2DV0A 1FDZA 4IM4A 4S23A 3W01A 3GDKA 1NJJA 2VD8A 4ADSA 2YL5A 3LEPA 1CGUA 1HUVA 2BX7A 3LCLA 2ZDRA 3R0KA 2WMIA 3PBWA 3N6HA 3W74A 4KFNA 5IBXA 2FPYA 1TWWA 3R2GA 3W2KA 3BMWA 1CCWB 3HG3A 3KFTA 5BMWA 3R5EA 4AC1X 1E70M 1Z69A 2XH4A 3G1VA 1NF7A 4NY2A 4GVIA 3THCA 2DIKA 4CU6A 5ENLA 4PCNA 2CLMA 1PIIA 3MB9A 8CGTA 3UNTA 4R33A 3N34A 3L65A 1KQZA 1N2VA 2ZZ2A 4Q4PA 3P84A 4KW2A 3GH4A 1R5YA 1V08A 1H7RA 2GVEA 5ABHA 3W7QA 1FWCC 3RFAA 2P53A 2OVLA 2WHKA 4PFMA 3NQGA 3VIGA 3W87A 3AMCA 1KXHA 2WSQA 1V3JA 4PL2A 1REQA 3GO2A 3BG5A 3VKKA 3G1SA 2GQ3A 4Z1YA 3KL5A 4JKLA 4I6KA 3KS6A 1PKYA 2XPKA 4MFEA 2CZFA 2HWGA 7ODCA 5FJRA 3NZGA 4O1BA 1YBQB 3MUAA 4GNJA 2R82A 4JFTA 4B3KA 2ZOXA 4RE3A 4B5WA 3BV4A 1MZHA 4UFJA 3QMTA 1XBYA 2VXNA 2DSWA 1VEPA 2H9AB 5DMMA 3BCJA 4MYAA 3VKDA 1F61A 1F5ZA 1OD8A 2UY5A 4YHGA 3U4AA 4HPGA 4M7TA 1GQKA 3DZ1A 1GZJA 2AAAA 1DP0A 1R3TA 3PUEA 3QC0A 3D0CA 2AGKA 3NCOA 3AWOA 5AKQA 3NQ2A 3QKEA 3ZJKA 1G4EA 3P67A 3ARTA 3B8IA 2RFGA 1C9WA 2GUYA 3F7JA 2CLPA 3NQAA 2BY3A 2FZMA 2A3AA 6CGTA 2HXUA 3OOQA 1OADA 3WX7A 4M8UA 1OJXA 1CPUA 2PWUA 2CYGA 3BICA 1DJNA 3UPWA 3ARUA 3W71A 4QTGA 3SR7A 2Y7GA 1GNXA 3G0XA 4GUIA 1PJ9A 3PF3A 1MDRA 4RE0A 5REQB 2VFEA 4QBXA 5GNYA 1GVYA 4Y8FA 3LZ5A 1J6PA 3CUXA 3LXCA 2YB4A 5LA0A 4AX6A 3L4TA 4YJ5A 2BBFA 4ZQPA 4GQ0A 1J10A 3CPUA 2X05A 1W5MA 2AL2A 1EH9A 1DXFA 1L2QA 4S38A 3RDKA 3UA4A 2P10A 2FKPA 3PB0A 1VPXA 3AWNA 5BW6A 1JUKA 4G2DA 5E1QA 4D6FA 3NJ3A 2BTMA 4J28A 5DMNA 2OQLA 3G8EA 1ODZA 4O1CA 4JL2A 5C9WA 3FEMA 4L9YA 3ABZA 3N4FA 4JN6A 2XFRA 1V8EA 3ARWA 1JUEA 5CZTA 3U0HA 1DTNA 1R9YA 1CGVA 1ZHAA 3I68A 4ZEPA 1FWBC 1US0A 4ERGA 1WOBA 3P0WA 1XC6A 1A5SA 2VUYA 3QOMA 4Z1BA 4AXKA 5FESA 4C1NB 1MW0A 4KEZA 2CLEA 5F2GA 4RR4A 1H50A 4NQ1A 4Q6JA 2CLOA 5GJNA 3MV11 1TWIA 3W28A 3LLDA 1EUAA 4A29A 5FF2A 3VO0A 1JZ8A 1W9VA 1G9HA 3K5XA 1OFPA 4ZFCA 4UTJA 3HV9A 1TR9A 1M65A 3T0TA 1A49A 2IQDA 3KHJA 