5LCJA

In-gel activity-based protein profiling of a clickable covalent erk 1/2 inhibitor
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
347
structure length
345
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDELDDLPKEKLKELIFEETARFQPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In-gel activity-based protein profiling of a clickable covalent ERK1/2 inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 1
total genus 112
structure length 345
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2016-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5lcjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5lcjA01
2A4LA 2YZLA 4NH1A 4CT1A 3DDPA 5FEDA 4CV9A 3UMXA 2BIKB 3ZUUA 5HE1A 4G6LA 5HVKA 1NT2A 4AZFA 3MIYA 3KXGA 4J97A 4FKLA 3LMHA 1DAWA 2XB7A 4C37A 2VTIA 3O71A 5HBHA 5IA4A 4DF3A 3R6XA 5C01A 4JG6A 3P78A 4AG8A 2OIQA 2XUUA 3DS6A 2YIRA 5FEEA 4QMOA 5E1SA 3PWYA 2R3NA 3QLFA 4TPTA 3E3PA 3R0TA 2BFXA 3SOAA 4AZEA 4D1XA 4CLJA 3OD6X 3VUDA 3DBFA 2WQOA 3VJNA 4AN9A 2GNFA 3PA3A 2CLQA 4ACDA 4PDYA 1H1PA 2C0IA 2UV2A 4DGLC 5JFXA 4ANNA 1WVWA 4LUEA 4ZTQA 4JJRA 3ROCA 1X8BA 2W06A 4AFEA 5AUVA 4EH9A 2OZOA 4C61A 3KVXA 5JN2A 2IN6A 4FL2A 2R3QA 1Q99A 4BIBA 5IKWA 2WTCA 4O7LA 2WNTA 3LKMA 3ACJA 4FSTA 4PTEA 4HJOA 4IB0A 3GCPA 3L8VA 3QUEA 3UOJA 3AGMA 3VHKA 3D2IA 3RCJA 1LR4A 2YA9A 1OL2A 4NCTC 3TG1A 4ZLZA 4L45A 2JKOA 4KD1A 3QTXA 3QTWA 3D7TA 3OF0A 4KA3A 4TYGA 4BCOA 3QCSA 1OPJA 4I94A 3ZZEA 3PYYA 5M07A 2PWLA 2ACXA 5KE0A 4OTQA 2E9NA 4JR7A 1WBTA 3PLSA 5HU9A 3ZM9A 2QOKA 2YACA 2RIOA 3BKBA 3B8RA 3QX2A 3ACKA 4X6QC 5ICPA 1PRYA 2BR1A 1DI9A 2WFYA 3QRJA 4R7HA 4EHEA 3B8QA 4RC4A 4Q5EA 1OUYA 3OTVA 4C2VA 2BZHB 3I0QA 3MH1A 4EK6A 2H96A 2UVZA 4PMPA 4W4VA 3DBCA 2JIVA 3I6WA 4HCUA 3U9CA 4N4SA 3FXZA 4DH5A 1J7UA 2X6EA 2X0GA 4PV0A 2BRMA 4FTJA 4EK5A 4O38A 5GJGA 4EC9A 4II5A 1PXMA 5J7BA 3EN4A 1YW2A 2YIQA 3IQ7A 2P33A 3O51A 3HZTA 2VWXA 5AUZA 3R7EA 5LARA 3QUPA 4UV0A 4DTKA 3MVHA 3OBJA 3MH0A 4GL9A 3IGGA 4YC6A 2XM8A 1GJOA 3RBWA 4ZTRA 4IZAA 3R7UA 5CLPA 3ORKA 3FLNC 5FP6A 1UV5A 4M67A 5CSHA 3BGQA 4FSZA 2XK8A 5LWMA 4UBAA 5IQCA 4IC8A 2ETMA 3FYJX 4ANLA 2OIDA 1WBPA 2AYPA 5H8BA 4EWHA 2VU3A 3UBDA 1VYWA 4IAIA 5EOLA 2UZWE 2B55A 2PZPA 4WSYA 3R83A 3OCTA 3GXLA 4FKGA 5AUWA 3PG1A 4GT5A 4PPCA 3C4EA 4C2WA 3LFCA 4RX7A 4USFA 3R01A 3QKMA 5FQDC 3QGWA 4KNBA 4AS0A 3R7YA 2RFEA 1QPJA 4FOCA 4XP2A 4FZAB 1PKGA 4FV5A 4BRXA 4Y5HA 5H9BA 1RDQE 3TUBA 4ITIA 4DG3E 4H1MA 4EOJA 1ZWSA 3UVPA 4RT7A 4LFIA 2C68A 5HI2A 4J53A 5AJQA 3ODZX 2RFNA 3CTHA 4GMYA 1UNGA 4O0XA 4IWDA 3E8CA 4KIKB 4QD6A 3Q5IA 2G2HA 3LFEA 4U42A 4G6OA 4JG8A 3QRKA 3P1AA 4FNYA 5HE3A 4GFMA 5KX8A 4I6BA 1W84A 1XQZA 2JDOA 2CPKE 3OCBA 2FGIA 4L8MA 4YPDA 3ZLXA 4DE4A 3WBLA 3QCYA 4FTOA 5EH0A 1ZY5A 1Y8GA 2X2KA 2HAKA 3NSZA 5DYJA 1Z5MA 1OZ1A 5DEYA 2YISA 3DAKA 3MA6A 4XP0A 1VZOA 5AP0A 5IQFA 2PE0A 4C3FA 4X3FA 3CE3A 4CLIA 3KC3A 5D7VA 3GB2A 3ZRLA 2BZKB 3D5XA 2CGVA 4RWLA 4GT3A 2OFUA 4L53A 4V05A 2WELA 4MWHA 3TEIA 2XMYA 5DA3A 3QD3A 3SDJA 5FEQA 2Z7RA 5GNKA 1OUKA 3O8UA 3LCTA 3VF8A 4CFNA 3LXPA 4EQUA 2R3RA 3UIMA 4CGAA 3SAYA 5IDPA 3EQPA 4CSVA 2X4ZA 1H1WA 1NXKA 2WTVA 2YDKA 4MD9E 4QO9A 3W32A 3QZFA 3KF7A 3R8PA 2GFCA 3NPCA 1AGWA 4WIHA 1JKLA 2OBJA 4XV3A 3FLWA 1QPEA 3TNQB 3DK7A 3EZRA 5HBJA 4BDKA 3R71A 1JAMA 3V51A 3UVRA 4RFMA 2WXVA 3DAJA 4JL9A 4HGLA 4NM7A 2QG5A 4OR5A 3IPHA 3A62A 4C33A 4RFYA 2PMOX 4EZ5A 3KRWA 3R00A 5CZIA 2VWZA 3TV4A 4ARKA 1F5QA 4O0SA 4FTMA 4HGSA 5CF4A 4CG9A 4L3LA 3RJCA 4GRBA 5AA9A 3S1HA 3BRBA 3KULA 3BU3A 2VWIA 3QD2B 1MRYA 3H30A 4U79A 5EDQA 4FTQA 4YUQA 2GQSA 4QT1A 5GINE 4DG0E 2XKDA 3R8MA 3U6IA 1LEZA 3PWDA 4XG4A 5CAUA 4YTHA 4AT4A 3TKIA 2YM8A 5HKMA 2RL5A 5EM6A 1Q3WA 2WMTA 5BUJA 4G6NA 3Q52A 3HV7A 4HGEA 3V6RA 4L42A 2ZB1A 3HMMA 4E5WA 4EI4A 3WIKA 4FSMA 5E91A 4EZ3A 3EYHA 3N51A 3SRVA 4X6RA 5A6OA 2IZTA 4WG4A 3F3WA 4K33A 3WI6A 3CR0A 4IIRA 4YJUA 4ZLYA 2ZM4A 4QPMA 3PIZA 3FXXA 5CSWA 1R1WA 3Q4TA 2BHHA 3JS2A 4M0ZA 2XA4A 4BDFA 2C5OA 5IUGA 4ACMA 5K0KA 3PZHA 4AGDA 2BILB 4DH3A 2G01A 4TYIA 4D9TA 2QODA 3GCSA 4IM2A 3LXNA 3MYGA 1Q24A 3CKXA 1YHVA 2WMUA 4BCPA 5AV3A 3VS6A 2PE1A 4MVFA 4BCQA 2X7GA 3CC6A 4G3FA 3DZOA 2YJRA 4DGMA 2IG7A 2Z60A 3OHTA 4E1ZA 4D4VA 2YZAA 4EOSA 3P7AA 3BV2A 3Q9ZA 2OO8X 4G9CA 5LMAA 4ASDA 3RHKA 2XKFA 3TNHA 3QQGA 2W1FA 3MJ1A 4BZNA 4KIPA 4RJ3A 2BMCA 1OIQA 3QL8A 3WIGA 4QTBA 3R28A 4R6VA 5K9IA 2VTHA 2B0QA 2NP8A 2R7IA 2W1EA 4PTCA 5H8GA 5BMSA 3BGZA 5HCXA 4MQ2A 2JIIA 5AMNA 3HAVA 3JUHA 4P5QA 1KV2A 3MFSA 4TNDA 1GZNA 3UNKA 4O7RA 5HVJA 3EQHA 1G5SA 1RQQA 2JGZA 4L43A 4YPSA 1SVGA 5I9UA 4QP9A 2CMWA 2OSCA 3ZH8A 3KRXA 1KE9A 5J79A 4W4YA 3GU5A 1Y6AA 5DI1A 3ZXZA 5M09A 2A2AA 2G1TA 3F7ZA 4AXAA 4V0GA 5CVFA 2YM4A 4D4SA 4JT3A 5JGAA 2HIWA 2HZ4A 1SZMA 2H8HA 3D0EA 5DEWA 2CGXA 4BVUA 1FGIA 2GHLA 4IB1A 1K2PA 3K5UA 3PE1A 2ERKA 2P2IA 5C8NA 4DT9A 3GGFA 4YR8A 2ZOQA 4EOOA 3VJOA 2C3KA 3I79A 3IONA 1OIUA 1UA2A 4RSSA 4IJ9A 4DHFA 2ITWA 4R7IA 4ONAA 1Y91A 4WUAA 5HTIA 1F0QA 3QTUA 5IA2A 2YM6A 4O86A 2G9XA 2PULA 4ZSLA 4YJVA 4TYHA 4D0WA 4ZTNA 4FG7A 3Q6UA 2EXMA 3QRIA 4NUSA 2B9JA 4OT6A 1JQHA 3Q4ZA 2QLQA 3V3VA 4J8MA 2OJ9A 4F9AA 5EQEA 2YHVA 5CNOA 