5LIPA

Pseudomonas lipase complexed with rc-(rp, sp)-1,2-dioctylcarbamoylglycero-3-o-octylphosphonate
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
320
structure length
320
Chain Sequence
ADNYAATRYPIILVHGLTGTDKYAGVLEYWYGIQEDLQQRGATVYVANLSGFQSDDGPNGRGEQLLAYVKTVLAATGATKVNLVGHSQGGLTSRYVAAVAPDLVASVTTIGTPHRGSEFADFVQGVLAYDPTGLSSTVIAAFVNVFGILTSSSNNTNQDALAALKTLTTAQAATYNQNYPSAGLGAPGSCQTGAPTETVGGNTHLLYSWAGTAIQPTISVFGVTGATDTSTIPLVDPANALDPSTLALFGTGTVMVNRGSGQNDGVVSKCSALYGQVLSTSYKWNHLDEINQLLGVRGANAEDPVAVIRTHANRLKLAGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the chiral selectivity of Pseudomonas cepacia lipase
pubmed doi rcsb
source organism Burkholderia cepacia
molecule tags Lipase
molecule keywords TRIACYL-GLYCEROL HYDROLASE
total genus 114
structure length 320
sequence length 320
ec nomenclature ec 3.1.1.3: Triacylglycerol lipase.
pdb deposition date 1997-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5lipA00
1IUPA 1N8SA 5CT6A 2WTNA 2BUCA 1CUJA 4ARAA 1M33A 1BEEA 3VJLA 2GYVA 4J3JA 1U2EA 4HRXA 4P93A 5LIPA 2R11A 1Y37A 3ZV7A 4E46A 3PE6A 2OGTA 2VQ6A 1EHYA 2XQKA 5AIBA 3IULA 1EI9A 3FSGA 4BVKA 2FJPA 1ZGBA 2ZJFA 2WLSA 3O4IA 5CMLA 3C87A 4N8DA 3DD5A 3I2HA 3HRHA 2FJ0A 5K3DA 3WK9A 4XX1A 5JYCA 3PICA 4UHCA 2XMDA 5A6VA 1QTRA 1CUWA 4FLFA 3ICWA 2Z8ZA 5DJ5A 4H35A 2PKYX 4MQMA 2BUBA 4H7EA 2QOEA 2JGFA 2PPLA 1XQWA 1E3QA 5K3FA 1DWPA 1MAAA 2O2GA 2XUFA 1UK7A 3DL4A 1FFCA 4L3WA 5FP0A 2I78A 1YASA 4C4XA 1DQYA 1VOTA 3AZPA 4BC1A 5ALKA 2O7RA 2WQZA 2GBCA 1LZKA 2D5LA 5ALIA 5D6OA 1W76A 3VXKA 4CCYB 4K6GA 4MYSA 4EY4A 4AO7A 1DT3A 4L9AA 4LYEA 2XMZA 1S8OA 2YXPX 1QZ3A 1N1MA 2WKWA 1GZ7A 3FVRA 2GBIA 3FWHA 3F97A 5I9IA 4BP8A 2WHQA 2XLBA 1F0NA 4LXHA 4N5HX 4WCVA 3ZWQA 2ZYIA 4FOLA 2OGSA 1BCSA 2BKLA 1LPAB 2RAUA 3WWDA 1G66A 3OPMA 3FCYA 5FOQA 4B7ZA 1Q0ZA 5HQ3A 1GQRA 4CG2A 2VJBA 1BS9A 3WKDA 2H1IA 4U2FA 4BCDA 2ZYRA 3P2MA 1MX9A 2HRQA 3ED1A 5T4HA 3PUIA 4JYMA 1THTA 1U65A 5K5EA 4F21A 2QXUA 2HA2A 1XRQA 2OGZA 5ALTA 1CEXA 2GBGA 3R3YA 1G42A 1AKNA 4MXDA 4GHWA 3EQ7A 3QBJA 5J3JA 4X6UA 5JANA 3H2JA 4Y2JA 3M3DA 3UUFA 1K63A 1EB8A 3G9XA 1IZ8A 5HFAA 3R3UA 5AKKA 5LYYA 3ESDA 4U2BA 4Y2UA 3FBWA 4DSZA 3UUEA 5EI5A 4HS9A 2HRRA 2WIFA 3PFCA 2PU7A 4B83A 3W04A 4BE9A 3E0XA 4OPMA 5AICA 3KSRA 2PUJA 1QGED 4B80A 4UBOA 1EDDA 4J03A 1UK8A 4YK7A 1ODTC 2OQIA 5DYWA 4DNPA 4FBMA 3QMWA 1XZHA 4L0CA 4B82A 1AMNA 3JYHA 3WKAA 4AO6A 1MN6A 1XQYA 3WZMA 3BF7A 1TRHA 2XLCA 2QXTA 5EIAA 1MO2A 5FPQA 4Y9SA 2VSQA 5A7FA 1MX1A 1DQZA 5ALZA 1RP1A 2PM8A 5CTAA 3EF3A 3WQHA 2WTMA 5AM5A 4FLMA 3H17A 1CUFA 2HA3A 1UWCA 2Y2VA 4DNQA 4XIIA 4H77A 3G8YA 2JEYA 3AZQA 2AJ8A 1KU0A 2C5FA 1XQVA 3R3XA 3A2MA 2JGEA 2O7VA 3KWFA 2CMFA 5IKXA 1XZJA 1EDEA 3WKCA 2JBWA 3L1JA 4FKBA 4XJVA 2XUHA 4JNCA 2XUKA 2V98A 3LCRA 5AIAA 3QM1A 4OU5A 4KJXA 1VE7A 5ALYA 1YB6A 3WK4A 4Y2YA 1A8QA 5CT8A 1QIFA 3EQ8A 4AN0A 3HZOA 3DNMA 4RE6A 1WB6A 1ZI6A 1EK2A 4ZRDA 2PL5A 3BIXA 1R9MA 1XZCA 4Q3KA 1CUGA 1HBJA 4K2AA 5JAHA 4HVTA 3BF8A 1WHSA 4Y2QA 4BRSA 5ALVA 3F96A 2VTVA 5AI8A 5ALPA 3DCNA 1AC5A 3WL5A 3BJRA 4FNMA 2GYWA 3DLTA 1XRNA 2XMGA 6YASA 3SK0A 2HA7A 1JJFA 1H2YA 4J0GA 3M82A 3ZLUA 3IBTA 4HXEB 1UFOA 2B4KA 5C7YA 1YR2A 1CUSA 3WZLA 3E1GA 5AP9A 5KBYA 4G8DA 5JZ9A 1MJ5A 3FSGD 2G63A 4NS4A 4LXGA 3C6BA 3BDVA 5HF5A 2LIPA 4E14A 1HQDA 3WKBA 4BVLA 4K6HA 2HA6A 5LZ9A 1VA5A 3DDUA 4KAJA 2I03A 4FFWA 3W05A 1CUEA 2D0DA 5JD5A 5AOAA 1XZFA 5AKJA 4ZV9A 2OCKA 2WILA 4WFJA 4RGYA 2ZSIA 3CCCA 4WJLA 4XVCA 2JIDA 4Y2TA 3DL7A 2EEPA 5HK8A 4BYMA 2XI4A 2V97A 4QLOA 1ZJ4A 4HTAA 3W2TA 2JGJA 3HYSA 1BE0A 3V1LA 3FAKA 1QE3A 2WJ3A 1NU6A 4QZVA 4W1PA 1TCBA 4RE5A 4UHDA 1DX6A 2CB9A 4W1QA 3FYTA 5K3FB 4AN1A 1QO9A 1UOPA 4BC0A 3RM3A 1LNSA 4ITVA 1YSCA 2H9YA 5JZSA 2QJRA 2X5XA 4BDSA 1EB9A 3G7NA 1ODSA 4I3FA 5D3KA 5BOVA 4H18A 1UKAA 2ZJ6A 1A8SA 5EFZA 4ARBA 1USWA 3IB3A 3KOOA 2OPHA 2ACKA 1N5MA 5ALLA 3C45A 4ZGBA 4X00A 3QPAA 5AM0A 4M0MA 1IUOA 4WFIA 2OLEA 1JU4A 2HU5A 3WKEA 1CUHA 2H7XA 4H7DA 2C58A 3F98A 4EZIA 3TJMA 5EHNA 3UMJA 5AI0A 2PUHA 1W75A 5EIHA 4M0FA 5HF9A 3A70A 3L1HA 2WIGA 4B84A 2ZJ7A 5DWDA 5JAOA 3LLCA 1YS1X 1CRLA 5ALOA 1J06A 5EGNA 3AZOA 5A62A 4YPVA 5LP1A 2WHRA 4BB0A 5CT4A 2ECFA 4GECA 2WHPA 5JARA 1AGYA 1RWQA 3VVLA 5ALUA 2OAGA 3GFFA 4KRYA 1ZOIA 1XRPA 1Y7IA 3O9MA 5C8ZA 3SWWA 5A7HA 2ZVDA 4Y2VA 4Y2RA 1E66A 2VT6A 5T4BA 1ACJA 2ZSHA 1CV2A 5ALFA 1JT2A 4C4ZA 1J07A 4CG1A 4N8SA 5BV7A 1QIKA 2XUIA 2I3ZA 2BUAA 2WJ6A 4Q05A 3BWXA 3NWOA 5AJHA 5AM3A 3WK7A 2AJLI 2QS9A 3FLAA 3CCBA 2CKMA 4H7IA 1CUBA 3NGMA 1SOMA 1XROA 4EY5A 5JD6A 5ISMA 2J3QA 4DTCA 5DTIA 4ZXFA 4KE7A 1EA5A 3I6ZA 1MX5A 2QTBA 3BDIA 5LZ2A 2QUAA 2QUBA 2DQZA 4Z49A 3K2IA 4FHZA 4FTWA 1H2WA 3MUOA 4G9EA 4IO0A 2GZSA 4W63A 1Z68A 4XWGA 1F8UA 3IUMA 2XMQA 1XLUA 3DQZA 4TVKA 3K6KA 1DT5A 4DMFA 5ALDA 2WUDA 1LPMA 2PSDA 3F67A 4DMHA 2RI6A 3KDAA 4GDMA 2CUTA 4QLAA 3V9AA 4ROTA 2XUJA 2OXEA 3G0BA 1OILA 1XZKA 3D2BA 4OSEA 5LZ4A 4BTLA 3C43A 5ALXA 4CIBA 2AJBA 2OQVA 1IVYA 3M83A 5YASA 4KAAA 4NZZA 5ALJA 3WMRA 1IMJA 2WSLA 2HL6A 1ORVA 3ICVA 5DTJA 5EIEA 3ZPXA 3DS8A 1J2EA 3FYUC 2WIJA 2G4LA 2RONA 4F5ZA 4QDOA 5A71A 4BCCA 4J0JA 4PSUA 4UHBA 3BE8A 3SX4A 1XLWA 4X90A 1QLWA 1LBSA 1K5PA 1W1IA 