4AX7A 4Z1DA 4J3WA 1SU5A 2OWCA 4JBRA 1K9TA 2AQOA 3KAOA 2ZCGA 1H5YA 3QN3A 2QF8A 3WQ5A 3L23A 2GSHA 3UG8A 1UD2A 1NWTA 3G2GA 3PZVA 3VD4A 3NYDA 3VE7A 1Z3NA 2VD9A 3TA6A 3AHTA 3W22A 5BXPA 3VYLA 5MF5A 1KBIA 3WMBA 1VYRA 1V4YA 2BVDA 3BZJA 4QP0A 1HXJA 1B4KA 1OG0A 1Q2RA 3GK0A 5BCAA 1EJ7L 1XJBA 4BF5A 1K77A 3LCGA 1MI3A 1MO0A 3CLMA 3PZOA 1DJWA 1GOQA 1OVDA 4YTQA 1QCWA 2Y7DA 3WCZA 1J96A 2ZUNA 4ROPA 4DUVA 1V6TA 3MTWA 3CUFA 5I03A 4B91A 3AUJA 3WQEA 2D3NA 3ZLFA 3EDKA 3HGRA 4PGLA 2X42A 3M0VA 4QITA 3GG1A 2DT2A 2W79A 4FR1A 4O28A 4RV8A 1RZMA 1TMHA 2W92A 2XIMA 2XGBA 4GJ1A 1PSCA 3R8RA 3WL1A 3B9OA 3CT7A 4HZ8A 4MB5A 1K8CA 2FDSA 3QY7A 3AHVA 1LF1A 3HTWA 1PUDA 3KLLA 5FA5A 1W9XA 2OYMA 1Q7QA 4EF8A 5E70A 4GJJA 2PB1A 3NGFA 5KETA 1ISXA 4DHGA 4D9PA 4X2PA 5GNXA 4NAFB 5LIUX 4M56A 4AYGA 2ZE0A 4GCXA 5KZMA 4NZ4A 3T78A 1RY0A 3FSTA 2OB3A 3AS3A 3UXAA 2E6FA 1S46A 3WLKX 5I77A 1ISZA 3W26A 3ERPA 4GNKB 3B3DA 4NP7A 1GWJA 3VM5A 3QXBA 1JZ2A 3DG7A 1KW1A 1XQKA 4FIRA 1R9XA 2VR2A 4ZE4A 3S1XA 2HE8A 2BY1A 3W2UA 1E73M 3CTTA 3BLOA 3V5CA 4AD2A 5C54A 5I09A 3QQ1A 4JQ3A 2GOUA 1QNQA 2PUZA 3GR4A 4M6PA 4LVDA 3UJFA 3W7LA 1SJCA 2QULA 1SW0A 4XAPA 2VEMA 2VR5A 5D2XA 2DUXA 3TYUA 1HJVA 4BK9A 3KTSA 2UY3A 4Z42C 1REQB 3CAWA 2CU0A 2NQLA 4PZVA 4QRNA 5A6JA 1AMKA 3IANA 4E8CA 3ZYZA 3MT1A 5AC5A 1WP6A 4Q8WA 1O1ZA 3UPBA 1TPC1 3W7DA 4CNSA 4K36A 3HN3A 2JF6A 4QDWA 4P61A 4INFA 3AHZA 3R94A 4IWWA 3GXPA 2ALDA 2BXVA 1W9UA 1NDWA 4HHPA 5JH1A 1X96A 2E1WA 3KLKA 2G37A 2ANUA 1E51A 3LTPA 3NL3A 5HUOA 4J7RA 3AMKA 4XIAA 4IPNB 3M4HA 4LX4A 5HBFA 3KWXA 5I3FA 5A95A 1BXBA 4HNOA 4GIAA 4OU1A 5D9NA 3E1F1 3EXTA 3WJYA 1MUWA 4YIWA 2XJ7A 3GUWA 2FZBA 3UG4A 4LB3A 3T0BA 3VI2A 1PDZA 2NX9A 5I2UA 1P1MA 3QC3A 3C0JA 3NURA 3GDRA 1TQXA 2ISDA 1Q6CA 5D2TA 2J25A 1NEYA 4FP1A 3CEPA 1XX1A 2OGJA 2ZXAA 3Q67A 3FAXA 3V7PA 2Y70A 4PTNA 3MHFA 3K4DA 4H2HA 5DCEA 1O5QA 3WQGA 2ODOA 1GYMA 2PDWA 