3GFWA 3IO7A 3PY0A 1H01A 4ITHA 3QC9A 3BX5A 4BDGA 5LJJA 4EHZA 3RPOA 4U80A 1QCFA 1YXSA 5CXZA 4LGHA 3F5GA 3GUBA 3LFSA 5B0XA 5FM3A 4PMSA 4D58A 4R5YA 2R64A 1K9AA 2JIUA 3NUUA 3TZ8A 1MP8A 3CQWA 4ZJVA 4QYHA 4L52A 4I1ZA 4NL0A 3UZPA 5CALA 2HENA 3DB6A 5J1VA 4MD8E 4QMNA 4ANQA 4FMQA 1L3RE 1UU3A 2VTRA 4KKHA 4DG2E 4D0XA 2WMBA 4FNZA 4R5SA 3DKFA 2VWUA 4O2PA 4TW9A 1JBPE 5CU3A 4BC6A 3JY9A 4DCAA 4C4JA 3SKCA 4PMMA 2X9FA 3UQFA 2WKMA 3EQCA 3FZ1A 4QNYA 4LL5A 4O6EA 3H3CA 5H2UA 3FMNA 3ZSIA 2OLCA 4XX9A 4EJ7A 4EK3A 4YC8A 2Z7SA 3R9RA 3D5WA 5EI2A 4G34A 2B54A 4BTFA 3TKHA 1UNHA 3RI1A 3LFAA 1SYKA 4NFNA 4J96A 4AGWA 3R9HA 4FKPA 3KMMA 4BB4A 3PY1A 5C4KA 2ITVA 4S31A 2RKUA 3FWQA 4DLJA 4GKIA 3NUXA 2Y6OA 5JQ5A 2X8EA 3KMUA 4C02A 1PW2A 2XIKA 4YJOA 1OL7A 4EQCA 3ATSA 3A7IA 1LEWA 2BZIB 4D4YA 4DH1A 3UMWA 1XBCA 2XF0A 4OW8A 3EQRA 4MXAA 3EB0A 3VS2A 2WHBA 3VC4A 2RF9A 3GP0A 4K8AA 4DITA 2XNPA 1QPCA 3QQJA 5C4LA 5DGZA 2PVRA 2OW3A 4L3JA 3G0FA 4OTWA 3VIDA 4D2RA 2PUUA 2I0EA 1UNLA 4WRGA 4FV9A 4LRKA 5F20A 3W8LA 3FZRA 5IA3A 5J7HA 4H58A 3C0IA 3DTCA 3OCSA 4EBVA 1H4LA 2BFYA 3MGYA 5EM8A 2C3JA 2VO6A 4JAJA 3FLSA 3OWLA 4LOQA 3O50A 4E4MA 3KREA 3LQ3A 4IH8A 2Y4IC 3HVCA 2J2IB 3ZLYA 1YWRA 3Q60A 4I41A 3QTIA 3U9NA 3V5QA 4F9WA 2O8YA 3H9OA 5DT4A 1GIHA 4MWIA 4QMPA 3S4QA 5GZAA 1PMNA 2X7FA 2PVMA 3MTFA 4NK9A 4X3FC 4NM3A 3UZTA 3CD3A 4O82A 2XVDA 3MDYA 3TUDA 4AUAA 5CI6A 3L1SA 3U6JA 5A4LA 5HCZA 1YI6A 4C8BA 5AEPA 4UEUA 4CZUA 2PYWA 1XH8A 4IADA 5B2KA 4JIKA 3ZDIA 4BDEA 1ATPE 2F4JA 4IAAA 4L67A 5DRBA 4EJNA 4XEYA 1FVVA 3BYOA 4AW1A 4DFNA 4DFYA 5AAEA 2HWPA 5IUHA 3DNEA 1WBWA 2BTRA 4LOPA 3BEAA 4JDIA 4USEA 5DPVA 3W1FA 1TKIA 2UZTA 4B8LA 1Q61A 4BCIA 4FSQA 3E92A 2IW8A 1OKWA 3FY2A 3BHYA 3L9MA 4FKUA 5EDPA 2XKEA 5H3QA 2OK1A 2VNYA 4CNHA 2Q0NA 4IAYA 4O27B 4UMTA 2R3OA 3GC8A 3EQBA 4I92A 4FIFA 2R4BA 2JDTA 1L8TA 4WG3A 2BAKA 4FZ7A 2EXEA 1NW1A 4RWIA 1I44A 5GZ9A 5HHWA 4XG7A 1PXKA 3IDBA 1IR3A 4ZTLA 4D1ZA 5IA1A 3KRLA 2WQMA 3POOA 5DLSA 1OB3A 4LMNA 1PMEA 2CNQA 5TE0A 4RIWB 2PZIA 3IOKA 4NU1A 3MESA 2BROA 1H1QA 4HNFA 1PF8A 4JDKA 5IEVA 5J87A 3LPBA 4MD7E 4RJ8A 3ALOA 2PU8A 1FINA 3BU6A 4NKAA 4S33A 4EYJA 5HD7A 4YO4A 4F1TA 4R7BA 2QOQA 1GAGA 5KHWA 4YHFA 4V04A 4O7SA 1NVRA 3BWFA 4P4CA 2C0TA 4MF1A 4MXXA 5ETAA 3W55A 4CKIA 3P7BA 4CRSA 3HA6A 4GCJA 4MAOA 4CD0A 1REKA 2J0MB 2RSVA 3W33A 4F6WA 4FTAA 4AQCA 3BE9A 2HOGA 3TACA 4CTCA 3ZC6A 1UU8A 5IQDA 3QCQA 3UOHA 2B1PA 1YQJA 3GVUA 4IJPA 4U6RA 4J99A 4O0UA 1PJKA 3QALE 4RLKA 4TWOA 3BHHA 4XG2A 4XLIA 4YBJA 4BCGA 4IVCA 4C0TA 1UKHA 3ROYA 3SXFA 5KMKA 3R7GA 4C7TA 3GCUA 3OC1A 3E3BX 5FXRA 3MH3A 3A4OX 3HMOA 4L01A 4EYMA 1J91A 1WFCA 2BAQA 4RX9A 3E8DA 1YHWA 2WTWA 2XK7A 5AP1A 3DXPA 2XNEA 3EMGA 4LV8A 3WF6A 4MEDA 3TT0A 4R3CA 2W9ZB 3BYUA 3V5WA 5LMKA 1P14A 4FZFB 3CXWA 4ZTHA 4NCTA 3WZKA 5C8MA 5IH5A 3F82A 5BVOA 3NMUF 3EQDA 1J3HA 3KXHA 5CU2A 3VS3A 4DGOA 3PDTA 3CQEA 1JKTA 2E9PA 5F95A 5HQ0A 5BYLA 4H05A 4HZRA 5KHXA 2BDJA 4YTCA 4KRDA 4A4OA 3L8XA 2BUJA 4MXOA 5M44A 3IW7A 2Q83A 4RQKA 4TL0A 4LOOA 2PMNX 1M52A 2J9MA 1GY3A 2AUHA 3C0GA 5F4NA 1H24A 4GSBA 1QPDA 3CSVA 4E3CA 4JG7A 4OBPA 4F99A 4ZSJA 1UWHA 4RVTA 3SLSA 4DTBA 4G9RA 3EWHA 1PYXA 4RVKA 4A4LA 5KKRB 4W4XA 4Z9LA 3ZS5A 2B4SB 4KUJA 2JAVA 2PVLA 3R30A 3RAHA 3VQHA 4PPBA 3TV6A 4ENYA 3RHXA 4QP1A 1RE8A 3BWJA 4BCKA 1GOLA 2CJMA 4KIQA 3OEZA 4ACCA 2VZ6A 2XBAA 1H28A 5FD2A 2QHMA 5EYCA 2HZNA 5DT3A 4P5ZA 3R7OA 4FGBA 2JKKA 1FMOE 4BIDA 3ZUTA 2ERZE 4L3PA 3HDNA 4QQCA 2IZRA 4XBUA 3EFWA 4WNOA 1P2AA 5BYYA 3PP1A 2JDSA 2Z2WA 4BDAA 4EOMA 1M7QA 2PK9A 3CQUA 3QQFA 1Q97A 3NR9A 4DGGA 1URCA 2CGUA 4KSPA 2QOLA 4XUFA 1PMUA 2VGOA 1V1KA 3EQFA 3KCKA 4XV2A 2WAJA 3EIDA 3VBTA 4OGRA 3UTOA 3VS4A 4MXZA 2WO6A 2XRWA 3EFJA 2PMLX 3W16A 1H07A 3Q6WA 4MXYA 4YJTA 3O96A 3VRYA 3ZSGA 4APCA 5DMZA 4QMTA 2OJJA 4QPAA 3FC1X 3FJQE 5KNJA 3WILA 5E8TA 3A4PA 3UDBA 3RM7A 2QCSA 2J5FA 3FLQA 2J6MA 5D11A 2ITXA 4MX9A 3S0OA 3VBYA 2R0IA 3CGFA 4YZMA 1H1SA 2DWBA 3LFDA 4GFOA 4AE9A 4Y8DA 4F7LA 4EOPA 1PXLA 3AD5A 4XG6A 4BBMA 3Q3BA 2F2UA 4JLCA 4RVLA 5IEXA 2UW5A 3W10A 1SMHA 4NW5A 5BNJA 3IK3A 4JNWA 3PLAE 3P4KA 4RJ7A 1KOBA 2F2CB 4AZWA 5LMKC 2LGCA 3FLYA 4CMTA 2P0CA 3CPBA 5J8IA 3FC2A 4YP8A 4EBWA 4XHKB 1LPUA 2AC5A 3P23A 2XRUA 2V5QA 4ALUA 2HELA 3QTSA 5IA0A 2R3GA 4FV2A 3KXMA 3D5UA 4ANSA 5F9EA 3W2CA 3R8VA 1JVPP 3H10A 3P5KA 2B53A 3MSSA 2YLFA 4FIJA 3U6HA 3EN7A 4I5PA 3SG9A 4ZIMA 4CYIA 4N6YA 5K5XA 5FBOA 3I1AA 4Y5QA 3MBLA 2BVAA 3L9PA 5J5TA 1ZOGA 4X3JA 4XOZA 5DNRA 5A4EA 5L2IA 4LQMA 1RJBA 3A61A 2GNGA 1Q8TA 1PHKA 3R2BA 4EH5A 4R1VA 4LGDA 4AU8A 1GNGA 3F2AA 4NFMA 3A8XA 4XH6A 3F66A 4TYJA 3ZO1A 1CKIA 4YLLA 1PKDA 2W1DA 3COMA 3TZMA 2VV9A 4E26A 2YCFA 2ZV2A 2XCKA 4WNMA 4UY9A 4BIEA 2CCHA 4UWYA 4TNBA 1Q8ZA 2PMIA 4GG5A 4WG5A 1Q3DA 4YHJA 1KE7A 4LL0A 4RGJA 4YJSA 4Z16A 5IPJA 1SNXA 4B6LA 4IWPA 1YVJA 4PDPA 4UXQA 5HNIX 3BIZA 4IBMA 2REIA 5ACBC 3G0EA 3RK7A 4F6SA 4UZDA 4JBPA 3BE2A 4KKEA 3R73A 3COHA 3CIKA 3QBNA 4WKQA 3RPVA 5CEMA 2ITOA 4FUXA 4EZ7A 5EW8A 4IDTA 3FHIA 3UQCA 2VUWA 3KK9A 2CSNA 4ZTMA 2ETRA 5IDNA 3ZONA 3LOKA 5CVGA 3QX4A 3BGPA 4QP4A 3MA3A 3BHUA 4GJ2A 4S30A 3QKKA 3U4WA 3LCDA 3ODYX 4S2ZA 5HICA 2OFVA 2QOCA 1GZ8A 1OL6A 