2RHWA 5AI6A 3G0GA 2DHDA 1G4HA 4M0EA 5JZBA 4OUKX 1SFRA 4FMPA 3HEAA 4TPKA 4DIUA 4JH0A 4J7AA 3WK8A 3OC0A 5A2GA 3WJ1A 3AUKA 5AI9A 4U2CA 1AUOA 4AXBA 1TCAA 4DNFA 5AKGA 1LPNA 4CIAA 3WIBA 4ZI5A 1NU8A 1WHTA 1GKKA 4J0CA 1THGA 3ILSA 4U2EA 1ZGCA 5JASA 4HXGA 1PJAA 4KE6A 4QDZA 2XQFA 3IDAA 4FDMA 3C6ZA 1EDBA 1HKHA 3G9TA 3O4HA 3DEAA 3DYIA 1KU6A 1UT6A 2WFMA 3STUA 5ALEA 3D2CA 5DYTA 3DKKA 5SYNA 4ETWA 3GZJA 2IX9A 1H23A 5HCUA 2Z8XA 3LP5A 3QYJA 1Q84A 3RLIA 3OURA 3H0CA 2RHTA 4IHAA 4QE3A 4QNNA 3FCXA 4G9GA 4EB0A 3FVTA 1T4MA 4DNOA 3D59A 5JATA 2EDCA 4EBBA 1WM1A 2WFZA 3QPDA 5FKJA 5IVKA 3O9VA 2JEZA 5BWBA 4I19A 4BE4A 2RIPA 1LZLA 3AJAA 2QMQA 1ZI9A 2J4CA 3WL6A 3QH4A 1E8MA 4P92A 5T4FA 4X97A 1YCDA 2QJWA 1WCYA 1CUZA 1R50A 1B41A 1UOOA 1YB7A 2VF2A 1CR6A 4NVRA 3N2ZB 5FLKA 1EK1A 3I2KA 2HA0A 5LLSA 4J0DA 4FLEA 5AOCA 3HI4A 3STYA 1SCKA 3MUNA 2WM2A 5E4JA 3I6YA 2WIDA 3ANSA 3D5EA 3FLEA 4ZREA 4IH1A 2J4FA 1CUCA 4JYPA 1QONA 4BCBA 3I1IA 4N5IX 3TGLA 1MU0A 2B61A 4J0IA 3GA7A 4QDUA 1YAJA 3OTQA 2BGNA 1DTEA 4DSAA 2YH2A 2B9VA 1TKRA 1LPPA 4W9RA 5JALA 3MGAA 4BZZA 3OG9A 1ZD4A 4WY5A 3AIOA 5AK3A 5BWCA 1P0QA 2X76A 5AM2A 3CN7A 2VT7A 1QIHA 4JUIA 2VA9A 4BDTA 5AO9A 5HF8A 2XDWA 4H7HA 1RYYA 4A23A 4AMZA 1JMYA 2VJDA 2WJ4A 2YYSA 1ZICA 4X6YA 1N5RA 4UBMA 4K6KA 4BVJA 4GEGA 2R8BA 1B6GA 1R4ZA 3ZLVA 5D3ZA 2AJCA 4Q3OA 4KR0A 1GXSA 1ACLA 1P0IA 4INZA 1ORWA 5DYYA 1JU3A 3STVA 2XUGA 2XUQA 5AK4A 3G02A 3Q8WA 3FOBA 3ZLTA 5CXUA 4GI1A 4MWSA 4UHFA 3GELA 5ALRA 1X2BA 4G8CA 3NOXA 1Q83A 3EQ9A 3H2HA 1U4NA 3IIIA 4Q34A 5SYMA 2RGUA 1MT3A 3IUQA 2ZYSA 2XQGA 2J3DA 2B20A 1QTIA 5C8VA 5ALGA 4OD0A 4D9JA 4HAIA 3C8DA 4OB8A 2PSJA 2QKYA 3CXUA 4MEBA 3AFIA 3R0VA 3E3AA 5AKEA 3VKFA 5IVDA 3KWJA 4C89A 5I8PA 4LHEA 3QMVA 3K9BA 1MNAA 2WG2A 4FWBA 1ZD5A 1JKMA 3V1KA 4BAUA 1UZAA 4HRYA 1FJ2A 1XZDA 1GT6A 5AOBA 4LIPD 3VISA 4UHHA 1DX4A 2XQIA 4OU4A 2WUFA 3I2JA 2VAXA 1CQZA 2Z3WA 4H0CA 1HL7A 4X91A 4P08A 1CUXA 4OCZA 4UPDA 3BXPA 4Y2XA 3HSSA 1ETHA 2XMRA 1AZWA 1FFDA 3VJKA 7YASA 1UXOA 2PX6A 1GPNA 1XRRA 4U2DA 5CT5A 3O4GA 4EY8A 4K5QA 1YA8A 2AXEA 5JD4A 1XQXA 1E89A 3STXA 3PFBA 5HQ3B 2HU8A 3F8SA 5LZ8A 3X3HA 3OOSA 1SCIA 5KWIA 1BEZA 1OCEA 2XMSA 3GUUA 1WPRA 2JGIA 3ESAA 1MPXA 4EHBA 4MYDA 2WG1A 4J0KA 1EX9A 4X85A 1CUUA 2ZYHA 2BFNA 2CBGA 4GWLA 1XRMA 1Q0RA 2VATA 3PI6A 5AKZA 3W9BA 1XRLA 4EA6A 3W06A 4BZWA 1TCCA 4MJ3A 4RNCA 3I2FA 5IVIA 1TK3A 1D07A 1BN6A 2C7BA 2WU4A 2HU7A 1TQHA 5ALMA 1WB5A 4V2IA 1E8NA 1SCQA 3DJYA 5CW2A 1WPXA 2NW6A 4UFOA 3DOHA 5ALSA 5ALQA 3EIOA 4Q3LA 2C4HA 4X95A 3WLAA 2OCGA 5IH7A 4GW3A 2YASA 5FXMA 1QIEA 5K3CA 1EVQA 3RARA 1F0PA 1TIBA 4PV7A 2ROQA 3H1BA 3WWEA 3EBLA 4IQ4A 2VJCA 4UBNA 1GPKA 4OB6A 5C8XA 1EINA 5ALNA 5LZ7A 4DGQA 4Q1VA 5HFNA 3C5WP 4B9EA 2W22A 1C7IA 3WK5A 3G9ZA 1VZ2A 2V96A 1VZ3A 5T4EA 1OXMA 2XT0A 1WOMA 2VJAA 2HADA 1UKBA 1O6GA 1VXRA 4A5SA 4B81A 1CUAA 2C0QA 5ALWA 4JEIA 3G9UA 1I6WA 4UBIA 3HLKA 3FYUB 3WL7A 3HJUA 1L7QA 4YASA 4AQDA 1W6RA 2XQJA 4PNZA 4X71A 1DWOA 4BTVA 1QIDA 4WDQA 3QPCA 1XZLA 3BIWA 3WYDA 1PFQA 4N8EA 1GKLA 5HKAA 5DNUA 5HF6A 2PBLA 5K3BA 1R9NA 5AKIA 1JJIA 2UZ0A 3A6ZA 1QIMA 2GZRA 4A16A 3SC2A 1QO7A 2HM7A 3H04A 1LLFA 4UBJA 4G8BA 2XE4A 4C6HA 2XMCA 2DR0A 4CCWA 4QEKA 4UFPA 3HABA 5HZGA 1H2ZA 1XZIA 1CIJA 1ZIYA 1ZD3A 5EHQA 5FV4A 4Y7DA 2WFLA 1FFEA 1FSSA 3OM8A 2Y6UA 1LBTA 4GBGA 3D3NA 2BCEA 2WG0A 3PF8A 2DHCA 5ALHA 3WA6A 2QR5A 3TRDA 3R3WA 4PSCA 1LPSA 3KD2A 3ANTA 1CQWA 5I7UA 2C5GA 1BU8A 4B85A 5CT9A 3W9UA 3V48A 2DHEA 2ORYA 1XKLA 4I4CA 5AI4A 4W1SA 1ZD2P 2V9ZA 3QMMA 3DOIA 4MWTA 4OYLA 1K8QA 1QFSA 2IIVA 1ZIXA 4C01A 4QWWA 1QIJA 2ACEA 1MTZA 2OG1A 1K6EA 3IUNA 4S0XA 4QDTA 3ESBA 1EH5A 4G4JA 2OAEA 3I28A 2Z5GA 1FFBA 1XZEA 3IURA 4IH9A 1XZBA 3NUZA 3O95A 5FUMA 1YA4A 1Y7HA 4OB7A 4KAFA 1VA4A 2XUOA 1CUYA 1VKHA 5IVHA 5JAPA 3V1NA 3MVEA 4FFVA 5CBKA 1CLEA 3PUHA 1J1IA 4AZ3A 2FX5A 3G0IA 1BROA 4X3CA 3WYNA 4B6GA 5KWJA 5LZ5A 3JWEA 1KEZA 3HXKA 2XB6A 5AK5A 4BAGA 1CUVA 2HFKA 4KE9A 1QOZA 2HHAA 5E2IA 2K2QB 1BN7A 3R40A 2O2IA 3IA2A 2FUKA 2PU5A 5ESRA 4PW0A 5K3AA 4TGLA 5AHXA 3H2GA 1XZMA 5JAUA 4F60A 2Y6VA 1XKTA 4G1FA 1F6WA 4DMCA 3V1MA 4BATA 1R1DA 3B3QA 1VJ5A 5F4ZA 4IH4A 1DINA 2DFPA 5AI5A 1X2EA 1JMKC 3KXPA 5AKYA 1A8UA 4CCYA 3I1YA 3BJMA 1QIIA 1A7UA 4C4YA 5A7GA 5HKBA 5D7BA 3GROA 3ZI7A 4KACA 4X94A 3AINA 1GPLA 1CFJA 2Q0XA 3YASA 5DLPA 5E4TA 3H1AA 3QITA 1AURA 2XUAA 1UOQA 3A2LA 1T2NA 2XUDA 3WL8A 3LS2A 2AJDA 5CRIA 5HK9A 1HDEA 3B5EA 4BAZA 4QDXA 2DSNA 3FNBA 2Y1KA 3N0TA 1JI3A 1H2XA 5FRDA 5JADA 1FFAA 1O6FA 4MQLA 3VDXA 4FBLA 3B12A 4Q82A 5E4YA 2PSHA 1YS2X 4E11A 3D2AA 5AM1A 4C87A 2G5TA 5CH5A 4HXFB 1JFRA 1VE6A 2PSFA 3T52A 1LPOA 4H7JA 1SC9A 1BCRA 1UK9A 1CUDA 1ZI8A 3R3VA 3AILA 5AKXA 1HLGA 2X8BA 1IUNA 3QZUA 2XUPA 3G0CA 3HC7A 1WB4A 1DU4A 1GGVA 1UK6A 4W1RA 1L7AA 3STTA 3VVMA 4DYHA 3DKRA 4AMYA 2PSEA 1CVLA 5DNVA 2QM0A 2WHPB 4AX4A 1BRTA 3G0DA 1YAHA 4KE8A 2WUEA 2H7CA 5C81A 1C7JA 3PF9A 3D7RA 4F0JA 4X93A 3T4UA 3IUJA 1P0MA 5CH3A 4CG3A 3ESCA 4WFKA 3C70A 1XZGA 4B0OA 2JGKA 4Y2PA 2CJPA 5AM4A 2Y2UA 3C8HA 2JGMA 1C4XA 3I2IA 1ZJ5A 3C5VA 1CUIA 5LKRA 4UFNA 2XMBA 3I6MA 5FPPA 5DNWA 3AIKA 1EXWA 3CN9A 1QJ4A 1JJBA 2H7YA 3R41A 1AQLA 4WY8A 4LYDA 4J0HA 3FYUA 3JW8A 5KREA 1PV1A 2WIKA 3WI7A 2EDAA 1QIGA 