2PE4A 4MKSA 3FW6A 2VJXA 1AJZA 4HU0A 4HMDA 3SY8A 2C1HA 5DRCA 5CZSA 5SWUA 4GBUA 4TX6A 4BS0A 3BK0A 3PZUA 3NNTA 4EE9A 1QOXA 4ECLA 3QLLA 5KZ6A 3BLLA 5FOOA 3GYCA 3ZFHA 2VZOA 2PS2A 4F2BA 2JKPA 5E6ZA 4LNCA 4MADA 3AZTA 2BGNE 1SVDA 4J4KA 5L9FA 3H4WA 5EBAA 5GNZA 2ESCA 3QEZA 3A64A 3EX4A 2PLJA 1UR0A 3MP4A 4WIWA 2B81A 3DC0A 4RLIA 3TTQA 2O4MA 3DGRA 3EMCA 2QDHA 3ZM8A 4LFYA 3CM4A 1BYBA 4AZGA 3W9ZA 4D8ZA 3RM4A 4E4UA 4GI6A 1JPHA 4PRRA 3NZRA 2OEKA 3PBYA 3B04A 3VNZA 3OGSA 3VD7A 1S5TA 5G1YA 4FSAA 3MCMA 4DBEA 3VIPA 3E0VA 4A3YA 3LS9A 4GACA 4MMWA 3VXGA 2QJNA 3T81A 2YYTA 4D6GA 1UOZA 1KKOA 4W7WA 2ZXBA 1TUXA 1IT0A 2HNEA 3DGBA 1OZMA 4WRHA 1TO3A 2E77A 1QK0A 1PTDA 5DT7A 3EB4A 1JVNA 1B4EA 3R25A 4MNLA 1KNWA 3BLIA 3MU7A 2CBUA 3Q2DA 3WH8A 2WKJA 4PMVA 1GVOA 1KWKA 4W8AA 3MHUA 3RO6A 3PK7A 1LQ0A 4I5UA 1IZJA 2FFCA 1EZWA 4PH6A 1ZBKA 3WLIA 3QYQA 5D8ZA 5M1TA 1KTBA 4YYCA 1X1ZA 3SJNA 2WCSA 3R0DA 3ZJ6A 1LWJA 4M29A 4Y9OA 1WUFA 4QJ4B 1BVWA 3NQ8A 4XSLA 4O4VA 2EG8A 2QV5A 4Q7NA 3UA3A 1P43A 3SY1A 2QAFA 2PWGA 3K8MA 3W1RA 5BU9A 3O0KA 2DSZA 1S3HA 2Y5JA 1S1RA 4NHVA 1HW6A 3PUOA 4G8TA 5LIWX 2BHUA 3R13A 4URIA 3POHA 4HVXA 1K9EA 2Y88A 1IV8A 2FPVA 4NZFA 1KGWA 3KVKA 3WLTA 2FZDA 4GKTA 3NIYA 3SSJA 2E5CA 4X9SA 1BXNA 3NEVA 3C52A 4F0HA 3BDKA 1V02A 3VOHA 3AU2A 1H1NA 1HNYA 1C93A 4GQRA 3OYZA 2OO0A 3TCSA 4H1ZA 4QGCA 3FVMA 4NZ1A 1VFTA 3WUBA 5CAKA 2OX4A 4IJCA 4QQUA 2FVLA 4JIRA 2Y85A 4WJ8A 3HQNA 5LKYA 2L5HA 3R7MA 7TIMA 4A8LA 1TRDA 3NO1A 3WQ8A 4Q32A 4QSFA 2G3IA 4U33A 1TA3A 3BE7A 2XUCA 3C2EA 3CK5A 4KCWA 4FO4A 3AYTA 5F4SA 2WJEA 3CXOA 4DO5A 3KX6A 1FWGC 3RO8A 1T6MA 3IUIA 3GTFA 1VGAA 5E09A 1Y7VA 2ZRVA 4HSNA 4G1NA 1UWTA 1GQJA 1ZPTA 2QGYA 3W82A 3BARA 3WUFA 1CECA 2O55A 3TC7A 1KQYA 3GKFA 1KM4A 1BRLA 4CCZA 1JCYA 3KBNA 1PWLA 3FGCA 1F4HA 1W1TA 3MCNA 1F74A 1TWDA 1UZDA 5D38A 1CXIA 3KRUA 2FB3A 3WF4A 3NQFA 4OWGA 3HO8A 2OZ8A 1NF0A 4ASTA 