3AD6A 4RX8A 5LQFA 4FG9A 1O6LA 4GW8A 5FWKK 1V0OA 4ACGA 4RZVA 2Y8OA 5M55A 3ZLWA 3U4UA 1IRKA 1CTPE 2W17A 3CS9A 2WQEA 5CU4A 3ZDUA 3UO4A 4FNXA 2QR8A 3ENMA 4I20A 5FXQA 3FI3A 3LLAA 4RA5A 4E4NA 4F65A 1BL6A 2CN8A 4OT5A 4C34A 3BYSA 4IACA 3DNDA 4WRSA 3UC4A 2HZ0A 2VTPA 4OUCA 4IHPA 2HY81 1R39A 4X2NA 4G17A 3ZRKA 5JK3A 4F7SA 3PJ1A 2CDZA 3QQLA 3TZ9A 3EN5A 2V7AA 2C47A 3T3VA 2OJIA 3CY3A 3FKOA 5CT7A 2PTKA 3NUNA 2ETKA 4GJ3A 2VNWA 5HNBA 2FSMX 3FQHA 3Q4CA 3BBWA 3OY3A 1UU7A 5LXMA 1BLXA 3L9LA 4BHZA 1WBOA 1OMWA 3HRCA 4OTFA 5TR6A 4DH7A 5J95A 4F08A 4PNKA 2F49A 1U59A 3AMYA 5HGIA 4D2VA 4IB5A 2IPXA 5EHLA 3NZ0A 3NS9A 3MTLA 3WF8A 4AAAA 4IMYA 3OW3A 4ANBA 4UMPA 2W5BA 5CY3A 5FUTA 2ZV9A 3D2KA 3I81A 4IWOA 4PY1A 3ZFMA 3DBEA 4PRJA 4BWXA 4RA4A 5HTBA 5IH4A 3ZO4A 3FUPA 1OITA 5TF9A 5CU0A 3DLSA 3HAMA 4ID7A 5CF5A 3QRUA 5LVOA 2GPHA 2JFMA 4EHGA 3HP5A 5IMXA 3DLZA 1XH7A 2FVDA 1H8FA 2WD1A 1YOJA 2OH0E 2W1HA 3BI6A 3ENHA 3FZSA 3LE6A 4JRNA 4ZZMA 3RGFA 5JGBA 4CG8A 2VTMA 3C50A 3ORMA 3ET7A 4IDVA 3HLLA 5CASA 4MXCA 4KBAA 3ZRMA 4W8EA 1BMKA 3MVLA 4PPAA 5GJFA 2I7QA 1Q8WA 4K1BA 2UZUE 2X8DA 4OTHA 4PF4A 5AV0A 5IUIA 3HDMA 5L3AA 3A8WA 2BIYA 3E8NA 4N70A 3ITZA 2VX0A 3RPSA 5AX9A 3GOKA 3S00A 5EYDA 3QD0A 2WQNA 4PX6A 4U9AA 2VTJA 3EJ1A 3GFEA 4YSMA 3WE4A 2YDIA 3MN3A 3MVMA 2C6DA 4R3PA 3DT1A 4H3BA 3S2PA 3Q9YA 3ID6C 4UMUA 3IOPA 3SG8A 1WVYA 3E88A 2JKQA 2JBPA 3Q9XA 1XJDA 2R0UA 4E7WA 4EH6A 5A54A 2UW9A 4HYUA 3RNYA 4RX5A 1DM2A 4RWJA 4HOKA 4TWCA 1BI8A 2ZVAA 3I6UA 3CP9A 2YWPA 4CFWA 4FL1A 3LCKA 4ZK5A 1OIRA 2UZBA 3ZUVA 5GZ8A 4EK8A 2XK4A 4QMZA 2FUMA 3THBA 2WU6A 4L68A 4X2FA 4QQ5A 3NNVA 5CT0A 2W05A 3UOLA 4HVHA 4UX9A 4A06A 3DKGA 3NYXA 2ZM1A 4FT9A 5G6VA 3ZBFA 5L4QA 2E9VA 1JPAA 3I7CA 2ZB0A 2VWYA 4Z55A 3KL8A 4APPA 2QOIA 3NYNA 1J7LA 3E87A 2BTSA 4AT5A 4ASXA 4V0GB 2OU7A 4Y72A 3GEQA 5IZFA 2QI8A 2C5NA 1DS5A 5T6KA 1ZY4A 4JBOA 4D2SA 2RG6A 4P2KA 2BRBA 3KXNA 3OP5A 4F7JA 5L8LA 1YRPA 2OG8A 4BDBA 3DZQA 5FDPA 5JFVA 4HYSA 4TN6A 4TWPA 3OXZA 1H08A 5E8WA 4EH3A 4IW0A 5CU6A 5FTGA 2H9VA 3LFBA 2HCKA 3AC1A 4QP8A 4UMRA 1SVEA 5AP7A 4YSJA 3DXQA 4DEAA 4IXPA 2WEIA 3NAXA 2C6OA 4CFFA 4GK2A 5G1XA 5E4HA 3OEFX 3N9XA 4F1OA 3EFKA 1KE8A 3NIEA 3DKOA 1PXPA 5CEPA 4L00A 4UMQA 2PVJA 2CCIA 5I9XA 2BZJA 3PA4A 5EM7A 1ZMUA 4C4GA 4KS7A 2E9OA 4LM5A 2WTKC 2YCRA 3I7BA 4NM5A 5CX9A 3OTUA 3RAKA 3OBGA 4PDSA 1YI3A 4O2ZA 3IW8A 2PUNA 4FT0A 2PVNA 4CTBA 1FQ1B 2VX3A 2RFSA 4FV8A 2XZSA 4FZDB 3SV0A 5A14A 1U46A 2UW6A 3T3UA 5KBRA 4PDOA 5E1EA 4RBLA 3PVUA 4F09A 4CZYB 4FBXA 2WIPA 3O17A 3FZTA 5LWNA 2NRUA 4FI1A 4F9BA 3TDVA 5HG9A 4YZCA 3R1QA 3FKNA 2X39A 2UVYA 3GQIA 3TUCA 3W2RA 3COIA 4O7ZA 5AP2A 1PMVA 2QOBA 3BEGA 4PUZA 3SXRA 2Z02A 4RIWA 3ORNA 5LOHA 1M17A 4X21A 4ZXTA 4LRMA 2IW9A 4DCEA 2QC6A 2A19B 4XOYA 1JNKA 4FSWA 5IQIA 2I0VA 2XH5A 3UJGA 4BTMA 4ZY4A 4IWQA 4L44A 3OROA 4EEVA 1OECA 4F0FA 5K4JA 3LJ0A 2OJFE 4FT5A 3VS7A 5HNGA 3BZ3A 3OY1A 5AR7A 5ANDA 2AC3A 3HEGA 4F7NA 3SX9A 5B7VA 3Q2JA 2F57A 2JC6A 2YDJA 3LCOA 4FT7A 4QTAA 1XWSA 2IZUA 4AGUA 2OXDA 4LRJA 2C6TA 4FE2A 2IVSA 1H27A 3F3VA 3KMWA 4NTTA 5D10A 3PXRA 5DHJA 5LMBA 2PZRA 3LIJA 4YNEA 4RIYA 4E4LA 5AUXA 4AZTA 4FT3A 4XV9A 4AN3A 2BKKA 5A9UA 4XS2A 4B9DA 4WNKA 3WZDA 3ZZWA 4FTTA 2Y4IB 3R8LA 4J7BA 3O0GA 5EI8A 5CS6A 1T46A 2WMXA 3F61A 3G9LX 3DDQA 3DJ6A 3LXKA 3KU2A 4XCUA 1U54A 5HIBA 4I5HA 4I0SA 5E8UA 2YIWA 3FE3A 3W2OA 4QQJA 4DEEA 1FGKA 4PMTA 2XJ1A 5M51A 4BI1A 4DYMA 2UZDA 1OKVA 3LQ5A 2G15A 4BI2A 4I93A 5DR6A 2PUPA 3TDWA 3AXWA 4LGGA 3NAYA 2C6KA 4AOJA 5KUPA 2NO3A 3ORZA 3PP0A 4D55A 1E1VA 4FSYA 3UO6A 2PVKA 3CLYA 3DQXA 3NYOA 3OT8A 3BCEA 4FTIA 4MYGA 2R3JA 3V5JA 1UU9A 4OTGA 5HLWA 2PUIA 4YO6A 3FLZA 5K3YA 4C57A 4ZSAA 1B6CB 2IO6A 4JS8A 3RK9A 2V7OA 1MQBA 4YHTA 3ETAA 4E4XA 3FY0A 4E5AX 2GNLA 5HVYA 3TIYA 3U55A 4FZ6A 4TXCA 4YGAA 3VW8A 2C3IB 5AIKA 3FZPA 3VN9A 4G5JA 3PY3A 3BV3A 3AG9A 2WIHA 3I0OA 3CGOA 5L2TA 3UGCA 5BX0A 3LFNA 2Z8CA 4EOKA 2XEYA 3QRTA 5M56A 4YMJA 4IM0A 5KO1A 1BL7A 4B99A 5AP6A 3VS1A 3PVWA 3PXZA 4P7EA 4DEGA 3HV3A 4OAUC 3PFQA 3FBVA 3F5XA 4BCFA 3KXXA 4WOVA 1ZYCA 4M3QA 1DI8A 1NY3A 5EQYA 3KA0A 5EOBA 3OW4A 4UYAA 4U8ZA 4BZDA 3MPMA 5T3QA 3K3JA 4FICA 3FDNA 4FIEA 5AR8A 1NA7A 2YABA 4X3FB 3RALA 1A48A 5HTCA 4YJQA 3A99A 4W4WA 5JQ8A 3AT2A 3QQKA 4EOLA 3NUSA 5BVDA 3VF9A 2E2BA 5LCJA 2QKWB 2R7BA 4PQNA 2O64A 5AM7A 1HCLA 5ITAA 3ATTA 3DK6A 4JBQA 3Q53A 4KS8A 4FKQA 1W8CA 4BYJA 2QOFA 1GIIA 4U81A 5CSPA 5I5ZA 2XIYA 4ERKA 3EL8A 5CZHA 3L8PA 3KCFA 3K5VA 4BKZA 2JAMA 4UWBA 4BZOA 4U45A 4JX7A 3A7GA 4O22A 3O7LB 4FC0A 1IA8A 1J1BA 2RG5A 4QMXA 4HYHA 1FVRA 5KMIA 4XG8A 3IG7A 4O1OA 4ZEGA 1ND4A 4BTKA 2WMRA 2ZDUA 4YU2A 1GZKA 3UIUA 1F3MC 4DINA 3QXPA 4Z7GA 2PVFA 3W8QA 2I40A 4PNIA 5I3RA 3QC4A 2G2IA 4HVDA 4JI9A 4TTHB 2EWAA 2HXLA 5CAOA 4MBJA 5EHOA 3G9NA 1JSTA 2VO0A 4TY1A 1VEBA 1XH9A 4EONA 3IW4A 2P55A 3D5VA 2R2PA 4G2FA 4OLIA 4I23A 2ZDTA 5CEKA 3LXLA 3ZOSA 4CKRA 5AV4A 3E93A 4BBFA 4K18A 4IVDA 2Z7LA 2QVSE 3FPMA 3G15A 4I4FA 2XYNA 4O0RA 5A6NA 4JQ7A 3R22A 3F3ZA 3D9VA 2YERA 3EH9A 4R1YA 3V01A 1H0WA 3RWQA 2BPMA 4LUDA 3BLRA 3HL7A 1QMZA 3UVQA 4RJ5A 4K2RA 4IEBA 4EKLA 4YJPA 2GTNA 4GIHA 4CEGA 2JDVA 3DAEA 5DR9A 1HCKA 4U3YA 1W83A 4AZSA 2V22A 