3LIPA 5CURA 4BP9A 2G5PA 1UKCA 1CPYA 2I3DA 3WA7A 2OCLA 4U2GA 1E8DA 1MNQA 3C6XA 3WWPA 1W4LA 4KRXA 4QA9A 4PF1A 4RPCA 3U1TA 1L7RA 3RK4A 1U8EA 3H19A 5AK6A 4DMKA 4UBLA 4X7BA 2DCMA 1P0PA 2JGLA 5JIBA 4B0PA 5EHZA 2HA4A 2QT9A 4UBKA 3WJ2A 4UHEA 4P9NA 2VAVA 2Z3ZA 4KYVA 4YX9A 4GLBA 3L1IA 3TEJA 1G5FA 4Y2SA 4EY6A 2IITA 5EHXA 5AKLA 4ZWNA 4B9AA 2ONCA 3DYVA 5CXXA 4G4IA 4O08A 3Q0TA 3H2IA 2HA5A 3H2KA 3E4DA 3BL8A 1W52X 3PDCA 2HFJA 1K4YA 2C0PA 1MAHA 4WDRA 4AO8A 2QRUA 4FNGA 2GBFA 3O0DA 3H18A 1LGYA 4CI9A 5FDFA 3D4LA 3FLBA 1XLVA 1ODCA 1LPBB 1VLQA 3WIOA 1TAHA 4DM7A 4BBZA 4ZV7A 3U0VA 2QZPA 4E15A 4MEAA 2E3JA 1AX9A 2BJHA 2WU3A 2W6CX 3IVMA 2CZQA 2O2HA 2JF0A 4H7FA 4DLNA 2HIHA 3QVMA 1VXOA 2BGRA 5AKHA 2PVSA 4HZGA 5LKAA 5H3HA 4AB1A 4PSDA 3LIIA 3O4JA 4PO3X 3C6YA 1R88A 3WWOA 4GXNA 3RKSA 4EUSA 2P8SA 3AIMA 4H7KA 3WK6A 2GYUA 2DQYA 4CFSA 2WUGA 1DWQA 3A2NA 1GQSA 4LXIA 3F9CA 4G5XA 3S8YA 1R3DA 4PQEA 1A88A 4LKOA 1X70A 1H22A 4BRZA 4NMWA 1IZ7A 2ES4A 2VEOA 1XFDA 4X92A 2WFLB 3GBSA 1NX9A 2OCIA 1HPLA 3HACA 4AZ0A 2HDWA 4UUQA 5CH8A 4X6XA 2BAGA 3VJMA 3S2ZA 4EY7A 1EVEA 4L72A 1E5TA 5AH0A 1ISPA 4C88A 3I2GA 3STWA 1QFMA 3R3ZA 4OYYA 2CEKA 1XZAA 4QWMA 3WWCA 4G4GA 2QVBA 3D0KA 3M81A 4KEAA 5K3EA
chains in the Genus database with same CATH superfamily
2A0WA 2X9VA 4FT4A 3FUWA 4BUZA 3DXZA 4UASA 5CT6A 2ONJA 2VZ0A 1VHDA 2GYVA 2HJHA 2WMDA 4J3JA 4R1SA 4YXWA 3WX0A 4EA7A 1U2EA 2PMCA 4HRXA 4MVJD 4FWTA 1QP8A 1RKXA 5I4IA 2UUCB 2OY0A 1NOIA 1U8UA 2JBAB 3OEHA 1UBEA 3B9BA 5G02A 3TE7A 4E46A 5DX8A 2MINB 2OGTA 4RTRA 1WOYA 5IRCD 1SC4A 2AYXA 4AD8A 3LKBA 4GZ5A 4DC0A 3OP4A 5AIBA 3IULA 1ESZA 2IU3A 3GVCA 3TX2A 1R0WA 4RTSA 1E1QD 3GV0A 3AM3A 3H4MA 3NGLA 1CY6A 2AG8A 1KP3A 1X7WA 4N8DA 1JALA 3AKCA 3DD5A 2YN0A 3I83A 1YR6A 4LECA 4P82A 3IDOA 3HCEA 1AZTA 1HDYA 2FJ0A 1C50A 4QXPA 3WK9A 2IT1A 5GZ6A 1HTWA 5JSKA 3L3BA 3LE8A 4Y18A 4KXVA 1QTRA 1R3UA 4XWWA 2WA1A 1X14A 2DSTA 2C84A 3UK2A 3RRZA 1R9GA 3MWYW 2BM1A 3HCDA 1BMFA 2PKYX 1W8IA 2EX0A 2JIPA 4MQMA 3ZD9A 2IP1A 4BWFB 5CFRA 2CL0X 2EFJA 2QOEA 4MK4A 1NC1A 4YT8A 1YACA 5C7LO 1E3QA 2GFQA 4XI9A 3K1ZA 1I01A 4ZOLA 1UWKA 1NRIA 4YJ2B 4TTPA 5T57A 4ZDIA 3W4JA 4ICIA 2P90A 3FGOA 2XZLA 2GCOB 3JASA 1Z2DA 2JDIA 2Z83A 1JQEA 2GN0A 1UK7A 3PQ8A 1FFCA 3L7KA 4LX8A 1XK7A 2I78A 5EQDA 1SQSA 1U7HA 3EGVA 3PTZA 1U0FA 4C4XA 1DQNA 4WVLA 1DQYA 1Y6JA 1KVRA 4EAAA 5DBHX 4RTJA 4NX2A 2XBLA 1NQTA 3N70A 4JKYA 5TGZA 5IASA 1OMOA 3AHGA 1PD1A 2P27A 3BMNA 4CF4A 2FG5A 1Z82A 1LZKA 3GGOA 1NR7A 4GPAA 4CLEA 1P0FA 3OZVA 1IM8A 3D7NA 3VNSA 2PQ2A 1LLUA 2I80A 1NBMA 2PD3A 3PG5A 4HWRA 3VXKA 3IPLA 4Z3OA 1U7WA 2KB0A 2X3UA 4K6GA 1KMMA 4OFZA 3ROTA 4B5KA 5JZVA 5B55A 4L15A 5EOVA 2AZMA 3PJFA 2GAAA 1DT3A 4UUOA 1P80A 1QR2A 2E1PA 1IB6A 5IFLA 2XMZA 3LRXA 4LE0A 3TOVA 1CJUC 1RWVA 1PWYE 3H5IA 4X8LA 4HVCA 2YXPX 5A3SA 2C1ZA 4D0RA 3C5HA 3O8OB 3TGPA 1ONPA 1VSTA 4I50A 2A9KA 4ZO8A 3LUBA 3L77A 3DVLA 1GPMA 4NOJA 1WIWA 2YUIA 3FOEC 4LXHA 1BU5A 4QELA 3FCAA 1NRWA 4WCVA 3ZWQA 4MKHA 2KS6A 5DK6A 2V6JA 3BGSA 4JLSA 4KPUA 2X6RA 3DE3X 3QUAA 5ARCA 2OGSA 3KL4A 4DJEC 2O59A 4IOLA 2JBAA 2WVHA 4R83A 4UVEA 4Q9LA 5FUWA 3AR8A 1DC8A 1TW2A 1X1RA 1JT9A 2Y1XA 2ZB7A 1ND6A 4OHCA 2DQSA 4J9VA 2QY9A 2G4VA 3MF4A 2GWHA 1GG5A 3ADCA 3IMFA 3T34A 3QOWA 2J6HA 1VDZA 4ZKEA 1EMDA 3RF7A 4K7JA 1C7QA 1COWD 2QGFA 4GD3Q 4JCOA 4L07A 4M83A 1FDSA 4CG2A 1MBZA 4C04A 4RMNA 5FBZA 4A7PA 1LSUA 2IPOA 3E9MA 3WKDA 2W6QA 1N4DA 2WJGA 3G79A 4KMRA 1JA0A 1OB5A 3C3JA 8MHTA 2XCOA 2BFDA 3IAS6 5KDOA 3ZHZA 3EXHB 2VNAA 3ED1A 4C4OA 4NCJA 5T4HA 5CEEA 1TYZA 3G3EA 2UZIR 2JARA 1QBGA 5D84A 1THTA 1PR9A 3N2NA 4EB6A 3DBRA 3NHZA 2F64A 2H17A 3JQ7B 4FFLA 4Q00A 3ES9A 1NUPA 5BQ5A 4QFCA 4W5JA 1T1IA 1ZKMA 2WINI 3Q12A 1ZVMA 2XOEA 2PIAA 4ILEA 2VBIA 3TLMA 4B79A 2OQ2A 2NZYA 2OGZA 1XIVA 4RVUA 5LMCA 1CEXA 1SCBA 4XQ0A 1IZYA 2DX7A 2GBGA 3T0FA 4HVLA 1XG5A 2XKBA 3KQMA 4UC0A 3VU1A 1HMYA 3NBZC 4AUEA 4JBLA 3O47A 4GHWA 2Y3IA 3EQ7A 1ESMA 4PC7A 4TMTA 5FLYA 2I7CA 3QXSA 1N75A 1E7WA 2AKAB 4IX9A 5AVQA 3H2JA 2G70A 5AESA 1XVTA 4CXMA 3ZE9A 1K63A 4PAWA 3RGWS 1IZ8A 4WCFC 4K2HA 2HGSA 2LW7A 2RGDA 1RI1A 5HFAA 3LUPA 4ZCTA 1DKNA 2BCGY 3T9FA 1NR5A 5F7JA 4WNIA 2D74A 2GASA 3HVJA 4IHKA 1QH8A 1T4BA 3RVKA 3U17A 4DSZA 4N3CA 1SIOA 4F5DA 1Z8NA 1MJNA 5ICSA 4HS9A 3CZCA 3RC8A 4CKBA 2HRRA 2WIFA 3D1JA 3PNKA 4PZYA 1VE5A 4UULA 4CEIB 3DNPA 2B82A 2J3EA 3KYDA 5EWJB 5DGTA 4JLBA 2AHOA 4TMXA 4TV8A 5DGXA 3OC6A 1H05A 1LBHA 2VNHA 3NP9A 4CQLA 4DIKA 4AQYB 5CFMA 4IXDA 1CE8B 4M9XA 5EWLA 4N1AA 2CK3A 2PUJA 3UOAB 1MRZA 3D6HA 4GAEA 3W3AD 4DKXA 1RWWA 1Z6TA 3WICA 2EGHA 9MHTA 4BL5A 2GHIA 4YK7A 2IYTA 2VIIA 3LUDA 3MT9A 2IX3A 1YL6A 4YT5A 2QRHA 3E35A 3AR6A 4FE7A 5DYWA 1EFAA 2V7TA 1AKEA 2IOQA 3NHUA 1YBFA 4JS0A 1APBA 3C6MA 3QMWA 4M4SA 4EABA 3V2HA 1N2CE 1R15A 4WA8A 4B82A 4YUXA 1AMNA 4CQMD 3TMKA 3KOUA 2J85A 3TJRA 3SEZA 4MPRA 2CMGA 4A6EA 1N3LA 1T6ZA 2AD1A 3IL2A 2CHVA 2FUG6 2KSQA 2IHNA 3FWKA 2GM9A 4MI1A 5BW4A 3VNQA 4B7AA 3EOBI 3QKTA 2LCIA 5KJCA 4MMXB 2H51A 1K2VN 4DLYA 5ITWA 3QENA 2YQ5A 4AZVA 3R3JA 2IUUA 1HQCA 3SQDA 5FPQA 1I9CA 4UCWA 4JNKA 1LJUA 4Y9SA 3TQHA 1XCPA 4ZYYA 2ZIFA 5B53A 2XXAB 1DQZA 4EHDA 2ODTX 5CTAA 3RHFA 3TL6A 2BHNA 4YV2A 3QE3A 2B69A 1IZ0A 3EF3A 