1JPMA 3UGVA 3MP5A 4A3QA 3VKAA 2DVTA 2PDPA 5C0QA 1AMYA 4IXXA 2PMQA 3N14A 1NQKA 1SJAA 4IJRA 4C6EA 2VVNA 3TJXA 4NX0A 4LYQA 2G8ZA 1XXXA 1UPMB 3RR1A 1S5NA 3ZR5A 1U30A 1IT7A 2ZUMA 1B3YA 1BGAA 3T8LA 3EWUA 3M07A 2EJ1A 4GY7A 3CAQA 3I3DA 4P8VA 2J74A 1V7YA 2WVVB 4F3HA 2D22A 2OG9A 1JZ6A 3W38A 1J0KA 1MUCA 4LU0A 2PWFA 3B0XA 5KSWA 3MHGA 3MA8A 4JTRA 3L5MA 4YCPA 2ONEA 5A8OA 1UD4A 1LTDA 5AYYA 4YCOA 1KRBC 3VDGA 4DJFD 3GKAA 3O05A 1J2WA 2G50A 4YHEA 3RMEA 1JGMA 4MKVA 3WF3A 1D2KA 1XBXA 3WFZA 5BOFA 8A3HA 2CERA 4V27A 4XZMX 4CCDA 1D7FA 3W7CA 3O16A 1IXQA 2Q71A 3EXSA 1UMYA 1N55A 1YYAA 3TV8A 4I5XA 4YPJA 2R94A 1JCXA 3IJ9A 4F0LA 4ACYA 1K7EA 1FCQA 1IWBA 3N4EA 2AAMA 1TJRA 4HU3A 4Y9AA 3TWAA 4GPNA 4MZYA 2QEZA 2XN2A 1GKQA 4LY8A 4PMOA 1GJUA 1BKHA 1DJHA 3U4FA 3EA1A 1D7KA 1LDCA 3FEQA 2F38A 3WMSA 2ZTKA 1VFLA 2A79A 5A69A 2JEPA 4EX4A 1UYQA 3F5JA 3P5ZA 3BV7A 2CLKA 1XLAA 4WKAA 3E02A 3DBPA 4XD5A 5LNRA 4X2RA 2OOGA 2VDIA 1UD6A 5LIYX 3IGXA 2W66A 3PTDA 3T08A 2C18A 1NQ6A 2V0TA 3NQDA 1H51A 2GWNA 3GW0A 2PDGA 3VOIA 2DZAA 2J8FA 1VZWA 2XN0A 3UWUA 2DIJA 4HJWA 1XBZA 1H2JA 3FIGA 4XTDA 4N9CA 3OA3A 2DSVA 4IPPA 5GJPA 1MW1A 2PWDA 3XINA 3L4YA 1UIOA 5A94A 1LQ2A 1GVFA 1XCFA 3OGRA 1VBRA 2YA2A 1EJTC 4C7DA 1E4LA 2XN1A 2ISVA 4HNVA 3NQVA 1U83A 4ZSTA 1FDYA 4GMEA 4JTGA 3BCFA 2WVSA 1IHIA 1OCJA 3QY8A 1M03A 4IXHA 5HINA 5BRBA 2D2OA 2Q8ZA 3VC5A 4GXWA 1MW2A 3DYPA 4KCUA 4FLSA 1ISWA 1VD6A 3MPGA 1F7BA 1LQAA 5F1UA 1RAKA 4JEJA 5FF0A 3TEVA 1S2VA 2Z28A 4RDVA 3MY9A 1KR0A 2QPSA 3B8DA 4HTYA 3DFPA 1XIDA 1XRTA 3ZMRA 4AU0A 2V69A 3FFSA 4US5D 3E49A 3SCPA 1UB3A 1G5AA 4GRSA 1KLYA 3SY5A 5LZLA 5BXTA 1GYLA 2ZZ4A 2QKFA 1VP5A 1J0HA 3ELFA 2A3LA 3VUSA 3FS2A 1ZBWA 4JN7A 2BHZA 1JFHA 1QPKA 1FHDA 4ZQOA 4D6HA 3PB2A 3ARVA 5K4XA 3THUA 1XINA 3D3FA 1W1PA 3GHUA 2IPJA 4K2SA 4WY0F 2X2GA 3NZQA 3VTRA 3GFYA 3MANA 1A5KC 3TDFA 1QNSA 1L0PA 2WM0A 4N42A 3TFCA 3AIVA 