4C35A 2VWVA 3GU8A 3RP9A 4E6CA 2OI4X 1BUHA 2Y0AA 3QXOA 4BCJA 3I4BA 3T8OA 2ZJWA 4HNIA 4D5KA 3QUDA 3UC3A 4NYEA 3FL5A 3RWPA 3R9DA 4QTEA 4DBXA 1H1RA 4JX3A 3S3IA 4HCVA 2ZAZA 4I6QA 2EVAA 4NEUA 2ITZA 3DGKA 1B38A 4QMSA 4A7CA 4TZRA 1MRUA 5JEBA 3JVSA 4IVAA 2C6EA 2FSTX 2GFSA 2I0YA 1ZYJA 3AQVA 4U7ZA 4NIFA 4ZP5A 5JH6A 2I0HA 3PPJA 4BDHA 3VUTA 3SHEA 4FNWA 3H9RA 4FF8A 4LYNA 3ELJA 1KV1A 2DS1A 3FMKA 4G3GA 3SQQA 3UNJA 4AWIA 5DIAA 3HRBA 5L6PA 5HD4A 5HE0A 4X2GA 2GS2A 2XIXA 2XBJA 2R3MA 1A06A 3BYVA 1EH4A 3QAME 4FKRA 3C4ZA 4TKSA 4XLVA 5EQPA 3N4UA 3Q5ZA 4L9IA 4BGGA 3U54A 2BKZA 1TVOA 1TQIA 3PXFA 3VVHA 2IZSA 5E8YA 3H9FA 2HYYA 2QO9A 4GVJA 4QNAA 3IS5A 4DFBA 5FP5A 5HZNA 4M69A 3IGOA 2QONA 4GUBA 2XCHA 2X9EA 4AA4A 4EK4A 3LMIA 3SXSA 1XO2B 3K54A 4BTJA 3TCPA 5KCVA 2BHEA 4GU9A 4CRLA 3PJCA 3CTJA 1LP4A 1M2QA 3V8SA 4AFJA 3K3IA 4O0WA 4DC2A 2OH4A 2A1AB 5HU3A 2R3IA 3UE4A 3KRJA 5BMMA 2UUEA 4CKJA 3R21A 4FKJA 4QP3A 1CM8A 2HW6A 2JEDA 3PUPA 4AACA 1ZLTA 2O3PA 3D15A 4WHZA 4ALVA 2J0KA 3LLTA 4I6FA 3MPTA 3PZEA 4YZ9A 1OL1A 3KK8A 2PHKA 4M68A 4GH2A 2W7XA 4RRVA 2B9FA 4GKHA 5AAGA 3NVMB 3E7VA 1RW8A 4MQ1A 3DKCA 1U5QA 3E64A 3EZVA 4B4LA 3TN8A 3BHTA 4O7NA 4ZY5A 1FOTA 1SM2A 3CJGA 5AM6A 3W2PA 5JZNA 3DFCB 2GNHA 4TRLA 4WA9A 3ZSHA 1OGUA 3C5UA 3F9NA 4X2JA 3DPKA 3C7QA 4DFZE 3OXTA 2XK6A 3DFAA 2WTJA 3D7TB 3NLBA 4GFGA 4MF0A 2J51A 4E6DA 4FTRA 5HE2A 4RIOA 1OI9A 4M97A 4TT7A 3MW1A 4IX4A 4WSQA 2UW0A 1ZYDA 2PPQA 2KTYA 2OXXA 3UP7A 1JSVA 1DAYA 3QHWA 4YNOA 4UALA 4YLKA 4RFZA 5D12A 4YTFA 2NNWB 5CEOA 4M69B 2ZMDA 2X2MA 2W96B 3F7WA 5BVNA 4IX3A 4BDDA 2JITA 2PZYA 4BBEA 5CAVA 1MRVA 3EOCA 3LHJA 3R7IA 2OICA 1OBDA 2JLDA 5HX8A 4I3ZA 4XBRA 5JRSA 4IC7A 4EUUA 4O81A 4ACHA 4D2PA 4Y95A 3C4FA 4QMMA 4K0YA 1WBNA 4H3QA 4NZWB 1OIYA 5CAPA 1M2PA 3NUYA 5DH3A 1OKYA 2Y9QA 3ORXA 3REPA 4DEDA 3QLGA 4B8MA 5TT7A 5I9WA 3P0MA 1IAHA 3NNUA 3RKBA 2C3LA 4FVPA 3VS5A 3TV7A 3PSBA 3ULZA 1BX6A 3NW7A 3R2YA 4RC3A 3F69A 3PRIA 5IQEA 1T45A 4IVBA 3F5UA 3UOKA 4EUTA 3R02A 4KBCA 4Z3VA 5J9ZA 5IH6A 4FIGA 3OWJA 3ZEPA 4FTNA 4L7SA 5ETIA 3UODA 4FR4A 3OMVA 2H6DA 3IECA 3RINA 1QL6A 5EDRA 4FV0A 4DT8A 4QP7A 4FKVA 5AX3A 3FZOA 3F88A 2UW7A 1M14A 3C9WA 4GK3A 4BCHA 4CFUA 4CFVA 1WMKA 3FI4A 2DUVA 4X2KA 2QD9A 4F70A 2YIYA 3RMFA 4YZBA 3H4JA 2EXCX 2P3GX 2HZIA 3VBXA 5AUTA 3NEWA 5KZIA 5ETCA 4UYNA 4QYYA 2C30A 5KMMA 3P9JA 5L2WA 3FI2A 2HWOA 1W0XC 5M4IA 3QQUA 1KE6A 1R0EA 4FTKA 4J71A 3UPXA 4O6LA 4KBKA 3I5NA 3AC4A 3S95A 3TWJA 4FOBA 4FYOA 3V6SA 3ZMMA 4KKGA 4XMOA 3T9IA 4CCBA 4DA5A 3H0YA 4XRJA 2FO0A 4ENXA 4I24A 3G90X 3ORPA 2HW7A 3EQGA 3Q2MA 4NJDA 3TKUA 1JLUE 2QG7A 1WAKA 5AADA 2C6MA 3ORTA 5IQHA 5CF8A 3FMDA 3ZCLA 5KMNA 4GEOA 5ANOA 4CT2A 4IZ5A 3DCVA 2YN8A 4Y85A 2VRXA 5EK7A 4D4RA 1YOMA 1WVXA 3BLHA 4FYNA 4IAKA 4FKOA 2PY3A 3DB8A 5DVRA 2CKEA 4Z7HA 1V0BA 1O9UA 2KULA 3LJ1A 4BDCA 4CMUA 1W82A 3UIXA 3FMLA 3LAUA 4WNPA 5K0XA 3O7LD 2WOTA 3QYWA 2GTMA 5DG5A 3WZEA 4U41A 2OJGA 4KIOA 4LV5A 2GCDA 2W0JA 1Q5KA 5D41A 2VN9A 4J95A 2VO3A 4U40A 3E8EA 4QMVA 3OXIA 5HG8A 3EKNA 4C3PA 4M14A 4BDJA 3LQ8A 3GC0A 4HYIA 4RG0A 4YURA 3TI1A 5CI7A 1Q8YA 1YDSE 4E5BA 5DR2A 1IASA 2UZOA 2WPAA 4C4HA 1CMKE 3AD4A 3KULB 2BRGA 3FI8A 2JDRA 3ANRA 2VTNA 3KXZA 4Y83A 4WBBB 5CNNA 5DRDA 3P7CA 1YOLA 3KFAA 4RMZA 4M13A 4DTAA 1OPKA 3CD8A 3JY0A 5DN3A 2EB3A 1GZOA 5DT0A 1R0PA 3AC5A 3MPAA 4CMOA 5AR5A 1R3CA 4E6QA 1M7NA 3M2WA 1SVHA 2XNMA 2XEZA 1E1XA 1OVEA 2A0CX 3O2MA 4J52A 2VX1A 4MBIA 5D7AA 3R9NA 4BDIA 5HORA 3COKA 2QLUA 3QYZA 4J8NA 3GQLA 2BRHA 5C03A 3LVPA 5JRQA 1XBAA 3CJFA 3SRVB 5E9EA 3HECA 3K2LA 4JIAA 4DEHA 4QP6A 5IQGA 3KY2A 2JBOA 2UZLA 1OPLA 2Y6MA 4MH7A 5CQWA 5L2QA 4GT4A 2GNIA 3ANQA 3GU4A 4QRCA 5AUYA 3PA5A 3EKKA 5HBEA 1ERKA 5L8JA 3GOPA 4WBOA 3G6HA 2R3LA 3UIBA 4OBOA 4HVGA 4JDJA 4W9XA 4WUNA 5M57A 4DH8A 2UZVA 2O2UA 2QO2A 3FKLA 2EU9A 3CPCA 2ZV8A 3KQ7A 2VD5A 4R3RA 3ZO3A 4AW0A 2OGVA 4I21A 2FA2A 4KB8A 2VTOA 4MNEA 3B2TA 3FHRA 3V5PA 2FH9A 3I60A 4S32A 5FXSA 3R1NA 3CY2A 2W4JA 2J0JA 3DJ7A 2C5VA 3MFUA 1KOAA 2XJ0A 4A9RA 4U0IA 5CSXA 4E6AA 2OKRA 3GCQA 4U44A 5LCKA 4C58A 4PP9A 4A9YA 4GYIA 2YM5A 3OT3A 3VUKA 3M1SA 2WMSA 5D9HA 2ITYA 4RIXB 3CBLA 2HY0A 4FL3A 5IISA 5KBQA 5AIRA 1BKXA 4DEBA 5IEYA 3VHEA 5AP5A 3C4CA 4RVMA 2B9HA 4FK6A 4RZWA 4FEUA 4HCTA 5IQBA 3ZFYA 2PZ5A 5HLNA 3NDMA 3VAPA 4TYEA 2QU5A 4FV4A 3EQIA 4KWPA 4QTCA 3N4VA 2P2HA 1Y6BA 3PSCA 3HYHA 2W5AA 3KN6A 4HPUE 2W1GA 3MJ2A 4EORA 3MB6A 3R1YA 1YHSA 5M53A 2X7OA 2ESMA 1FPUA 2GMXA 5A4CA 5LVMA 4R78A 2XK3A 3R1SA 3MY5A 4ZY6A 4F6UA 2F7ZE 3ZFXA 5EM5A 3PVGA 3RZBA 2DYLA 1PYEA 3U87A 4CXAA 4EH2A 4IQ6A 4O7WA 4MKCA 4KSQA 2XM9A 4GU6A 2J50A 5FTQA 3WF7A 5L6OA 5KMJA 2R3HA 4BY9E 4YZDA 3AC2A 2W1IA 4TYHB 4XJ0A 5I3OA 4ASZA 3BU5A 2J5EA 2O65A 4PWNA 5CSVA 3OOMA 4CZTA 4G3CA 2R3PA 2F7XE 3AC8A 3JVRA 5LVNA 3QF9A 3HGKA 3LJ2A 3L9NA 1V0PA 3UO5A 4MTAA 1CKPA 3FSKA 3QQHA 4AZVA 4ZMEA 5ANGA 2ZYBA 4L46A 4BWPA 2F9GA 3HV5A 3MWUA 2XNBA 4FUYA 2R3KA 4GYGA 2ITUA 4YC3A 5BVWA 5ANEA 3VS0A 1JWHA 3C1XA 3RPRA 2P4IA 3AOXA 3MFRA 3C51A 4PP7A 3LCSA 3NX8A 3QCXA 3OWKA 3QKLA 4FKWA 5FTOA 3SOCA 3R04A 2RGPA 4O96A 3B2WA 4U5JA 4EOQA 3TZ7A 1CDKA 2VWWA 3E7OA 2YAKA 4D5HA 1GIJA 2E9UA 4QYEA 4UWCA 4I5CA 3FAAA 