3GQVA 5LQRA 5EJ4A 3MQ4A 4I1VA 3WQHA 5DM2A 1DBWA 5JAZA 3SEAA 4NICA 2WTMA 3L18A 1VE9A 1QBKC 4HZUA 4HWKA 4P3KA 5JPIA 2DR2A 3IOYA 3I9MA 1S2OA 1M2GA 1H1LA 4G56A 1KWKA 5T7BA 1AF7A 5LJIA 1ULZA 5MGBA 1CP3A 1E94E 1MHPA 2GKOA 4H77A 4XIIA 3G8YA 3RJTA 3Q8MA 2X15A 3TNDA 2VUSA 3TZCA 3AZQA 3AGQA 5DLEA 4LJYA 5JCOA 3C4VA 2XYPA 5EKUA 3WRWA 1R0KA 1ULAA 2RCNA 2W2NA 4B4WA 4C0JA 1P6XA 4Z0PA 1VLMA 2C5FA 4N03A 1SK8A 1NL3A 2COEA 2FZ5A 4P3YA 2HO5A 2JGEA 4WZBA 4C7JA 4D1YA 2P91A 2YWFA 2CMFA 3CBGA 4BMOB 2C77A 3WKCA 2JBWA 2V5VA 5HIAA 3NAQA 3OUTA 1W0JD 1IXKA 3BRCA 3GOQA 1UBNA 3K31A 1N9GB 5JY1A 1J7JA 2CLOB 3VU3A 3TEMA 4ZAZA 1NAHA 4YMTA 1HNWB 2C42A 1N6IA 2XB4A 3DXFA 3E18A 5AIAA 1Z6YA 4KB5A 1DEKA 3S44A 4FQ7A 1TVKA 3JWPA 4OU5A 4BCBA 4MHOA 2C4TA 3OQMA 3WK4A 2XGOA 5CDUA 3HGTA 5BNZA 3ZTWA 3L6BA 1KQNA 3J80A 1TCUA 5CT8A 3AHEA 3S6JA 2FP4A 2I6FA 2YHAA 3PR2B 2OO7A 3IDQA 1VJCA 4BXOA 2BSQA 1SN7A 3F3YA 1Z5UA 3IT2A 2VHYA 4RE6A 2ZBUA 3LFTA 1P9LA 4EELA 1VMEA 4BO0A 4FMDB 1JLLA 3B6MA 1Z13A 3B5IA 4ZOBA 3UATA 1T8WA 1C1DB 5KJEA 3OE4A 2ORIA 5FJJA 4HAOA 3QE0A 2C5BA 1XZCA 1VLLA 1GEGA 2V7GA 1TVCA 4FEGA 5DP2A 1CBUA 3AXSA 1SVKA 3CS3A 1KY2A 4FYYA 4JQZA 1WW3A 1UBTS 1Z45A 4ENVA 1NVWQ 4HVTA 1S3FA 4PN3A 4CMBA 4II7A 3T7IA 5CLGA 4PQGA 3LW7A 3ZUPA 5CP8A 3JS5A 2ZIUB 1G0OA 2JJMA 4HN9A 1XOIA 1N6OA 2OYRA 1B1AA 4G0QA 5CCXA 2BMDA 3A05A 5EMHA 5DU2A 3MUEA 3V3KA 4LHXA 2M6LA 5LLDA 4JX8A 1M0SA 4MGKR 5LNK6 4HQNA 2GEUA 4RPKA 4G0NA 1GTJ1 3BJRA 3WL5A 2IYEA 2IZ0A 3NDBB 1NP6A 3K15A 1FFYA 3JZFA 5J2UF 3QKIA 1VRCA 4IW3B 1NXWA 2X0IA 4P5PA 1Z74A 2D1QA 3B7GA 4PAMA 1VHTA 1PYDA 4BLRA 6YASA 2W2MA 2NSDA 1W1UA 5A0TA 4ESOA 3E8XA 4R2LA 4F84A 4IIGA 5HCNA 5CG1A 5JTUA 4O3MA 1KNQA 4Q9KA 2QTNA 1K0FA 1RCTE 2HF9A 1O0SA 3M89A 1PUXA 3NIGB 4IVRA 5K09A 1KKLA 3NNDA 4U6QA 2X4DA 4HQFA 1VG0B 5KPJA 4JU8A 4G23A 2DE0X 4ZVVA 1DQRA 3LKVA 1UM9B 1JLRA 2M32A 2H3HA 3QFCA 3UHAA 4OBXA 3N2EA 1QH1B 4O1HA 3O7MA 4KIFA 4K3UA 2VDLB 1W94A 3LCVB 5C7YA 4MQ5A 2BGIA 3CX7A 3E9ZA 2OHOA 3WZLA 4BWGA 1HFWA 3TECE 4BNDA 3ONVA 2OGUA 3LL7A 2G63A 2Y1OA 4XYMA 4LXGA 5FNVA 3BDVA 3WISA 5HKKD 4GLJA 3BGDA 5J63A 4E14A 1HQDA 1PQPA 1GU1A 4BVLA 4BRWA 2VRCD 1Z83A 3N8DA 1J0AA 4MCJA 3WAGA 3V3TA 1ZRHA 3B20A 4EPRA 1XL0A 2CE7A 2PKQO 2X9GA 1CWUA 3PUYA 1OFTA 2BFCB 5F98A 4YPFA 1E92A 2FMXA 4ACAA 2Z9DA 4BO6A 3HNRA 3L9XA 5L3VA 1F06A 2GJKA 3R3HA 1Z5PA 4M9ZA 1R4MB 2X14A 2XA9A 3DDZX 2VPPA 4MJLA 4QPZA 2P40A 3E9QA 2P4UA 4XM1A 5JD5A 4TTIA 2YMLA 1JV2B 4HI0E 3UAZA 2ZYDA 3CG4A 1XZFA 3BB3A 2AEFA 4XX0A 2GN9A 5AKJA 5TR9A 3LZ6A 4CM4B 4N5LA 2ZSIA 1YTUA 3CCCA 2NU7A 3P1JA 3K2QA 2G17A 3AUJB 1TM4E 3IAXA 1N3IA 3ZD8A 4RKEA 1M1NA 4GXTA 1GR1A 2LP4Y 2VQDA 3DKVA 2IPLA 3OZFA 3SR4A 4BYMA 4ESHA 4QPPA 1JG7A 3LDGA 3PWZA 2Z2ZA 4IM7A 4HLUC 2H5LA 3W2TA 1A9XB 1GY8A 1YBHA 2EATA 3BOSA 4FIZA 4LHZA 3TW6A 1XHFA 3BERA 2H8GA 3HJHA 5BYAA 4RESA 3L0DA 3ZIAD 2O1EA 1OC4A 2IQ5A 2ZB3A 3GT3A 2QRKA 2R1UA 3LPLA 3WLOA 1QE3A 3EIHA 4ROSA 4G1EB 4TQGA 5JH7B 3MGGA 3TI7A 3HDQA 3W8NA 4G9BA 1RT9A 1SG0A 4B3TB 2EYUA 1V5GA 2B25A 3QHPA 1Y1RA 2I1VB 3L07A 1OX6A 2IOYA 5CLJA 4RE5A 4ZODA 3LQ4A 1ZOOA 4GUDA 3LWDA 4QUBA 3C16C 3HB1A 4UW9A 1OKKD 1DEXA 2JI8A 3QLJA 3B6ZA 1ONSA 1Q7TA 2X0RA 1QO9A 1UOPA 2XB8A 3MELA 3R5KA 2JGRA 1DS6A 4FDVA 4BC0A 1LNSA 1A97A 4JL5A 4P3PA 5PNTA 4EM6A 5KO2A 4Z7QB 2JAHA 3VZCA 3QWFA 5BQXA 1I2DA 3ZWAA 1SXQA 4Z99A 2YWHA 4YP0A 4EYEA 2CSXA 1NN5A 4AMUA 4QXMA 4GMXA 1JAXA 1L7XA 3KOWA 2HSJA 1W5AA 3LCUA 5B2ZA 1WBDA 4Y3UA 4PYIA 3HKBA 1U6JA 3Q8LA 2ZK7A 1UKAA 5TJ9A 1A8SA 3B2EA 1CIVA 2IZ6A 1USWA 2R7NA 3EZ7A 3IB3A 4EG7A 4HYEA 3B8EA 5MFZA 1OUMA 3I92A 3RYTC 3QWBA 5IH3A 4DIOA 1WDMA 4ZYTA 4TL8A 1GG9A 3C45A 5E3HA 4EVSA 3NHJA 1VSVA 1Q0SA 2C94A 1G60A 4D41A 1JKIA 3KCQA 2WJPA 1Y1KE 1N6LA 5B3LA 3K70B 2RGNA 4CCAA 4D96A 1C29B 4Y2GA 3U7JA 1XQ6A 3HQ4O 2VH5R 3DP9A 2W6PA 2HJ9A 2OWEA 4PYKA 5ED0A 3H1FA 1OAAA 3TM5A 1L3BA 1XGKA 3WKEA 3KKEA 1M2KA 3DFKA 1JKXA 3HJBA 3PCXA 4G65A 3VDQA 1S1MA 3Q1KA 3RS0A 2C58A 4UTNA 3KTAB 4MS1A 3JYPA 3U56A 2GJ4A 3UMJA 3OZRA 3NWPA 4LN1A 1VBNA 3DOEA 4M0FA 5CNKA 4F3NA 2C5EA 4QJBA 5BSHA 3DAHA 3D6TB 4X84A 5HF9A 5T5QA 3FI0A 4EFDA 5FUQA 3T15A 4JLOA 4PYRA 3ICEA 3D4IA 2WIGA 2XWQA 3TCNA 3GMIA 4R2MA 4H2DA 4V03A 3EXHC 1KK1A 1RI3A 5KYYB 3BTSA 1X86B 2XY4A 2BY4A 4M38A 4QBKA 5BWOA 2ZVJA 1OYVA 1TM5E 3T5CA 1RM4A 1W88B 3VHXA 4RLFA 3EOZA 4DF3A 2IDKA 3DZDA 3FXAA 4L08A 3ROQA 2OD9A 1CRLA 1QF7A 3GIWA 1J06A 5ALOA 3FG9A 5JAOA 3FWNA 3K0SA 1UC5B 2EBFX 3AZOA 3AR9A 3IEUA 1A4IA 2MR5A 3DCJA 1MGOA 5A62A 4NCBA 3HUUA 2UAGA 3GDWA 4C5AA 4O0MA 3FFXA 3MWLA 4CV0A 3PLNA 2WHRA 2FW8A 4O1MA 4BB0A 5CT4A 1NBME 1LK5A 1M7BA 4JVLA 3CNBA 1LV8A 1YU6A 4Q3EA 2F4NA 3DJFA 7ADHA 3AFNA 4F45A 2Q1WA 3VH3A 4UXIA 1Z5ZA 2LIVA 3OZUA 1Z8HA 1ZOIA 3QVGA 3SS9X 4UDOA 1E7SA 2LBPA 3BKXA 3UXMA 1RWPA 1XJCA 5FBRB 4R0MA 2IH4A 1Y7IA 3O9MA 1X6VA 1HYBA 3B1XA 3KXLA 4HDMA 3N6VA 5CCDA 3H4IA 1FL9A 1WSAA 4HTFB 2JIZA 5FWYB 2IFTA 2OHFA 4Y2VA 2QG4A 1E66A 4Y2RA 2BMWA 1CDEA 4YV0A 5L9AA 2AFRA 1OI7A 3AIIA 4OATA 4NRDA 4EI2A 1CV2A 3D7KA 3NM6B 2BF4A 3GJYA 1XPJA 4GI3A 3L0PA 3RANA 2H4YA 5TPZA 3LHIA 1TYBE 1J07A 1GG2A 2OBBA 2WZBA 3FDFA 3GI1A 4K6CA 3S2EA 3ZV4A 4CG1A 4EAQA 4WW0A 1ZX1A 2C03A 2WNIA 