4ILSA 3UWYA 1Z42A 3TW6A 3E74A 4MTVA 4PEEA 2YLAA 1C8YA 4PTXA 3MV01 1O5XA 1VRXA 2P8BA 2Z2BA 2ZICA 4QJ3B 3OLIA 1QWGA 3NL6A 1TWZA 4KGJA 2IPFA 2DT3A 4J5NA 3CUZA 1K8ZA 1EPXA 1XS2A 4IPLA 2GFTA 3VDHA 1E43A 3QY6A 4HN8A 2OLAA 4UNKA 3WLRA 4RDYA 4GOAA 1FOBA 1XRSA 5H1WA 1ME9A 3ZLGA 2A4AA 4WXYA 4REQB 1FBAA 1TIWA 4YTRA 3UXLA 1FA2A 1XKYA 3GDTA 2C16A 3VOCA 1EOKA 3MI2A 2VCCA 3CB3A 3OYXA 4I9TA 3WIJA 4H8HA 4UBPC 4L1XA 1EIXA 5G2HA 4OUEA 5CPSA 1AVAA 4J3XA 5D04C 3EDDA 3IJQA 4HYVA 4JYFA 3S9YA 2AQWA 3EOOA 1UR9A 5J5DA 5MKGA 1B9BA 3QV7A 1C92A 1LG2A 3UY7A 4MB1A 1EJVC 4MM1A 4MWAB 4ZSUA 3KRSA 3LHVA 3GXTA 1YE4A 1TPFA 3T0DA 5HULA 5EPDA 1R85A 4DJFC 5EYWA 3OQEA 3AALA 2INZA 3QM3A 3SN0A 3SAZA 5HNUA 2PA6A 1B3OA 5HNTA 3MUCA 3DHPA 2ZIDA 3KS5A 4LAKA 1XFCA 3C5QA 5LSMA 1OINA 3L5LA 3E2SA 4A6GA 1XLMA 3LG3A 4V1XA 3IK4A 1QPRA 3W1PA 3GTIA 1EXPA 2ZX7A 3R58A 3UNDA 5F4WA 5A8QA 4A3RA 3UXKA 5B80A 4ZQRA 1QI4A 5A6BD 4FK9A 6REQA 2YSWA 3DXIA 3GZAA 2BXZA 1KFWA 1R46A 1GHSA 4C6PA 1XLHA 4DI8A 2QCGA 3MSYA 2PD9A 4YVPA 5K4ZA 4ZTXA 4Y8EA 2GJXB 3F03K 1R2SA 3AZRA 5CSRA 4L6HA 4LBRA 4QE1A 4C91A 4N0RA 2KZHA 1LBFA 1ML1A 3ITCA 1CLKA 3KRBA 4PUNA 2UV8G 1RXOB 3GC2A 3H2EA 2QXWA 3NDYA 1OG6A 4W9TA 4LB4A 3R12A 1ECEA 3CHFA 2QCDB 4ADTA 3HF3A 1KXQA 1JCMP 1WX0A 1J2BA 2VC7A 1H7NA 1XGEA 4I7VA 4MSSA 4NXKA 2JK2A 5DO8A 1XUZA 4UFIA 4QS5A 2XSBA 4GGHA 4QISA 2YL8A 4H19A 3H7RA 3KE0A 1Y5WA 3LM3A 3ZIZA 5FL1A 3DDMA 1OQFA 2VR4A 4KERA 1XQLA 1GQNA 2DZUA 1AFSA 3VGGA 5HJLA 4K8GA 4MFDA 3RITA 1E6QM 3U2EA 1PBGA 1W3HA 2HBVA 1R7OA 4JTTA 4U28A 3J7HA 3S2NA 3PVFA 3VDBA 3TNOA 4H6KA 5FL0A 4CQ9A 4QROA 3BJTA 3MZNA 5JIPA 1XLFA 5AHEA 4IG2A 1FXQA 1DPMA 4C6KA 5HJYA 3FDGA 3W7RA 4WSHA 1NFGA 4U3AA 2NXGA 1CGTA 1ZNNA 3TN5A 1FH7A 3MI6A 3MUIA 2R91A 5I07A 5EL1A 3AS0A 1LUCA 4W86A 5M3WA 1LRNA 3PZQA 1Z41A 3E2RA 2Z25A 5CC5A 2FMOA 1I60A 5HPOA 4FNUA 4DZ5A 4U31A 1E1FA 1A0CA 5I5RA