3Q32A 3D7ZA 3F6XA 1YXVA 3QWJA 5GIPE 5GHVA 4EC8A 5EG3A 1G3NA 4OTDA 3HUBA 5HG7A 3RTPA 3O8TA 4FEXA 4FGRA 1YWVA 4KAOA 4EL9A 4CCUA 1UWJA 2I1MA 3DJ5A 3EHAA 3Q4UA 4KABA 4O0TA 1IG1A 4AP7A 3UNZA 4QYFA 3GC9A 3NYVA 3TIZA 5K5NA 4FG8A 3W2SA 2YIXA 3HRFA 3EYGA 4EKKA 2XYUA 3A7FA 3WOWA 3T9TA 1HOWA 1O6YA 1I09A 1W98A 4R77A 3NGAA 3PXQA 4G31A 1ZMWA 3ZC5A 2W99B 4M66A 5CEIA 3TL8A 2WMVA 3SA0A 2YM3A 1OM1A 4QMWA 3H0ZA 1CKJA 4YZNA 3BQCA 1YXXA 4LMUA 3R9OA 1J1CA 3WARA 4EHVA 4USDA 4F64A 5DE2A 2JKMA 2GNJA 2H34A 5TO8A 2IW6A 3ZLSA 4Y73A 4BN1A 5AUUA 4FX3A 5C1QB 3II5A 5JFSA 2WEVA 3OVVA 4F0GA 5HO6A 1YKRA 4FEQA 4AA5A 2C69A 3VRZA 5CENA 5ANIA 4N57A 4HVIA 4BI0A 5AA8A 5M06A 5E92A 4CYJA 3FQSA 4ZOGA 3QHRA 1ZYSA 3ALNA 3PSDA 5CWZA 4K6ZA 1URWA 5HO8A 1ZZ2A 5BUIA 1H00A 3EN9A 4FIIA 3ULIA 1P5EA 2IWIA 4ZS4A 3ZYAA 4FSNA 4F1MA 2NRYA 4HZSA 3NUPA 4KINA 4E93A 3DTWA 5BYZA 1OL5A 3HKOA 1KE5A 1WBVA 3P08A 4QPSA 3PPZA 4AF3A 3F5PA 2PE2A 3HP2A 3A7HA 4H1JA 5BVEA 2EUFB 3ZXTA 3BPRA 2EB2A 5HCYA 5JSMA 2CKQA 3P86A 4G16A 1WCCA 5FDXA 3V04A 4ASEA 3MY0A 5JT2A 2UW4A 2UZEA 3LW0A 4Q5HA 4FSRA 2BCJA 4LI5A 3V5TA 5C27A 1M2RA 3KGAA 1XH4A 3QD4A 4H3PA 2GHGA 4JR3A 3QA8A 4NWMA 4PTGA 4XRLA 1KUTA 2X4FA 1Q8UA 1PXIA 3C13A 2GSFA 3HMPA 3EL7A 3QZIA 5CXHA 5IMEA 3NNWA 2XIRA 4G1WA 4UB7A 3IW6A 4F9CA 2W1ZA 3FMEA 2GQGA 5CEQA 5BPYA 2UW3A 1AD5A 3OWPA 5BVKA 2Y7JA 2R5TA 2W5HA 4FTLA 3LZBA 3G51A 4OTPA 3JR1A 3PTGA 2YM7A 4C62A 1ZYLA 4JQ8A 2CNUA 5ETFA 2V55A 3VBVA 3IDPA 1Q41A 3KKVA 4YTIA 5EI6A 4AGCA 3KVWA 5DFPA 3PRFA 3RCDA 2FB8A 4BCNA 3VWAA 4QOXA 5B2LA 5HIEA 2C6IA 5KMLA 2BALA 4XG9A 3DK3A 1NVSA 1ZZLA 1ZOEA 5AR4A 2OF4A 2A27A 2PVYA 4V01A 4A9UA 3UPZA 3U51A 2LAVA 4A07A 4AX8A 5HX6A 4GV1A 4F9YA 3CTQA 2X1NA 2V62A 3HV6A 3MB7A 2SRCA 2QOHA 4IFCA 3MIAA 4BGQA 5J5SA 2WGJA 2XIZA 4FVQA 4C3RA 5HIDA 4NW6A 5J9YA 2XNNA 3VNTA 3LM0A 3G5DA 4L6QA 2XNGA 5EKNA 5EYKA 1R78A 5FRIA 4AW5A 3OFMA 3QU0A 3IW5A 4I0TA 5M08A 3BLQA 4M0YA 3WE8A 3OG7A 4E73A 3KB7A 1G8AA 3DV3A 3OOGA 4XG3A 3P79A 4RC2A 3NUAA 2QKRA 4WD5A 3UYSA 3VUHA 5CVHA 4YJNA 2IVTA 4YJRA 1AQ1A 3AC3A 3LFFA 4DLIA 1Q62A 4XP3A 3UG1A 4A9SA 3QTRA 4K11A 5I9ZA 3RVGA 4BYIA 3D83A 5E7RA 1XHAA 4OTRA 1STCE 2I6LA 2J7TA 2OF2A 2YJSA 5DOSA 5FG8A 4D2WA 4F4PA 2YCQA 1TQMA 3OCGA 1LUFA 4FV7A 3G6GA 3LM5A 3WZUA 4D28A 4PL3A 3RPYA 2FSOX 2YFXA 5E90A 3RK5A 3M42A 1SNUA 5DBXA 5I9YA 4U3ZA 3HMNA 3FSFA 3I5ZA 4EOIA 4HW7A 2VWBA 4AT3A 5C26A 2CKOA 2C5XA 3FV8A 3MH2A 3NNXA 3PJ3A 2GU8A 4IAZA 1JOWB 3PIXA 2VGPA 1Y57A 2ITPA 3EN6A 4X0MA 3V5LA 3UYTA 3VULA 4A4XA 2O5KA 2W4OA 4FKSA 4WO5A 1P4OA 5L8KA 4O7VA 5AFVA 4DFUA 2J4ZA 4XYFA 5BUEA 2WB8A 2C1AA 5FM2A 4CFXA 4UZHA 2QHNA 2V0DA 1YXTA 3HV4A 4C4FA 4PL5A 3VUGA 2OWBA 5FLFA 4QQTA 5K4IA 3VUIA 3DBDA 5AR2A 4PL4A 2W9FB 4O7TA 5KMOA 1IAJA 3C4WA 1JKSA 2QNJA 2JD5A 3NIZA 1PXOA 2XP2A 3WYXA 3ZHPC 5CAQA 4UXLA 2X8IA 2ITQA 4KIKA 3R8ZA 3WF9A 3OZ6A 4CV8A 2J0IA 2CLXA 3OUKA 3UQGA 1BYGA 4EH8A 5BQ0A 3HUCA 3F3TA 3RNIA 3OS3A 4C59A 4HVSA 5C8KA 5M4CA 3R63A 3E63A 4GG7A 4JQEA 2PSQA 1FBNA 3QWKA 3Q9WA 3GBZA 3O8PA 4Q9SA 5EW9A 2FYSA 4ZSEA 4M8TA 2W1CA 3Q04A 4MBLA 3JYAA 3SW4A 4B7TA 1ZXEA 4C4EA 3RZFA 3C4XA 1FVTA 5ANKA 2GQRA 4JDHA 3TNWA 4J98A 2IJMA 4FV6A 1S9IA 4XNEA 2DQ7X 2WMWA 5EHYA 5HEZA 3GU6A 2BAJA 2R9SA 3UP2A 3NVKI 3DBQA 4EWQA 4ERWA 4DFXE 5M4FA 4FKTA 3JPVA 4L7FA 1Q4LA 5F94A 3MI9A 5CF6A 2WZJA 1YXUA 4EH7A 5M4UA 4RQVA 4B0GA 1VJYA 3VBWA 1P4FA 1UKIA 3TTIA 4FKIA 4M12A 3SD0A 5CTPA 2ITTA 4DEIA 3DOGA 5JGDA 3BQRA 2X81A 4MNEB 1XH6A 5TKDA 5HLPA 4IM3A 5IG1A 4ZS0A 4ZTSA 2WTKB 3PPKA 3ZBXA 2J0LA 5EFQA 3GT8A 1VYZA 3QGYA 3NW5A 2XJ2A 4RIYB 2O0UA 3MVJA 4ZSGA 2W4KA 3F2RA 3VO3A 2CGWA 5LVLA 4QTDA 3NRMA 4MNFA 4WT6A 4Y46A 4I6HA 1E9HA 2C0OA 5D1JA 2GS6A 5GJDA 4IFGA 2YLEA 4ANMA 1W7HA 1O6KA 1PXNA 3PG3A 3W18A 4DGNA 4OTIA 4BGHA 2C1BA 2XKCA 4GIIA 2YWVA 3CCNA 3FEGA 5CQUA 3Q96A 3ERKA 4IANA 2GS7A 1APME 3DA6A 5E8ZA 2Z7QA 4CQEA 2PL0A 3LFQA 3KEXA 5HESA 4JVGA 4FV1A 4JRVA 2C4GA 4CVAA 3AGLA 4FK3A 4RJ4A 4A9TA 1XKKA 4O0VA 5AV2A 4QMUA 3R7VA 2ITNA 2XK9A 2R3FA 5FBNC 1K3AA 2QURA 2BDWA 4W9WA 3FYKX 3NW6A 3A7JA 3ZM4A 4C4IA 4GUEA 4W8DA 1U54B 4NJ3A 4H36A 3BBTB 4UN0C 2X2LA 5CANA 4NKSA 4D2TA 3G2FA 2GHMA 4N0SA 5F1ZA 1Y8YA 2QOOA 3FMJA 4FEVA 4BFMA 5ANJA 3CKWA 2VTSA 5HOAA 2B7AA 4HPTE 2QU6A 1VR2A 2XS0A 4I22A 4NT4A 2OZAA 1Z57A 3PXYA 4JOAA 3HX4A 1U5RA 5AWMA 2FSLX 5E8SA 4GS6A 1U4DA 2B9IA 3VQUA 4IX6A 4U43A 5A4TA 1UVRA 3MY1A 4I4EA 1OKZA 5I0BA 1JKKA 3POZA 4OAVB 3QTZA 4P90A 3N4TA 2GDOA 2VTAA 3U8WA 2HK5A 3CEKA 5EW3A 4AN2A 3F2NA 3A2CA 5KKRC 4K9YA 3E5AA 4DBNA 4E20A 4RLLA 3M11A 4YBKA 1WBSA 2CKPA 4O21A 5IF1A 1WZYA 4MK0A 4ZLOA 4IAFA 3F3UA 4TWNA 3MS9A 2VTTA 5I9VA 4ZJJA 2IVUA 4M7IA 4QMYA 3DY7A 4QP2A 5A46A 3AMBA 5EYMA 1FMKA 4FTUA 4RJ6A 3OUNB 5EKOA 2ZV7A 3IDCA 4IB3A 5AV1A 3O23A 3R8UA 4J1RA 1ZRZA 3TJDA 3V8WA 2WTDA 4AOTA 1J7IA 3GCVA 4GK4A 2QQ7A 1H25A 4CQGA 2ONLC 3BELA 4O1PA 5IA5A 5E8VA 3DXNA 4BF2A 5AR3A 4CFMA 2OIBA 4ZAUA 3WF5A 3UG2A 3SGCA 3TM0A 5J1WA 4F63A 2YITA 4ZZOA 4OBQA 4BHNA 3KF4A 3WZJA 2CN5A 5ACKA 4FIHA 4ANOA 3PE2A 2CNVA 3TXOA 4M15A 3SC1A 4U97A 1S9JA 4ORKA 4FV3A 2VO7A 4I5MA 4AOIA 4Q9ZA 3NWWA 2HXQA 4H39A 2VAGA 4I0RA 3QZHA 