3NRBA 4URYR 2H59A 2AI1A 2Y4OA 4TROA 4G5SA 2I2CA 3AR2A 2IGBA 3SSOA 4IR7A 3VYTB 2O8FB 4W8OA 3FKSA 2GK7A 4PZCA 1GZHB 4AKSA 1FLVA 1L5SA 2I7XA 2OLJA 2Q28A 3GC6A 1MEEA 1MOPA 3DE0X 3DHVA 3EN0A 2OBYA 1E1KA 4DGSA 1VKJA 3NWOA 1DLIA 1DUIA 4K88A 1HSOA 5H81A 3ZGOA 5AM3A 4LJLA 3THWB 3ST7A 2NYUA 1H8HD 2B4QA 2ZIAA 3OZTA 2O0KA 4E22A 1T5SA 4TN5A 4AZ3B 2UXBB 3DAYA 2CKMA 1M6YA 1PFWA 1TPYA 1CUBA 2WKRA 3I9V1 2XZTA 5GONB 3NEAA 1D7AA 4M6WB 3REFA 1PZGA 3O21A 1XROA 2CXHA 1WMFA 3VYRB 4BN4A 2O52A 4EY5A 1J0EA 4JUAA 4BJ3A 3MAAC 1HE8B 2B35A 3DGEC 4R7ZA 4REQB 4DTCA 5DTIA 4ZXFA 1JHPA 3OQJA 4P35A 4IIJB 3M1YA 4KE7A 1D9ZA 2QF7A 4RK7A 2DXIA 2O8EA 4FZ3A 1IDOA 2HQRA 4C1NA 2PXAA 3GT0A 3AVYA 2F2TA 4IV0A 3KAKA 1G59A 2EJWA 1RLIA 2QTZA 4M1QA 1EFRA 2VH2A 4TTVA 3U4DA 5AVJA 2XSZD 4FMBB 4FYWA 3WGVA 2FNAA 3K5PA 5KNCA 1Z0AA 1RJWA 4FTWA 2R8XA 3MWJA 4YCMA 4C2AA 1SVNA 3KSAC 1N8NA 3T9AA 2FFHA 1Y0BA 4CL3A 2ZRHA 1V2HE 5JY6A 1TZBA 3L2OB 4U7DA 1Z68A 2W2XA 3QI7A 1DXHA 4ML3A 4MS4A 4NENA 3TRFA 5JSQA 4QBGB 5LDHA 1G7CA 1CJBA 2XMQA 3N2YA 1MZVA 2R86A 3P4XA 4HCJA 5DT9A 4KK3A 1QPBA 3QW4B 2B1GA 2ECQA 2MSWA 2PZMA 1G5PA 1PLKA 3L93A 1SBQA 4C14A 1E1DA 1KZGB 3VSCA 2O06A 3UJ9A 2BMEA 5AK0A 3ED5A 4DZRA 4E94A 1NSFA 1L7OA 5KTRA 4GKKB 4MVJE 2DWOA 1D6NA 1ECCA 1F38A 2GFIA 1DT5A 2D5BA 2TECE 3IUEA 1X13A 4KFSA 1KIMA 1TM7E 1QXSA 1HMPA 3P9CA 1Z63A 3HV0A 1B7GO 2XGGA 3K09C 1QGUA 4NBKA 5JWOA 2Q6IA 4KQCA 4XWOA 3QUTA 4NR0A 1IVSA 5IN5A 5FBQB 3VR5D 2Y8EA 4CR8A 2CVOA 1JFFA 2I5PO 3FPFA 1M2OB 2RI6A 1VL8A 3KDAA 2CUTA 3VKWA 4LJ7A 1A0OA 2VL7A 4CM4A 2P2NA 5GJVC 1AN0A 3DHWC 3EZ2A 4OIMA 4Q1DA 4DHEA 1IQRA 3PYMA 5EJ6A 2ZRLA 3K1AB 1YQTA 1D1PA 2N1MA 4W5NA 2X19A 2JGAA 4ARZA 2JRCA 1ML4A 2OK7A 5EPOA 2G77B 3G17A 3AHFA 4FYMA 3T06B 1IN1A 4RLSA 3IP7A 3N2LA 2HMWA 2DUJA 1XZKA 3A37A 1T9HA 1KORA 4QYIB 4UNQA 3CISA 3NBMA 4G1MB 1G8YA 1GV0A 4BTLA 5JXGA 1G1AA 3B36A 2FI1A 1ZP6A 2IHJA 4R2IA 3USES 5BOSB 5KIAA 5A1TA 1RXWA 3HYCA 1XR3A 3HI6A 4ZO7A 2CNLA 1GNVA 5LIRA 2AJBA 4WLEA 5E6SB 1XYGA 3D8RA 1GPH1 2LXNA 1X7XB 2H1VA 5HJ5A 5EZYF 2VQSA 5YASA 1ZD1A 1K98A 1UBCA 2GZMA 2WSLA 1PEKE 2HL6A 5TGDA 2QPTA 4RZ2A 2WSMA 4V0MA 1CVIA 1NKSA 4Z9FA 4ZJUA 1EG7A 2OOSA 4MZXA 1WUTA 5LQDA 2K6GA 2O6LA 1PEYA 4FFBA 3TLCA 3TVYA 5DTJA 2I2AA 2BI7A 2C29D 4MUAA 1R0RE 4MHSA 3DS8A 1J2EA 3GMSA 3U7RA 3SQLA 2CWDA 3KQPA 1CE8A 4F12A 3LPMA 3ZQ4A 1RYHA 1C0EA 1T0PA 1ZO8A 1Z62A 2P41A 4ZVNA 3RUPA 2ODAA 4KSYA 1Z2PX 3LY7A 4C6TB 1KI6B 5HQJA 2CV1A 1X0XA 2HCTA 2VXOA 2OCYC 1C0LA 1EAMA 5A71A 2V74B 3A0UA 1Z25A 2Z57A 1FC0A 3DFIA 4RVOA 4YJHB 4Z7OB 2H5EA 4Q1EA 4X6LA 5IMSA 4QD3A 1FMLA 4N9QA 5JDCC 3PWSA 1MRNA 1NVDA 4UHBA 2ATIA 3BE8A 3HHPA 4ZJPA 3ZIDA 4RYLA 4KYIB 1I30A 2EKQA 3P9SA 1OWLA 3VPDA 2O2YA 1I2AA 2L42A 5EIBD 3ADKA 4MQEB 5KVVA 3FN4A 2Z4TA 4DBVO 5LL6P 4D02A 1RZRD 2RC6A 5BSKA 1NJGA 5A9SB 2F3PA 4I1PA 1DKRA 3A9VA 4EDHA 3E9EA 1U1GA 2EL9A 1AOXA 3A11A 3H9CA 4CKCA 2FR0A 3L7BA 1P1CA 4R9SA 3OT1B 3JSXA 1RQRA 3BFKA 3QG1A 4DWOA 5TC4A 2A9RA 3UZUA 4RHCA 3SZLA 4OEHA 3RRMA 1SA0A 1QP0A 3OOJA 1OYOA 3BRWA 2YOGA 5JWHA 4WRRA 2FXVA 2Q7OE 3IDZA 1BMDA 3RF6A 4DG5A 1ZMTA 3SHOA 3I5XA 3Q6MA 3CEMA 4Y8VA 2V6BA 4MVJG 1JJAA 5EJ7A 1P2VA 2K87A 3W3AH 4EO9A 4Z4HA 2BTQB 2WWHA 4HEHA 1V5IA 1VPTA 5SY9A 3BN3A 2XB9A 2BEUA 3I9FA 4O8CA 1XTIA 2NTVA 5F2NA 1NVBA 1Z08A 4TWJA 2GESA 2EJCA 4U00A 4W99A 5AI9A 4EFLA 3U3DA 4MCHA 2JZCA 1AUOA 3NXKA 5K0TA 1C0IA 1QG0A 1P6UA 4EHFA 1KOGA 3AM1A 1LDNA 3DBLB 3P96A 2EJTA 1T5TA 2LGJA 4HDOB 4QUKA 3NHAA 3VBEA 4DNFA 4LY9A 1PG0A 2XWSA 4MYTA 1YKFA 5AKGA 4HEA1 1ADGA 1LPNA 3WIBA 5T3UA 3SFTA 4F38A 1V8BA 1JNYA 3HM9A 1UDXA 2AMLA 2VYFA 5GOZA 5E3IA 2ZETA 1V1RA 3AEXA 3IUYA 3E7WA 5CFPA 3F4LA 2AK3A 1THGA 4YCJA 4JDUA 1QHYA 4M88A 4XR9A 2JLSA 2GCPA 2D1FA 3OQBA 3IBGA 1VIDA 4OA8A 5F1PA 5FR2A 1F2DA 4HXGA 3QXJA 2XSZA 3BWDD 4KE6A 4QDZA 3F0TA 1P4JA 1U98A 2H48A 2XNDA 4DARA 4EH1A 3Q7SA 1M0EA 3MCTA 3W3ZB 3VKUA 3C6ZA 3JD4A 2OFOA 2GN8A 4Q39A 1EDBA 5CVEA 3RCBA 4JELA 1HKHA 2LDBA 1KU6A 4ZOAA 1IJFA 4UATA 4LJRA 4RK0A 5GM1A 4HOYA 3ZKWA 1WVIA 2WZDA 3STUA 3T1NA 4JJ4A 3UWKA 2NNWB 4F97A 4ZHSA 1U7TA 3HZRA 4K3VA 1EFVA 2M9MA 3DKKA 4KWTA 1S01A 2Z56A 1Z0ZA 4US1R 3GZJA 5DTQA 4UNRA 5TS3A 2ZU0C 4L6IA 2FUNB 4WD3A 3WMXA 2IH2A 2JANA 3A3PA 1Z88A 3MTBA 3FF4A 1RQLA 2UYOA 3LP5A 2ZT5A 3QYJA 4U9HS 1CERA 1TU3A 1V96A 1EWVA 1QH0A 2QE6A 3EB9A 2EFYA 2I9PA 3CH6A 3KZMA 4KXNA 4UVHA 2FKNA 4WADA 2IIQA 2Q1SA 1I13A 2ZTHA 3P9PA 3I45A 3H16A 3BXXA 4QNNA 5H1YA 1MCZA 4MNTA 1P0CA 3AVOA 3FCXA 1T9ZA 2B8EA 1RBYA 2C2ZA 2PXCA 1ZLXA 2WF8A 2X7XA 4G9GA 4QTXA 4RVHA 1Z0IA 3CSDA 3DZKA 4V2UA 4C3ZA 3QEBZ 3D59A 5JATA 1A7AA 4XJXA 2ASVA 4TYPA 4AS3A 1Q0HA 2YBEA 5KQMA 4M46A 2JFFA 1W1WA 3TSZA 4GVXA 2WFZA 3OZSA 1OLXA 5FKJA 2Z6AA 2QL9A 5DI3A 3NRCA 3O9VA 5E0OA 5FFNA 4FXPA 5HCUA 4MSUA 3LLMA 4P38A 4ZVTA 1XNQB 2GB4A 4YWHA 3A6GA 3A9TA 5BWBA 1CVRA 1QC5B 1JDSA 1QHXA 2BHSA 2P5UA 2XDYA 5F1KA 1LZLA 1ZJWA 3GPBA 1FDUA 1L4HA 1WUKS 4HQKA 3MW8A 3CLHA 4HDSA 5TQVA 2O8VA 2X8LA 1R37A 3AHHA 1XWIA 2CMKA 2I6UA 3DBIA 4ZT2A 4IXNA 4KQ6A 1B3RA 3A1DA 3DBLA 5T4FA 3TUIC 2N47A 4MUJA 5B3JA 3FMVA 3H99A 3QVKA 4XJTA 5CFNA 3DONA 1SXJD 3LOPA 4JENA 2MTBA 3W2GA 4PG4A 5H70A 4QUDA 1UOOA 1FFSA 4C7MA 