5BVFA 3WYYA 4NTSA 3MV5A 4AA0A 2OZAB 3BHVA 1ZMVA 2QO7A 5JFWA 5AP4A 2WMQA 2WMAA 1XBBA 4FA2A 1G8SA 1KSWA 5AP3A 3D94A 5L6WL 4IX5A 2VTLA 3SW7A 3HNGA 2YEXA 3GENA 5J9LA 3GNIB 4G3DA 1XR1A 5HG5A 3HMIA 3PJ8A 4N6ZA 4EH4A 2QR7A 3GC7A 3FMHA 2JFLA 4QYGA 3FL4A 3IKAA 4FTCA 4G3EA 4S34A 3TJCA 3HA8A 2ONLA 1PXJA 3V8TA 4C36A 3JXWA 2RFDA 3KRRA 3RM6A 3ORIA 1CSNA 2ZM3A 4BCMA 1A9UA 3W2QA 5L2SA 2C5YA 5GIOE 1MUOA 4IZ7A 4E8AA 4QMQA 4BICA 4ZZNA 2XNOA 3AT3A 4GVAA 4JBVA 1ZOHA 4XV1A 4MHAA 5IU2A 5A3XA 4D9UA 4LG4A 3QTQA 5KZ0A 4BWKA 2C6LA 4G5PA 5AAFA 4KRCA 4DFLA 3A60A 5I4NA 3RAWA 2CHLA 1BI7A 4O83A 4DAWA 4R8QA 2X6DA 3D4QA 3ZO2A 2WQBA 3FQEA 4C38A 5E8XA 4HGTA 4EQMA 5JKGA 3TNIA 4O91A 3AT4A 1REJA 2VTQA 3PJ2A 1H26A 1NVQA 4MCVA 2Y4PA 4FVRA 4O84A 3C5IA 1XH5A 3BYMA 4JAIA 4ALWA 3ORLA 2NPQA 2YAAA 5FGKA 4ZJIA 2PVHA 2UW8A 4NSTA 2WOUA 5B2MA 4RWKA 5T68A 1IA9A 4FODA 4IE9A 1B39A 2UZNA 5TOZA 1MQ4A 3UZRA 3D14A 1KWPA 4JXFA 4YLJA 5DWRA 2ZMCA 4NM0A 2G2FA 4AW2A 4RIXA 3MFTA 4FSUA 3DQWA 1YDTE 3FPQA 4RPVA 3RAIA 1YDRE 3AMAA 2B52A 2BDFA 3FMMA 5IQAA 4O0YA 2WTIA 2WU7A 3PVBA 1OBGA 3VUMA 1PY5A 3KN5A 1JSUA 3VW6A 1YI4A 1ZARA 3ZU7A 5A4QA 5HO7A 3PXKA 4IZYA 3DU8A 3NCZA 3G33A 3QA0A 4K77A 3VBQA 3EFLA 4BR3A 2F7EE 1Z9XA 4F0IA 4O7YA 3NCGA 1IEPA 2YCSA 1TQPA 4NIFB 2O63A 2Q0BA 3L8SA 3ZTXA 5C9CA 5LVPA 4ITJA 2BRNA 5H8EA 5CYIA 4AE6A 1H0VA 4DN5A 2OXYA 3C0HA 3GI3A 3LMGA 4FEWA 5JMSA 4QMLA 3E62A 3QZGA 4X7QA 3TTJA 2UVXA 3QFVA 5JZJA 4D1SA 1YWNA 1ZAOA 3GU7A 3FXWA 3ZEWA 3TNPC 4BKYA 4M84A 3PIYA 4ZMFA 2J90A 4BL1A 2IVVA 3SVVA 4BKJA 4Q2AA
chains in the Genus database with same CATH superfamily
2A4LA 2YZLA 4NH1A 4CT1A 3DDPA 5FEDA 4CV9A 3UMXA 2BIKB 3ZUUA 5HE1A 4G6LA 5HVKA 1NT2A 4AZFA 3MIYA 3KXGA 4J97A 4FKLA 3LMHA 1DAWA 2XB7A 4C37A 2VTIA 3O71A 5HBHA 5IA4A 4DF3A 3R6XA 5C01A 4JG6A 3P78A 4AG8A 2OIQA 2XUUA 3DS6A 2YIRA 5FEEA 4QMOA 5E1SA 3PWYA 2R3NA 3QLFA 4TPTA 3E3PA 3R0TA 2BFXA 3SOAA 4AZEA 4D1XA 4CLJA 3OD6X 3VUDA 3DBFA 2WQOA 3VJNA 4AN9A 2GNFA 3PA3A 2CLQA 4ACDA 4PDYA 1H1PA 2C0IA 2UV2A 4DGLC 5JFXA 4ANNA 1WVWA 4LUEA 4ZTQA 4JJRA 3ROCA 1X8BA 2W06A 4AFEA 5AUVA 4EH9A 2OZOA 4C61A 3KVXA 5JN2A 2IN6A 4FL2A 2R3QA 1Q99A 4BIBA 5IKWA 2WTCA 4O7LA 2WNTA 3LKMA 3ACJA 4FSTA 4PTEA 4HJOA 4IB0A 3GCPA 3L8VA 3QUEA 3UOJA 3AGMA 3VHKA 3D2IA 3RCJA 1LR4A 2YA9A 1OL2A 4NCTC 3TG1A 4ZLZA 4L45A 2JKOA 4KD1A 3QTXA 3QTWA 3D7TA 3OF0A 4KA3A 4TYGA 4BCOA 3QCSA 1OPJA 4I94A 3ZZEA 3PYYA 5M07A 2PWLA 2ACXA 5KE0A 4OTQA 2E9NA 4JR7A 1WBTA 3PLSA 5HU9A 3ZM9A 2QOKA 2YACA 2RIOA 3BKBA 3B8RA 3QX2A 3ACKA 4X6QC 5ICPA 1PRYA 2BR1A 1DI9A 2WFYA 3QRJA 4R7HA 4EHEA 3B8QA 4RC4A 4Q5EA 1OUYA 3OTVA 4C2VA 2BZHB 3I0QA 3MH1A 4EK6A 2H96A 2UVZA 4PMPA 4W4VA 3DBCA 2JIVA 3I6WA 4HCUA 3U9CA 4N4SA 3FXZA 4DH5A 1J7UA 2X6EA 2X0GA 4PV0A 2BRMA 4FTJA 4EK5A 4O38A 5GJGA 4EC9A 2AQXA 4II5A 1PXMA 5J7BA 3EN4A 1YW2A 2YIQA 3IQ7A 2P33A 3O51A 3HZTA 2VWXA 5AUZA 3R7EA 5LARA 3QUPA 4UV0A 4DTKA 3MVHA 3OBJA 3MH0A 4GL9A 3IGGA 4YC6A 2XM8A 1GJOA 3RBWA 4ZTRA 4IZAA 3R7UA 5CLPA 3ORKA 3FLNC 5FP6A 1UV5A 4M67A 2IEWA 5CSHA 3BGQA 4FSZA 2XK8A 5LWMA 4UBAA 5IQCA 4IC8A 2ETMA 3FYJX 4ANLA 2OIDA 1WBPA 2AYPA 5H8BA 4EWHA 2VU3A 3UBDA 1VYWA 4IAIA 5EOLA 2UZWE 2B55A 2PZPA 4WSYA 3R83A 3OCTA 3GXLA 4FKGA 5AUWA 3PG1A 4GT5A 4PPCA 3C4EA 4C2WA 3LFCA 4RX7A 4USFA 3R01A 3QKMA 5FQDC 3QGWA 4KNBA 4AS0A 3R7YA 2RFEA 1QPJA 4FOCA 4XP2A 4FZAB 1PKGA 4FV5A 4BRXA 4Y5HA 5H9BA 1RDQE 3TUBA 4ITIA 4DG3E 4H1MA 4EOJA 1ZWSA 3UVPA 4RT7A 4LFIA 2C68A 5HI2A 4J53A 5AJQA 3ODZX 2RFNA 3CTHA 4GMYA 1UNGA 4O0XA 4IWDA 3E8CA 4KIKB 4QD6A 3Q5IA 2G2HA 3LFEA 4U42A 4G6OA 4JG8A 3QRKA 3P1AA 4FNYA 5HE3A 4GFMA 5KX8A 4I6BA 1W84A 1XQZA 2JDOA 2CPKE 3OCBA 2FGIA 4L8MA 4YPDA 3ZLXA 4DE4A 3WBLA 3QCYA 4FTOA 5EH0A 1ZY5A 1Y8GA 2X2KA 2HAKA 3NSZA 5DYJA 1Z5MA 1OZ1A 5DEYA 2YISA 3DAKA 3MA6A 4XP0A 1VZOA 5AP0A 5IQFA 2PE0A 4C3FA 4X3FA 3CE3A 4CLIA 3KC3A 5D7VA 3GB2A 3ZRLA 2BZKB 3D5XA 2CGVA 4RWLA 4GT3A 2OFUA 4L53A 4V05A 2WELA 4MWHA 3TEIA 2XMYA 5DA3A 3QD3A 3SDJA 5FEQA 2Z7RA 5GNKA 1OUKA 3O8UA 3LCTA 3VF8A 4CFNA 3LXPA 4EQUA 2R3RA 3UIMA 4CGAA 3SAYA 5IDPA 3EQPA 4CSVA 4O4DA 2X4ZA 1H1WA 1NXKA 2WTVA 2YDKA 4MD9E 4QO9A 3W32A 3QZFA 3KF7A 3R8PA 2GFCA 3NPCA 1AGWA 4WIHA 1JKLA 2OBJA 4XV3A 3FLWA 1QPEA 3TNQB 3DK7A 3EZRA 5HBJA 1ST4A 4BDKA 3R71A 1JAMA 3V51A 3UVRA 4RFMA 2WXVA 3DAJA 4JL9A 4HGLA 4NM7A 2QG5A 4OR5A 3IPHA 3A62A 4C33A 4RFYA 2PMOX 4EZ5A 3KRWA 3R00A 5CZIA 2VWZA 3TV4A 4ARKA 1F5QA 4O0SA 4FTMA 4HGSA 5CF4A 4CG9A 4L3LA 3RJCA 4GRBA 5AA9A 3S1HA 3BRBA 3KULA 3BU3A 2VWIA 3QD2B 1MRYA 3H30A 4U79A 5EDQA 4FTQA 4YUQA 2GQSA 4QT1A 5GINE 4DG0E 2XKDA 3R8MA 3U6IA 1LEZA 3PWDA 4XG4A 5CAUA 4YTHA 4AT4A 3TKIA 2YM8A 5HKMA 2RL5A 5EM6A 1Q3WA 2WMTA 5BUJA 4G6NA 3Q52A 3HV7A 4HGEA 3V6RA 4L42A 2ZB1A 3HMMA 4E5WA 4EI4A 3WIKA 4FSMA 5E91A 4EZ3A 3EYHA 3N51A 3SRVA 4X6RA 5A6OA 2IZTA 4WG4A 3F3WA 4K33A 3WI6A 3CR0A 4IIRA 4YJUA 4ZLYA 2ZM4A 4QPMA 3PIZA 3FXXA 5CSWA 1R1WA 3Q4TA 2BHHA 3JS2A 4M0ZA 2XA4A 4BDFA 2C5OA 5IUGA 4ACMA 5K0KA 3PZHA 4AGDA 2BILB 4DH3A 4I6LA 2G01A 4TYIA 4D9TA 2QODA 3GCSA 4IM2A 3LXNA 3MYGA 1Q24A 3CKXA 1YHVA 2WMUA 4BCPA 5AV3A 2AEGA 3VS6A 2PE1A 4MVFA 4BCQA 3UDTA 2X7GA 3CC6A 4G3FA 3DZOA 2YJRA 4DGMA 2IG7A 2Z60A 3OHTA 4E1ZA 4D4VA 2YZAA 4EOSA 3P7AA 1ST0A 3BV2A 3Q9ZA 2OO8X 4G9CA 5LMAA 4ASDA 3RHKA 2XKFA 3TNHA 3QQGA 2W1FA 3MJ1A 4BZNA 4KIPA 4RJ3A 2BMCA 1OIQA 3QL8A 3WIGA 4QTBA 3R28A 4R6VA 5K9IA 2VTHA 2B0QA 2NP8A 2R7IA 2W1EA 4PTCA 5H8GA 5BMSA 3BGZA 5HCXA 4MQ2A 2JIIA 5AMNA 3HAVA 3JUHA 4P5QA 1KV2A 3MFSA 4TNDA 1GZNA 3UNKA 4O7RA 5HVJA 3EQHA 1G5SA 4QDEA 1RQQA 2JGZA 4L43A 4YPSA 1SVGA 5I9UA 4QP9A 2CMWA 2OSCA 3ZH8A 3KRXA 1KE9A 5J79A 4W4YA 3GU5A 1Y6AA 5DI1A 3ZXZA 5M09A 2A2AA 2G1TA 3F7ZA 4AXAA 4V0GA 5CVFA 2YM4A 4D4SA 4JT3A 5JGAA 2HIWA 2HZ4A 1SZMA 2H8HA 3D0EA 5DEWA 2CGXA 4BVUA 1FGIA 2GHLA 4IB1A 1K2PA 3K5UA 3PE1A 2ERKA 2P2IA 5C8NA 4DT9A 3GGFA 4YR8A 2ZOQA 4EOOA 3VJOA 2C3KA 3I79A 3IONA 1OIUA 1UA2A 4RSSA 4IJ9A 4DHFA 2ITWA 4R7IA 4ONAA 1Y91A 4WUAA 5HTIA 1F0QA 3QTUA 5IA2A 2YM6A 4O86A 2G9XA 3BLAA 2PULA 4ZSLA 4YJVA 4TYHA 4D0WA 4ZTNA 4FG7A 3Q6UA 2XAMA 2EXMA 3QRIA 4NUSA 2B9JA 4OT6A 1JQHA 3Q4ZA 2QLQA 3V3VA 4J8MA 3UDSA 2OJ9A 4F9AA 5EQEA 2YHVA 5CNOA 3GFWA 3IO7A 3PY0A 1H01A 4ITHA 3QC9A 3BX5A 4BDGA 5LJJA 4EHZA 3RPOA 4U80A 1QCFA 1YXSA 5CXZA 4LGHA 3F5GA 3GUBA 3LFSA 5B0XA 5FM3A 4O4BB 4PMSA 4D58A 4R5YA 2R64A 1K9AA 2JIUA 3NUUA 3TZ8A 1MP8A 3CQWA 4ZJVA 4QYHA 4L52A 4O4FA 4I1ZA 4NL0A 3UZPA 5CALA 2HENA 3DB6A 5J1VA 4MD8E 4QMNA 4ANQA 4FMQA 1L3RE 1UU3A 2VTRA 4KKHA 4DG2E 4D0XA 2WMBA 4FNZA 4R5SA 3DKFA 2VWUA 4O2PA 4TW9A 1JBPE 5CU3A 4BC6A 3JY9A 4DCAA 4C4JA 3SKCA 4PMMA 2X9FA 3UQFA 2WKMA 3EQCA 3FZ1A 4QNYA 4LL5A 4O6EA 3H3CA 5H2UA 3FMNA 3ZSIA 2OLCA 4XX9A 4EJ7A 4EK3A 4YC8A 2Z7SA 3R9RA 3D5WA 5EI2A 4G34A 2B54A 4BTFA 3TKHA 1UNHA 3RI1A 3LFAA 1SYKA 4NFNA 4J96A 4AGWA 3R9HA 4FKPA 3KMMA 4BB4A 3PY1A 5C4KA 2ITVA 4S31A 2RKUA 3FWQA 4DLJA 4GKIA 3NUXA 2Y6OA 5JQ5A 2X8EA 3KMUA 4C02A 1PW2A 2XIKA 4YJOA 1OL7A 4EQCA 3ATSA 3A7IA 1LEWA 2BZIB 4D4YA 4DH1A 3UMWA 1XBCA 2XF0A 4OW8A 3EQRA 4MXAA 3EB0A 3VS2A 2WHBA 3VC4A 2RF9A 3GP0A 4K8AA 4DITA 2XNPA 1QPCA 3QQJA 5C4LA 5DGZA 2PVRA 2OW3A 4L3JA 3G0FA 4OTWA 3VIDA 4D2RA 2PUUA 2I0EA 1UNLA 4WRGA 4FV9A 4LRKA 5F20A 3W8LA 3FZRA 5IA3A 5J7HA 4H58A 3C0IA 3DTCA 3OCSA 4EBVA 1H4LA 2BFYA 3MGYA 5EM8A 2C3JA 2VO6A 4JAJA 3FLSA 3OWLA 4LOQA 3O50A 4E4MA 3KREA 3LQ3A 4IH8A 2Y4IC 3HVCA 2J2IB 3ZLYA 1YWRA 3Q60A 4I41A 3QTIA 3U9NA 3V5QA 4F9WA 2O8YA 3H9OA 5DT4A 1GIHA 4MWIA 4QMPA 3S4QA 5GZAA 1PMNA 2X7FA 2PVMA 3MTFA 4NK9A 4X3FC 4NM3A 3UZTA 3CD3A 4O82A 2XVDA 3MDYA 3TUDA 4AUAA 5CI6A 3L1SA 3U6JA 5A4LA 5HCZA 1YI6A 4C8BA 5AEPA 4UEUA 4CZUA 2PYWA 1XH8A 4IADA 5B2KA 4JIKA 3ZDIA 4BDEA 1ATPE 2F4JA 4IAAA 4L67A 5DRBA 4EJNA 4XEYA 1FVVA 3BYOA 4AW1A 4DFNA 4DFYA 5AAEA 2HWPA 5IUHA 3DNEA 1WBWA 2BTRA 4LOPA 3BEAA 4JDIA 4USEA 3W0OA 5DPVA 3W1FA 1TKIA 2UZTA 4B8LA 1Q61A 4BCIA 4FSQA 3E92A 2IW8A 1OKWA 3FY2A 3BHYA 3L9MA 4FKUA 5EDPA 2XKEA 5H3QA 4LDTA 2OK1A 2VNYA 4CNHA 2Q0NA 4IAYA 4O27B 4UMTA 2R3OA 3GC8A 3EQBA 4I92A 4FIFA 2R4BA 2JDTA 1L8TA 4WG3A 2BAKA 4FZ7A 2EXEA 1NW1A 4RWIA 1I44A 5GZ9A 5HHWA 4XG7A 1PXKA 3IDBA 1IR3A 4ZTLA 4D1ZA 5IA1A 3KRLA 2WQMA 3POOA 5DLSA 1OB3A 4LMNA 4QDVA 1PMEA 2CNQA 5TE0A 4RIWB 2PZIA 3IOKA 4NU1A 3MESA 2BROA 1H1QA 4HNFA 1PF8A 4JDKA 5IEVA 5J87A 3LPBA 4MD7E 4RJ8A 3ALOA 2PU8A 1FINA 3BU6A 4NKAA 4S33A 4EYJA 5HD7A 4YO4A 4F1TA 4R7BA 2QOQA 1GAGA 5KHWA 4YHFA 4V04A 4O7SA 1NVRA 3BWFA 4P4CA 2C0TA 4MF1A 4MXXA 5ETAA 3W55A 4CKIA 1W2DA 3P7BA 4CRSA 2NYAA 3HA6A 4GCJA 4MAOA 4CD0A 1REKA 2J0MB 2RSVA 3W33A 4F6WA 4FTAA 4AQCA 3BE9A 2PUIA 2HOGA 3TACA 4CTCA 3ZC6A 1UU8A 5IQDA 3QCQA 3UOHA 2B1PA 1YQJA 3GVUA 4IJPA 4U6RA 4J99A 4O0UA 1PJKA 3QALE 4RLKA 4TWOA 3BHHA 4XG2A 4XLIA 4YBJA 4BCGA 4IVCA 2A98A 4C0TA 1UKHA 3ROYA 3SXFA 5KMKA 3R7GA 4C7TA 3GCUA 3OC1A 3E3BX 5FXRA 3MH3A 3A4OX 3HMOA 4L01A 4EYMA 1J91A 1WFCA 2BAQA 4RX9A 3E8DA 1YHWA 2WTWA 2XK7A 5AP1A 3DXPA 2XNEA 3EMGA 4LV8A 3WF6A 4MEDA 3TT0A 4R3CA 2W9ZB 3BYUA 3V5WA 5LMKA 1P14A 4FZFB 3CXWA 4ZTHA 4NCTA 3WZKA 5C8MA 5IH5A 3F82A 5BVOA 3W0QA 3EQDA 1J3HA 3KXHA 5CU2A 3VS3A 4DGOA 3PDTA 3CQEA 1JKTA 2E9PA 5F95A 5HQ0A 5BYLA 4H05A 4HZRA 5KHXA 2BDJA 4YTCA 4KRDA 4BJJB 4A4OA 3L8XA 2BUJA 4MXOA 5M44A 3IW7A 2Q83A 4RQKA 4TL0A 4LOOA 2PMNX 1M52A 2J9MA 1GY3A 2AUHA 3C0GA 5F4NA 1H24A 4GSBA 1QPDA 3CSVA 4E3CA 4JG7A 4OBPA 4F99A 3P5JC 4ZSJA 1UWHA 4RVTA 3SLSA 4DTBA 4G9RA 3EWHA 1PYXA 4RVKA 4A4LA 5KKRB 4W4XA 4Z9LA 3ZS5A 2B4SB 4KUJA 2JAVA 2PVLA 3R30A 3RAHA 3VQHA 4PPBA 3TV6A 4ENYA 3RHXA 2XALA 4QP1A 1RE8A 3BWJA 4BCKA 1GOLA 2CJMA 4KIQA 3OEZA 4ACCA 2VZ6A 2XBAA 1H28A 5FD2A 2QHMA 5EYCA 2HZNA 5DT3A 4P5ZA 3R7OA 4FGBA 2JKKA 1FMOE 4BIDA 3ZUTA 2ERZE 4L3PA 3HDNA 4QQCA 2IZRA 4XBUA 3EFWA 4WNOA 1P2AA 5BYYA 3PP1A 2JDSA 2Z2WA 4BDAA 4EOMA 1M7QA 2PK9A 3CQUA 3QQFA 1Q97A 3NR9A 4DGGA 1URCA 2CGUA 4KSPA 2QOLA 4XUFA 1PMUA 2VGOA 1V1KA 3EQFA 3KCKA 4XV2A 2WAJA 3EIDA 3VBTA 4OGRA 4JMQA 3UTOA 3VS4A 4MXZA 2WO6A 2XRWA 3EFJA 2PMLX 2XAOA 3W16A 1H07A 3Q6WA 4MXYA 4YJTA 3O96A 3VRYA 3ZSGA 4APCA 5DMZA 4QMTA 2OJJA 4QPAA 3FC1X 3FJQE 5KNJA 3WILA 5E8TA 3A4PA 3UDBA 3RM7A 2QCSA 2J5FA 3FLQA 2J6MA 5D11A 2ITXA 4MX9A 3S0OA 3VBYA 2R0IA 2XANA 3CGFA 4YZMA 1H1SA 2DWBA 3LFDA 4GFOA 4AE9A 4Y8DA 4F7LA 4EOPA 1PXLA 3AD5A 4XG6A 4BBMA 3Q3BA 2F2UA 4JLCA 4RVLA 5IEXA 2UW5A 