1RQ2A 2FPUA 4Y1RB 3UXHA 1P2SA 1HYEA 5BV2P 1U8CB 1WW2A 2JFPA 5KJ6A 3H0KA 3IALA 3N2ZB 1YL5A 1ZYUA 4IMJB 5LLSA 2A0UA 2MU1A 3DDOA 1G3IA 4J0DA 4W5WA 3ZHUA 4BTEA 2QJTA 1PE0A 4ZQFA 4UQLA 3NH6A 1UAAA 2ID9A 2QRGA 3NIBA 1ZFNA 1Z4PX 1AMOA 2GRUA 1FDIA 2I2WA 2FP3A 1MRSA 3A6EA 3PI7A 4XPZA 3QF4A 3ZZUA 3T7EA 1ABEA 1R16A 1Y9DA 3HVHA 4M76B 5BQPA 3IILA 1NLYA 2RK6A 2P35A 2OVFA 3VJRA 3MUNA 2JKZA 3BSSA 1T15A 1A9OA 1RW4A 2JFNA 2J1LA 2NU7B 4RD0A 4EYOA 1JIKA 1Z56C 3ANSA 5E6UA 1L3IA 3ZDYB 3FLEA 3ZE7A 2J4FA 3TVTA 2OB2A 1QONA 1SUFA 1S1CA 4ASUA 1FJGB 5BXYA 1Y98A 1B8PA 5HZMA 5M7EA 4UUMA 2C9OA 3NM4A 2P7IA 1BH6A 5ICFA 2C00A 3HEBA 1AHPA 3L05A 1MU0A 2B61A 3KXIA 2HMUA 3GA7A 4LMAA 4O4LF 4WZAB 4XWTA 1U9YA 3G8DA 4FZVA 2L2QA 3HDVA 5FTJA 4BBJA 1T0UA 1DAEA 4F8EA 2Y67A 2YVAA 1DTEA 4CIVA 1LH0A 4GE3A 2R96A 2QSZA 3ABOB 1YJAA 1LPPA 3T8YA 4DILA 5JALA 2XRYA 4IIDA 1TOAA 5FL7D 4BN5A 3A9CA 3JALB 4BO3A 3OG9A 2CC2A 3NETA 4WY5A 4EBFA 4HX2A 2Q6TA 5BWCA 4AKIA 4YTEA 4Z1MA 1O0CA 4O25A 5ED4A 1ZQ1A 1V8FA 2X76A 4ATNA 1BC5A 1V3TA 4CTNA 4CT4B 5AM2A 4AUMA 3CBQA 1BXRA 1XMJA 2J5KA 1O9HA 4KMSA 2QW0X 4EO4A 4TZ0A 4EFMA 3PGXA 2J0EA 3ZUGA 5HF8A 2XDWA 1VJTA 2QD1A 3QYFA 4JR2A 3EAQA 2M98A 2J0QA 4BX2A 2PJZA 2ZTMA 4UOZA 1JMYA 2VJDA 3VR6D 1Y4UA 2WJ4A 3RKRA 1OLSA 1T25A 1QFYA 1YCFA 2YL2A 3EBOA 4TZTA 3MGKA 3N0WA 4EHKA 2WE8A 1RTKA 5TRTA 3HGMA 2ARKA 3M4XA 4MS3A 1XXLA 5F4BA 1N7GA 4H4EA 4J7XA 1A27A 4NTZA 4XUDA 1KEPA 1T43A 4BVJA 4E33A 4K9MA 2E5LB 3B13B 4M1WA 1IHPA 3I76A 4EY3A 3RS7A 1B6GA 3KKMA 1R4ZA 1UEIA 1SGWA 2FJUA 2PPVA 4WLUA 2CW5A 3QU9A 1NFFA 1O2DA 3IUPA 4KLZA 3NG1A 3T3HA 4BGUA 1VGRA 1XV5A 4PSAA 2GM5A 1D0SA 3COSA 1R6VA 3QHAA 4ZHQA 3OKPA 4UJ3A 1FP4B 1P7PA 5FOUA 4ND1A 5KMGB 4LDPA 3DOCA 5GMOA 2DT5A 2E4AA 3HMKA 4BKQA 5JQGF 2J3JA 4BV2A 4ZDWA 4BNGA 2CYBA 2BKXA 3B9QA 4C4SA 3QUQA 5AW8A 2DH5A 3CZ5A 1FP2A 3L43A 4R68A 5G0WA 2DBVO 4I5IA 3JZMA 4PAGA 2G09A 2OBXA 4JQCA 3WGHA 5JMWA 1PR3A 4G0ZA 3JTEA 5D85A 1MQ9A 5FTNA 4BQPA 3KB1A 2BDUA 2JH9A 2PS1A 2FAXA 3AEKB 4IIVA 1Q2XA 3G02A 4HWGA 1UPTA 3EE6A 3IAM1 3QNWA 2I1QA 2YNMC 3BK7A 1IYZA 3BRSA 4UHFA 1JEYA 1X1EA 1DAOA 1OR8A 2J3LA 2OBFA 2ZR9A 3THRA 4POOA 1F2TB 3DV9A 4FD3A 3NTOA 4CEJA 1ADBA 5ALRA 1X2BA 5DIFA 3ANMA 3ZWKA 2BF7A 1LDYA 5LP6C 1Y3AA 1O5TA 3NOXA 3I12A 4K03A 5L4SA 3H2HA 3QU2A 1G98A 4D9NA 3IPXA 2XVXA 1MVOA 3KJFA 1E1RD 1JW9B 3QFFA 4O2LA 2JCYA 2J3HA 2SCUA 2RGWA 1GGMA 1JPNA 1XDGA 2LD4A 1RHQA 1CDZA 1OZHA 2I8CA 2X7HA 1VG9B 4AKTA 4Z0TA 3BGWA 1II8A 5J4HA 2G28A 3EDRA 1E4OA 4D9JA 4HAIA 1Q17A 2K7FA 1HG0A 3AOEA 1YDMA 2YYZA 4OB8A 4R51A 2Y93A 2CLIB 2E21A 2WAYA 3DTNA 2AMYA 4IMPA 4DPLA 4DY6A 1GTRA 1M2FA 1ZNXA 5T8KC 3ROFA 4ZVOA 3N3AC 5L3RA 1V48A 2PZAA 3AUAA 1OGJA 3M2PA 4PINA 4CM6A 2VJOA 1US8A 5TMPA 4HDAA 1JKJB 4S35A 3QOXA 4EYGA 3IPCA 3SIPA 4EGJA 1NVFA 2KQUA 2B8NA 4LJ4A 3S99A 5IJZA 4RJIA 2O5RA 3I2YX 2HEGA 3KYDB 1W49A 3LUCA 1ZM4A 2G9QA 5EWJA 8ATCA 3Q15C 3T1HB 4YCBA 1PJBA 4QBFA 1M75A 3KEGA 1H0HA 4C5CA 4CNQA 1JQ5A 5JCZA 4G0XA 5MN5A 1I7DA 3HPQA 4BAUA 4D4IA 5KYVA 2ZRIA 1U0GA 1XZDA 2O2JA 5CA0A 4EVQA 2JVIA 4OH7A 4CDNA 1GCOA 4EHAA 1TECE 1ML3A 4BUCA 2W6NA 4YXFA 4LIPD 4RBNA 4RQBA 2XT9A 4JJGA 1YZUA 4WXRA 5BMVF 2ZSDA 3VBCA 3WGMA 4OU4A 2Q46A 3DAPA 2ATEA 4HLNA 3BYZA 1CQZA 4XQGA 5FB3A 3WRYA 1HL7A 3O8DA 3EX7C 4WN9A 3O91A 1IBSA 4PCUA 4MRNA 3F2VA 3ZOKA 1KZHA 4P08A 1T5OA 3FD8A 1CUXA 3LZCA 1J42A 4YP1A 2PYIA 5DFAA 1LW7A 3VR6H 2IY8A 2PYZA 5K4GA 2CY0A 1MOSA 1NW9B 2ZWMA 3FVQA 3UFBA 2WTUA 4HZIA 5B2EA 2QN3A 3ONNA 2VSOA 1XPOA 1TRKA 2V7VA 4U3JB 2XCTB 1Z6PA 4ALNA 5KQLA 1WXWA 1GPNA 4TV9B 1NQAO 3JYLA 1H66A 1KDRA 3V9PA 4G0UA 3EUFA 2JFVA 3TJZA 1YZYA 1OXXK 4U2DA 1CRZA 5CT5A 1F60A 3ZY4A 1XCLA 4CLOA 2JI9A 1T2VA 4MRAA 4V0RA 4OX9Y 5G0SA 1VJGA 1GPDG 2Q9UA 3CV3A 5JD4A 5JJKA 1E89A 2J9FA 1PU2A 1G7SA 3GLHE 4MGHA 1PWEA 1UJNA 5DBIA 1TYCA 4NJMA 3STXA 3PFBA 3MK31 5DYNA 5EWMA 2CLFB 3FUXA 1KJNA 1X1BA 3IH5A 2YY5A 4Q37A 3TQTA 4LSWA 2GK3A 2Z30A 3GY0A 5BN5B 1JHAA 1RI2A 3ZNPA 3DG9A 3FB4A 2NTEA 4OP3A 1T6NA 4XASA 2WT8A 3CUTA 3EPLA 3F8SA 4RHXA 2PJRA 3U37A 1U3UA 1TL7C 2HMVA 1U04A 4UZSA 2ZIZA 5KWIA 3OOHA 1IH8A 3T95A 3WHIA 1M1UA 2YY6A 1BEZA 3EARA 1SR8A 1TUBA 4G0WA 2V65A 4JI5B 2ZRAA 3EVAA 3GJZA 1KJJA 3CHYA 4CMJA 2VCEA 2AUNA 4NLLA 1JDZA 2XMSA 1P33A 2CHUA 4H1WA 3HN6A 3GUUA 2PDAA 1W87A 5IXJA 3MLAA 1NXQA 3V7WA 2IK8A 3QF4B 2IUYA 3HO8A 3THSA 3DB2A 1WVMA 1L8AA 5F3DA 1J8FA 1A4XA 1SXIA 1TFUA 4UCXA 2CLDX 4MR7B 5DN6A 1BWSA 4K6OA 4RC9A 4J0KA 4WPGA 2Q5LA 4J75A 5A03A 1TNDA 1HLPA 1CUUA 1KYXA 2F90A 1U5BB 3G68A 3BGVA 4LZZA 1A2BA 5IDXA 4IL5A 3I4LA 3VZBA 1CDDA 2CBGA 2D2VA 4GPD1 1X7ZB 3G7UA 4XIGS 5BN3B 4ER0A 1W85A 1QV6A 4JYAB 2GMWA 3I9OA 4F04A 2W4QA 3RIEA 1RZ3A 3M6AA 3ESZA 1ZEMA 3WJAA 5HZHA 2V6FA 1WMEA 5AVXA 2VATA 1DMRA 2JD0A 5AKZA 4HB4A 4B31A 2NUPB 1KDVA 1XRLA 4RHYA 4EA6A 1TCCA 3PC2A 2VJKA 1JDNA 1D9XA 1X38A 4MJ3A 2NPFA 1UJ2A 4RNCA 4MUYA 4RA6A 3Q0IA 1OZGA 1D07A 2I2BA 1L9XA 4QBHA 5D1HA 5THKA 2JJ2A 4YLGA 1WTAA 1QUEA 1PKXA 3AYZB 1RC8A 2WD7B 2O23A 1E3SA 3U4MA 3CC8A 4NMMA 2HTFA 3I37X 4TQAA 5AW2A 3KVNA 3P9YA 2PKWA 3N59A 5D5QA 1NDQA 3NT4A 4Q02A 1U28A 5J4YA 2B6HA 4NJOA 3T41A 4TXNA 3DOHA 5IHXA 4M98A 4LJ6A 2WYOA 5ALQA 5ALSA 3QK7A 