3W10A 1SMHA 4NW5A 5BNJA 3IK3A 4JNWA 3PLAE 3P4KA 4RJ7A 1KOBA 2F2CB 4AZWA 5LMKC 2LGCA 3FLYA 4CMTA 2P0CA 3CPBA 5J8IA 3FC2A 4YP8A 4EBWA 4AXDA 4XHKB 1LPUA 2AC5A 3P23A 2XRUA 2V5QA 4ALUA 2HELA 3QTSA 5IA0A 2R3GA 4FV2A 3KXMA 3D5UA 4ANSA 5F9EA 5BV3A 3W2CA 3R8VA 1JVPP 3H10A 3P5KA 2B53A 3MSSA 2YLFA 4FIJA 3U6HA 3EN7A 4I5PA 3SG9A 4ZIMA 4CYIA 4N6YA 5K5XA 5FBOA 3I1AA 4Y5QA 3MBLA 2BVAA 4AXCA 3L9PA 5J5TA 1ZOGA 4X3JA 4XOZA 5DNRA 5A4EA 5L2IA 4LQMA 1RJBA 3A61A 2GNGA 1Q8TA 1PHKA 3R2BA 4EH5A 4R1VA 4LGDA 4AU8A 1GNGA 3F2AA 4NFMA 3A8XA 4XH6A 3F66A 4TYJA 3ZO1A 1CKIA 4YLLA 1PKDA 2W1DA 3COMA 3TZMA 2VV9A 4E26A 2YCFA 2ZV2A 2XCKA 4WNMA 4UY9A 4BIEA 2CCHA 4UWYA 4TNBA 1Q8ZA 2PMIA 4GG5A 4WG5A 1Q3DA 4YHJA 1KE7A 4LL0A 4RGJA 4YJSA 4Z16A 5IPJA 1SNXA 4B6LA 4IWPA 1YVJA 4PDPA 4UXQA 5HNIX 3BIZA 4IBMA 2REIA 5ACBC 3G0EA 3RK7A 4F6SA 4UZDA 4JBPA 3BE2A 4KKEA 3R73A 3COHA 3CIKA 3QBNA 4WKQA 3RPVA 5CEMA 2ITOA 4FUXA 4EZ7A 5EW8A 4IDTA 3FHIA 3UQCA 2VUWA 3KK9A 2CSNA 4ZTMA 2ETRA 5IDNA 3ZONA 3LOKA 5CVGA 3QX4A 3BGPA 4QP4A 3MA3A 3BHUA 4GJ2A 4S30A 3QKKA 3U4WA 3LCDA 3ODYX 4S2ZA 5HICA 2OFVA 2QOCA 1GZ8A 1OL6A 3AD6A 4RX8A 5LQFA 4FG9A 1O6LA 4GW8A 5FWKK 1V0OA 4ACGA 4RZVA 2Y8OA 5M55A 3ZLWA 3U4UA 1IRKA 1CTPE 2W17A 3CS9A 2WQEA 5CU4A 3ZDUA 3UO4A 4FNXA 2QR8A 3ENMA 4I20A 5FXQA 3FI3A 3LLAA 4RA5A 4E4NA 4F65A 1BL6A 2CN8A 4OT5A 4C34A 3BYSA 4IACA 3DNDA 4WRSA 3UC4A 2HZ0A 2VTPA 4OUCA 4IHPA 2HY81 1R39A 4X2NA 4G17A 3ZRKA 5JK3A 4F7SA 3PJ1A 2CDZA 3QQLA 3TZ9A 3EN5A 4F78A 2V7AA 3AKLA 2C47A 3T3VA 2OJIA 3CY3A 3FKOA 5CT7A 2PTKA 3NUNA 2ETKA 4GJ3A 2VNWA 5HNBA 2FSMX 3FQHA 3Q4CA 3BBWA 3OY3A 1UU7A 3NFFB 5LXMA 1BLXA 3L9LA 4BHZA 1WBOA 1OMWA 3HRCA 4OTFA 5TR6A 4DH7A 5J95A 4F08A 4PNKA 2F49A 1U59A 3AMYA 5HGIA 4D2VA 4IB5A 2IPXA 5EHLA 3NZ0A 3NS9A 3MTLA 3WF8A 4AAAA 4IMYA 3OW3A 4ANBA 4UMPA 2W5BA 5CY3A 5FUTA 2ZV9A 3D2KA 3I81A 4IWOA 4PY1A 3ZFMA 3DBEA 4PRJA 4BWXA 4RA4A 5HTBA 5IH4A 3ZO4A 3FUPA 1OITA 5TF9A 5CU0A 3DLSA 3HAMA 4ID7A 5CF5A 3QRUA 5LVOA 2GPHA 2JFMA 4EHGA 3HP5A 5IMXA 3DLZA 1XH7A 2FVDA 1H8FA 2WD1A 1YOJA 2OH0E 2W1HA 3BI6A 3ENHA 3FZSA 3LE6A 4JRNA 4ZZMA 3RGFA 5JGBA 4CG8A 2VTMA 3C50A 3ORMA 3ET7A 4IDVA 3HLLA 5CASA 4MXCA 4KBAA 3ZRMA 4W8EA 1BMKA 3MVLA 4PPAA 5GJFA 2I7QA 1Q8WA 4K1BA 2UZUE 2X8DA 4OTHA 4PF4A 5AV0A 5IUIA 3HDMA 5L3AA 3A8WA 2BIYA 3E8NA 4N70A 3ITZA 2VX0A 3RPSA 5AX9A 3GOKA 3S00A 5EYDA 3QD0A 2WQNA 4PX6A 4U9AA 2VTJA 3EJ1A 3GFEA 4YSMA 3WE4A 3W0SA 2YDIA 3MN3A 3MVMA 2C6DA 4R3PA 3DT1A 4H3BA 3S2PA 3Q9YA 3ID6C 4UMUA 3IOPA 3SG8A 1WVYA 3E88A 2JKQA 2JBPA 3Q9XA 1XJDA 2R0UA 4E7WA 4EH6A 5A54A 4AXEA 2UW9A 4HYUA 3RNYA 4RX5A 1DM2A 4RWJA 4HOKA 1OGYA 4TWCA 1BI8A 2ZVAA 3I6UA 3CP9A 2YWPA 4CFWA 4FL1A 3LCKA 4ZK5A 1OIRA 2UZBA 3ZUVA 5GZ8A 4EK8A 2XK4A 4QMZA 2FUMA 3THBA 2WU6A 4L68A 4X2FA 4QQ5A 3NNVA 5CT0A 2W05A 3UOLA 4HVHA 4UX9A 4A06A 3DKGA 3NYXA 2ZM1A 4FT9A 5G6VA 3ZBFA 5L4QA 2E9VA 1JPAA 3I7CA 2ZB0A 2VWYA 4Z55A 3KL8A 4APPA 2QOIA 3NYNA 1J7LA 3E87A 2BTSA 4AT5A 4ASXA 4V0GB 2OU7A 4Y72A 3GEQA 5IZFA 2QI8A 2C5NA 1DS5A 5T6KA 1ZY4A 4JBOA 4D2SA 2RG6A 4P2KA 2BRBA 3KXNA 3OP5A 4F7JA 5L8LA 1YRPA 2OG8A 4BDBA 3DZQA 5FDPA 5JFVA 4HYSA 4TN6A 4TWPA 3OXZA 1H08A 5E8WA 4EH3A 4IW0A 5CU6A 5FTGA 2H9VA 3LFBA 2HCKA 3AC1A 4QP8A 4UMRA 1SVEA 5AP7A 4YSJA 3DXQA 4DEAA 4IXPA 2WEIA 3NAXA 2C6OA 4CFFA 4GK2A 5G1XA 5E4HA 3OEFX 3N9XA 4F1OA 3EFKA 1KE8A 3NIEA 3DKOA 1PXPA 5CEPA 4L00A 4UMQA 2PVJA 2CCIA 5I9XA 2BZJA 3PA4A 5EM7A 1ZMUA 4C4GA 4KS7A 2E9OA 4LM5A 2WTKC 2YCRA 3I7BA 4NM5A 5CX9A 3OTUA 3RAKA 3OBGA 4PDSA 1YI3A 4O2ZA 3IW8A 2PUNA 4FT0A 3O5AA 2IF8A 2PVNA 4CTBA 1TZDA 1FQ1B 2VX3A 2RFSA 4FV8A 2XZSA 4FZDB 3SV0A 5A14A 1U46A 2UW6A 3T3UA 5KBRA 4DDIA 4PDOA 5E1EA 4RBLA 3PVUA 4F09A 4CZYB 4FBXA 2WIPA 3O17A 3FZTA 5LWNA 2NRUA 4FI1A 4F9BA 3TDVA 5HG9A 4YZCA 3R1QA 3FKNA 2X39A 2UVYA 3GQIA 3TUCA 3W2RA 3COIA 4O7ZA 5AP2A 1PMVA 2QOBA 3BEGA 4PUZA 3SXRA 2Z02A 4RIWA 3ORNA 5LOHA 1M17A 4X21A 4ZXTA 4LRMA 2IW9A 4DCEA 2QC6A 2A19B 4XOYA 1JNKA 4FSWA 5IQIA 2I0VA 2XH5A 3UJGA 4BTMA 4ZY4A 4IWQA 4L44A 3OROA 4EEVA 1OECA 4F0FA 5K4JA 4AQKA 3LJ0A 2OJFE 4FT5A 3VS7A 5HNGA 3BZ3A 3OY1A 5AR7A 5ANDA 2AC3A 3HEGA 4F7NA 3SX9A 5B7VA 3Q2JA 2F57A 2JC6A 2YDJA 3LCOA 4FT7A 4QTAA 1XWSA 2IZUA 4FRFA 4AGUA 2OXDA 4LRJA 2C6TA 4FE2A 2IVSA 1H27A 3F3VA 3KMWA 4NTTA 5D10A 3PXRA 5DHJA 5LMBA 2PZRA 3LIJA 4YNEA 4RIYA 4E4LA 5AUXA 4AZTA 4FT3A 4XV9A 4AN3A 2BKKA 5A9UA 4XS2A 4B9DA 4WNKA 3WZDA 3ZZWA 4FTTA 2Y4IB 3R8LA 4J7BA 3O0GA 5EI8A 5CS6A 1T46A 2WMXA 3F61A 3G9LX 3DDQA 3DJ6A 3LXKA 3KU2A 4XCUA 1U54A 5HIBA 4I5HA 4I0SA 5E8UA 2YIWA 3FE3A 3W2OA 4QQJA 4DEEA 1FGKA 4PMTA 2XJ1A 5M51A 4BI1A 4DYMA 2UZDA 1OKVA 3LQ5A 2G15A 4BI2A 4I93A 5DR6A 1XMMA 2PUPA 3TDWA 3AXWA 4LGGA 3NAYA 2C6KA 4AOJA 5KUPA 2NO3A 3ORZA 3PP0A 4D55A 1E1VA 4FSYA 3UO6A 2PVKA 3CLYA 3DQXA 3NYOA 3OT8A 3BCEA 4FTIA 4MYGA 2R3JA 3V5JA 1UU9A 4OTGA 5HLWA 2X0OA 4YO6A 3FLZA 5K3YA 4C57A 4ZSAA 1B6CB 2IO6A 4JS8A 3RK9A 2V7OA 1MQBA 4YHTA 3AKKA 3ETAA 4E4XA 3FY0A 4E5AX 2GNLA 2X0PA 5HVYA 3TIYA 3U55A 4FZ6A 4TXCA 4YGAA 3VW8A 2C3IB 5AIKA 3FZPA 3VN9A 4G5JA 3PY3A 3BV3A 3AG9A 2WIHA 3I0OA 3CGOA 5L2TA 3UGCA 5BX0A 3LFNA 2Z8CA 4EOKA 2XEYA 3QRTA 5M56A 4YMJ