1VCNA 3EIOA 1N5IA 1CCWA 2FRVA 1SCAA 1Y5MA 1YK1A 3HKDA 1JKFA 1O4WA 1A82A 3O94A 4RU1A 1KMHA 4X95A 3SFVA 4HPWA 1U9IA 4OG2A 4QPNA 1D3AA 2OCGA 3F7TA 3WLAA 4US2R 2DUUA 5FA5A 1EWTA 3F6PA 9GPBA 2YASA 1EA7A 1M73E 2CB0A 4K9OA 3K1TA 1BQ3A 2WLTA 4DREA 1T2FA 1YIAA 5DMXA 3AERB 1BVYF 2ZRPA 1BE1A 3BD6A 3DUFB 5K3CA 2OCAA 5AD1A 1F9EA 2A57A 3ZCXA 3N2IA 2CVHA 2WSSA 1RYDA 3FJOA 3QW2A 3DF9A 4Q01A 3RARA 4DCNA 1XCJA 4KX3A 3KEFA 1XWFA 5L95A 4LPKA 4WEQA 2HPZA 1I5RA 3AUFA 3RU2A 3AF1A 1NXSA 3HDGA 2DAPA 3KQQA 2HV8A 1YZHA 4OI2A 2GM3A 3SQNA 1XNJA 3O0TA 1JVBA 4M7PA 2ATVA 3AUXA 3N53A 4PZ0A 2JLRA 2OHHA 3T94A 1T2UA 1C9KA 3QPWA 4GSYA 3AYXB 2NGRA 3CY6A 4AICA 5U4XA 1Y3FE 5HVNA 1NJ2A 2X2PA 4AAYA 2IS4A 2YOFA 1F0YA 1TA0A 2JHFA 1NWCA 3P2EA 3R6TA 3SZRA 3A32A 1PJ3A 3W4KA 1SU8A 2A5FA 2GFHA 3FHLA 4PX2A 5J2TF 4DCCA 4XYLA 3C5WP 1NURA 3OCVA 1AT1A 4PRLA 5DP1A 4L4SA 4KZPA 2ZG6A 3GWZA 5KOIA 5IHPA 5IG2A 3QGMA 1M8FA 3SD7A 1V43A 3QEOA 2J33A 1VZ2A 2ZI5A 3OCUA 5ULLA 1FMJA 1N8TA 4AJ1A 1QHGA 2AC2A 2AQ8A 3TB6A 1VZ3A 2QYOA 3ZGLA 4IZ6A 5F1YA 1OXMA 3CJRA 2XT0A 4DAEA 3T3EA 3LSYA 2O07A 4AW9A 2JHCA 3U13A 1EU1A 4WBNB 2WF6A 1EUQA 4HNQA 3PUZA 3WP1B 1FRFS 2II6A 4XOUA 3L04A 4B8WA 1IOLA 2XYQA 2QVGA 2FLVA 4FHEA 3W1EA 5CFQA 1CUAA 1HE5A 2ZJYA 4I9FA 4O2RA 4QGAA 4P7JA 3LY9A 5T41A 5TQ0A 3RS3A 3G9UA 1ZK0A 3C41J 4LRSB 1MEOA 4PX3A 1I6WA 1EDZA 1V11A 1V6SA 1PGPA 1Y5LA 3HLKA 2FQWA 1GFWA 4LSMA 4CR6A 3OTOB 1KI3A 2BISA 1CY7A 1GZDA 3C4QA 3HJUA 2VN8A 3WLIA 3DTVB 3HYTA 4OAQA 1GUDA 3R09A 4E08A 1BKYA 1SK9A 3PWKA 4L51A 3TDMA 4AQDA 1W6RA 4G26A 2G0NA 1U2RA 1A95A 1E7MA 3DZ8A 1HDZA 3NB0A 1FLNA 1TJYA 1GPBA 2AFHA 1WZUA 2BLNA 3G2IA 4CNBA 3HWWA 4NG5A 3IMEA 4X8MA 4I5FA 4YALA 4AP9A 3BIWA 5A4DA 1LQTA 5AFSA 3DLHA 3ZBQA 5A0FA 2WUWE 4QT4A 1PFQA 2QRLA 5G0VA 2Z58A 4N8EA 3PXGA 5JRZA 4RACA 4WBSA 4Q16A 1MP0A 1X9GA 3S68A 4IINA 1J56A 3BWEA 3D7MA 3GPIA 3Q7PA 2YRFA 5JG7A 5K3BA 4Z4QA 2X2OA 1KFCB 3I5MA 1UWVA 2PVPA 3E27A 1ZM2A 3H97A 3PT9A 2FPLA 2QUJA 3HYNA 3H04A 5D00A 4BOYA 1TLLA 1SU4A 3CZAA 4G8BA 2XE4A 2QNIA 1BW9A 5KWSA 1RU3A 4JMLA 4KKXB 3QEMB 2UDPA 2YZNA 3NHMA 5IBQA 4UFPA 3HABA 5ITZA 2QHXA 4I3GA 1H2ZA 1CIJA 2AOWA 3IEIA 1OROA 2ERCA 4GOKA 3H3XA 5EHQA 4QDJA 4X60A 1C81A 1DX9A 3HADA 1JDJA 3ZU6A 5JI2E 1R12A 2XECA 2WWFA 2Y99A 2GYYA 2ZRNA 4Y9RA 5A05A 2I71A 2JIQA 3WAJA 2P9YA 3TD6A 2GDJA 1GUAA 5H3CA 2GEKA 1FSSA 1NKTA 4LBZA 2Y6UA 1GAQA 3H83A 3ADDA 5T6BA 2BCEA 1JFSA 3PF8A 4BRUA 3S81A 1U3DA 3JQBA 4GX1A 2XCQA 3O6VA 1NJFA 1NZDA 5CB0A 2XNJA 3PP8A 1XD2A 1WKBA 5EEGA 5DI3B 1ZOPA 3C8ZA 1XJWA 4JI1B 3ZY3A 4ZOQI 4YRIA 1N6HA 3KD2A 2D4AA 1WLYA 2WF9A 2OBMA 3V1YA 3VDRA 3JQ6A 3TSOA 1EJBA 4QASA 1C1XA 1HRKA 1SVLA 4YACA 4COKA 2Z6VA 5CT9A 3W9UA 4BJHB 4RKWA 4L8VA 5CR9A 2YWGA 4D0SA 3HV2A 1M5UA 2DHEA 2XYGA 2ORYA 2GZAA 4F4JA 5K03A 4HLQB 4I4CA 1X7GA 5FWNA 1T8TA 5ILOA 3RK0A 3DOIA 3HU5A 5H0IA 2DG2A 4D46A 3PD0A 3K9QO 3KSMA 1P1BA 2HJVA 5HJ2A 3QKUA 3LW8A 4RKYA 3F3SA 4AQ7A 1XHEA 2IIVA 1ULBA 1FYDA 1C9JA 1HEYA 3ETCA 3A1VA 1WABA 1SUAA 1IN7A 3RUEA 4JI0B 4CMEC 2DLDA 1TZMA 4E21A 1J23A 1LDBA 1NASA 4OIFA 4CQMB 1DELA 1XL1A 3QXXA 2E4VA 1XX6A 2OG1A 1K6EA 5F21A 4FZRA 3AXTA 1G21E 3IP3A 3LFHA 3HDYA 3BXHA 2VYVD 3PGKA 4PYOA 1EM8B 4B4OA 5KKNB 5KZMB 2WSSD 2Q5QA 3I28A 4F6LA 1OI3A 3RAEC 4MRMA 5A4JA 2E2WA 1P19A 3I62A 5IAOA 1PJCA 2GCIA 2W6JD 4GMFA 3IDSA 3RUIA 2NVUA 3IURA 1JEJA 4CM9D 5CDSA 2C96A 1C0KA 4Q1CA 1RZVA 1EVZA 1XZBA 2DFTA 3P2IA 5KVAA 1U81A 1BJTA 1Z2OX 2ERYA 3VTAA 5GIOE 1E79A 1M74A 2QMUA 2Z5VA 1JQLB 2ODNA 1XMIA 1U1EA 1VBFA 1LSOA 1U9CA 1ZMBA 3OTWA 4I6EA 4YMIA 5ICEA 1V1RB 4XARA 4CT5A 1QLHA 4NDAA 5AVYA 1P4AA 3K8OE 2XV1A 1FP7A 3BXEA 4FC6A 1CUYA 1FP6A 2B37A 5FJIA 4PNEA 1HV8A 3AY7A 3OIGA 3V1NA 2NUAA 3PDIB 1S2IA 2XAUA 2XNCA 4WOCA 3RVRA 4BU1A 1Q7CA 1FRVA 2DKFA 3UICA 2RHMA 3WZ2A 1E2FA 4NI5A 3WGUA 1IJEA 5JJCA 5KNLA 4M2LA 3VR2D 2FX5A 3G0IA 4HRVA 4E6PA 4X3CA 1ZL2A 3WYNA 1M2NA 1R8XA 3M70A 5GONA 1UMKA 4AJNA 3CKLA 4A91A 3EUEA 4B6GA 1TO1E 3JYQA 5KWJA 1KRWA 3ORQA 1KEWA 1SULA 1KEZA 4NFHA 4L28A 5D2CA 2AI2A 1W44A 3NANA 4O4LB 1FXWA 1ZUHA 2ZAMA 1HFKA 4RF2A 4XAQA 3S40A 5I51A 1VBKA 1XCOA 4UVIA 2JLUA 1NUQA 1U6IA 2ZT6A 2OG2A 3P94A 3H86A 2A33A 4HL6A 3QX3A 1YOBA 2B34A 3VPFA 1AV6A 2K2QB 4K28A 1NXOA 4XGIA 2DUNA 4EKDA 1R0SA 3VC3A 4GR4A 1XTJA 3IB6A 1BN7A 1A8IA 4FS3A 4I99A 2P6RA 3Q2OA 3KP1A 4KIGA 1J1ZA 3DXYA 5D3MB 2MMGA 3OJLA 3ZDFA 1NJ6A 5ESRA 2VHQA 3QE9Y 4QRHA 3CKYA 3FOFC 3MS7A 1MAVA 3M9XA 5K3AA 3VOBA 4TGLA 5AHXA 4ZA2A 3U3KA 1S8AA 3E7FA 4I1SA 4P1ZA 2P1RA 3ZV5A 3KQLA 5JAUA 2I2DA 1DJOA 1QKKA 4F60A 2CUKA 2Y6VA 1XKTA 2OECA 1F6WA 2Q5HA 1SY7A 3BTUA 3DV0A 4S1PA 2ZI7A 2XYRA 2BMJA 2GA9A 4FFMA 4IGIA 4R8MA 4WKBA 2CLSA 3PLAE 4NP6A 4R3NA 3H2BA 3B3QA 3EG5A 3FBGA 3OX1A 3OU2A 5H59A 1RJEA 4YVFA 1VJ5A 3RSCA 3DLBA 4IH4A 3ROKA 4DJ5X 3W6PA 1LQUA 3ETNA 2DPXA 2J7PD 2QAJA 1DHRA 2ZBEA 1JDPA 4EF6A 3KXPA 3UMGA 5GQSA 4NCNA 3TQCA 4CCYA 4AXXA 1LNZA 2OLKA 3BJMA 6LDHA 2FYTA 3PHGA 4DRXB 2O6HA 3NIFB 4KR9A 3DLCA 1QIIA 4B45A 1N36B 3SP1A 2H57A 3NJ4A 5MHTA 1RKBA 3Q98A 1JKJA 1MAUA 3TAXA 5A7GA 1IMOA 2DCUA 3PB3A 4OLFA 3E48A 2QWXA 5LYJA 3T7AA 2NO4A 3GROA 4QOHA 4PWYA 2OZPA 3UK0A 3EDQA 4CEJB 2C1XA 4OXKA 4F72A 4LZPA 2V7PA 2IPMA 4DRYA 5FOSA 2E4WA 3ZY6A 1TD9A 5BVHB 4IFEA 3D2LA 3BWYA 3NIWA 4BJ5A 4CETA 4TN1A 4W8GA 5EFOA 1E5LA 3OZXA 3QITA 4Z86A 3UMCA 1I3MA 2EQBA 1Q3HA 3DMGA 2Q3LA 2CLEB 1U2ZA 1WULS 2WU8A 1RJ9A 1AURA 2ZIVB 4LVCA 3ZHBA 1D1QA 3OPNA 4NMHA 1II8B 3WL8A 4BLTA 2OXIA 3HY3A 3TZQA 3PJDA 3I9JA 4KJZA 2X4GA 1FQWA 1A9TA 1N0HA 2LWIA 5KUTA 2ZYGA 2R1ZA 3OEHD 4QDXA 4GS5A 4P2BA 2Y1KA 3JVDA 5NLLA 3H8VA 3K0CC 4HMQA 1GCIA 3VPSA 4II3A 4NOLA 1JI3A 4RXMA 3QLTA 4B3CA 2X0JA 4NAVA 5FRDA 1E0KA 1TKCA 2HQSA 2DFKB 5I9NA 3GLGB 2BC9A 1JGTA 5C53B 1TUEA 4W9NA 1IHXA 4IIEA 2AKYA 3CLSC 3M4YA 4MQLA 4CMEA 4EPVA 1QHHA 2OE2A 3FKJA 3FPAA 3I1JA 4I50F 1Z37A 4BVHA 4ER7A 5K45A 4X1IB 1GNQA 2QRVA 5E4YA 5DDIP 1G291 2G67A 4E11A 3D2AA 3H8WA 4EITA 4PX9A 1N0VC 5IARA 3OESA 3R8CA 2C2BA 4JOQA 3B2NA 3EMBA 3H11A 4GLFA 1VLZA 1VE6A 3PRHA 3JQGB 4R2KA 1P3DA 1XSEA 4JP3A 2H08A 1IBLB 5TX7A 1XEWY 2IODA 3C5EA 3UKJA 2EXXA 4PFKA 3T52A 3KQNA 4DIMA 2WE7A 1F4VA 2XH8A 1SC9A 2P62A 3LY5A 2NQ2C 2P9TA 1ND5A 2ZRKA 4YAOA 1O57A 1SZJG 4P7BA 1MH9A 2CDNA 3EPHA 2VJQA 2UVDA 1HLGA 1XU4A 3TXYA 3QZUA 3D8HA 3KZ1E 4NAHA 5IEBA 3S3TA 3KEQA 1SCDA 4HFMA 1TEHA 4KP7A 3OO1A 3TCKA 3T9CA 1K4KA 3STTA 3VVMA 5M3BA 4RHFA 1RFGE 1M8KA 2JLZA 1U8TA 4HNAA 2WD9A 3TTXA 4Q4CA 4R40A 1TJ4A 1DJPA 1ZBDA 2WHPB 5LQNA 3IT3A 3OZDA 4IQ8A 5JT1A 2QR2A 1L4KA 2BLLA 3LO5A 4YJDA 3K73O 1QG6A 3NZEA 4LDJA 5AVZA 1E61A 2ACWA 4MKXA 4HO1X 2GR9A 4Q47A 2BZSA 3GBVA 3IQXA 4YMGA 1YT5A 1JTVA 2PT9A 3T7CA 2AI3A 1SM4A 4BLPA 4CUJA 4F3KA 4URVR 1BA2A 1KQOA 1JE1A 2ADMA 3U48A 2H7CA 4KX5A 3C3DA 5C81A 3QLVA 1XDSA 1OE0A 2YJZA 4MB6A 4X93A 3DW1X 1RAIA 2M6RA 4K9PA 3V8EA 2BTQA 4F0JA 1FFXA 3FA2A 4Q1AA 4PHGA 2WI8A 2FPSA 2VPYA 2ODEA 3IUJA 1N1GA 4JL6A 4EARA 4WZBB 4DM4A 5G4LA 4IUCS 3TW0A 4CG3A 4DA4A 4L95C 5ER9A 5F73A 4KPYA 1NW8A 2JG3A 2APJA 5LA6B 1CZLA 4W4TA 4Y2PA 2CJPA 5CDFE 4DDWA 1L7PA 4LFAB 4KR6A 6REQA 1E2KA 1JI0A 1Z4LA 3C8HA 3FJYA 4WOKA 1PJ4A 1C4XA 4YCAA 1J0DA 1E3WA 1X8XA 3S2IA 3VC1A 4A10A 3D3KA 1V4VA 4ZEVA 3OCWA 4JJ8A 1AUQA 3IEKA 2J08A 3PGVA 3GT7A 1AKYA 3DR3A 4M8NE 1UBUS 5LKRA 1RXSA 2CWWA 3CMMA 1CZOA 2AKEA 3PWTA 5I9LA 2PUTA 1YR9A 4ZGGA 3EVNA 5FPPA 1YVDA 3CKKA 4AJEA 5C8YF 5K0FA 3RASA 1QJ4A 3NPAA 1JJBA 1IDN1 2GD0A 4LOLA 3RBVA 2VSYA 4URZR 4PWZA 5LLTA 5H83A 5FHQA 3O3CA 1LC0A 4GKJB 2O0LA 2R6AA 2EKBA 3ENWA 3ITKA 4KW7A 3AHIA 5KX5B 1QAMA 2NU9A 1KI6A 2JFBA 2DJ5A 3NC4A 3T9DA 2A58A 3C7DB 5JRDS 5B7GA 3ZX5A 2EIXA 4LYDA 4XTCS 2D3WA 3R76A 3DEJA 2J48A 3NT2A 4RANA 3TR6A 4E4YA 1A7JA 3I4FA 3FYUA 1NSYA 4LDZA 3ZDDA 1CQPA 5J2UA 3H6KA 3JW8A 3KUKA 1BS2A 1PV1A 2WIKA 2E0IA 3WI7A 2UYCA 3SZ3A 4FYVA 1U0EA 4ODIA 4L50A 2Z95A 5FYDA 4CEHA 4XQCA 4KDFA 5CYGA 5LDDC 1H0RA 1IIBA 1T2AA 3RPEA 4BP9A 2D62A 1Z0FA 2G5PA 2NO0A 2RHBA 4ZOCA 3SM9A 5KI6A 1YBAA 2FMFA 1RNLA 1SWVA 1U5CA 1CZNA 3GJ0A 1DRVA 1GOTA 1FNSA 1A77A 1G5RA 2ZJ4A 2R6GA 4F9TA 3R5HA 2ZIWB 1GLGA 1M34E 1XJ5A 3OBBA 1FTNA 4X24A 3V55A 4L5BA 5BUZA 1MNQA 1EFTA 5GIPE 1W36C 5SY6A 1A50B 1PVVA 1QU3A 4OO3A 5TVKA 3WGNA 1AQYA 2FEXA 3C6KA 4TXJA 3MPUA 4AIIA 1Z22A 3COYA 2KE5A 4YQYA 1ULUA 4RZ3A 4YUYA 2BKUA 5HKBA 3FWYA 4QA9A 1Q5PA 3WBBA 2B8TA 1TJNA 2GRJA 2QD5A 3A4NA 1YNOA 2QLMA 4CQJA 4MUGA 2FX3A 1A76A 3D5QA 4F6CA 5BSVA 4DEYA 2GLTA 4B8YA 1ABFA 3AP2A 1D4ZA 1DTWA 4U2KA 5J23A 2DLNA 1XEWX 2E89A 4QVKA 4F06A 3LC7O 1P0PA 3WLRA 2JLWA 3AY0A 1UXIA 4TRMA 4WQMA 2VDUE 1ORDA 1YI8A 4DEVA 1QRRA 3AP1A 1Q14A 5F12A 1R4AA 3MD9A 4EYQA 2XCSB 2QT9A 1J8VA 1NE2A 4C0QC 3HSKA 2HUPA 3WYBA 2FEPA 4HDSB 2GPSA 3BGOS 4JGBA 4KYVA 3T1OA 1E96A 2HIMA 3MBOA 5AVKA 4PO1A 2PUDA 3QHQA 1RAAA 4I6GA 4Q03A 3F90A 3L1IA 5EE9A 5BR8B 6REQB 2BFWA 4XD2A 1U0OC 3SC6A 3QWHA 3TEJA 2GTPA 4Z8XA 4WLFA 4XVHA 1G5FA 2IITA 5CIWA 4AVYA 2JBHA 4GOMD 1YQWA 1M67A 1TXGA 3FR8A 3PEUA 3QU4A 4ZWNA 4B9AA 5EHXA 4MR9A 1CQJB 1RRCA 1IU9A 3H84A 3IESA 4FKMA 3VR1A 4HGOA 4D2IA 1NJSA 1RXVA 2VTEA 4YR7A 3Q0TA 5AJYA 4BO9A 4ENWA 3H2KA 4FGSA 1OYYA 4UE3S 4V38A 1UPXA 2H7VA 3BL8A 2J0SA 3K5WA 3QIVA 2FMHA 3P8ZA 5FIUA 3RADC 1RZRA 4ZVKA 4DLZA 1YHYA 3OCZA 1XDUA 1DKQA 4OY3A 1MAHA 2A78A 3ICCA 1WKVA 2I62A 4WDRA 1NVTA 1M8PA 1MABB 2GF9A 5JQGA 4M89A 1IEWA 3IXQA 3OFNA 4FNGA 3N74A 3O0DA 5CK5A 4Z9BA 3DL0A 2IYPA 4WJKB 2GCOA 3JASB 3PD7A 4OP2A 2F1RA 5FA8A 5LFAA 2ZR7A 3F5QA 4JJFA 4U8HA 2AW3A 3EZ9A 4RL6A 4HV4A 1DBPA 4XVQA 1LSJA 3DHNA 3GJSA 4C05A 3VAAA 4JUCA 3UKOA 4G37A 2ZYTX 1LPBB 3KZCA 2HT1A 3A1EA 3MAJA 3QKSA 4L1KA 4DM7A 3I9V6 1N77A 4HGYA 2EFEB 1SAYA 1P77A 5ESWA 2E3JA 1AX9A 1FPQA 2BJHA 4FCWA 5GONF 1FUKA 3RFVA 3UJ6A 5HYVA 3IVMA 3NC1C 5F7ZA 3U9LA 1N6NA 4EPWA 4QHSA 4GFDA 2O2HA 2QU7A 1H2EA 2FXIA 1I7NA 5CEFA 2NO1A 4WOPA 2Y66A 2ZJ1A 1V45E 3VDMA 4D4JA 4LSGA 4ZQCB 1QTNA 1HDXA 4M0CA 1A7KA 1OX5A 5CFZA 2H2WA 4CZ2A 4YDQA 1X7HA 5IJ0A 4ZCQA 2JCXA 1WR8A 2XKAA 3HKDB 5DBGA 2OM6A 2WWGA 3UXEA 4II2A 3LLUA 3LP8A 4AB1A 1USUA 4PO3X 3C6YA 2C5HA 3LGAA 1BEUB 1EIWA 1R88A 2DT8A 4CHGA 1JR2A 2YJGA 2PS9A 1P5ZB 1BXGB 2UZ4A 3NEPX 2RG7A 4RZIA 3CB4A 1QK3A 3EVFA 4A1FA 4QTTB 5KOHA 2CHQA 1HT1E 1OPRA 1F2TA 5FEMA 2H4ZA 2REXB 2NWQA 3CT6A 1WETA 3UHOA 3A2NA 4O2BA 3ZVLA 4G5XA 4M60A 3K32A 4P98A 2QMHA 4KXLA 1R3DA 1S7GA 4P0PB 5CLLA 4LKOA 3GGGA 3KD3A 5T8KA 3EDMA 3NVMB 3O1LA 4ZAFA 1R5JA 4WACA </