5MQ6A

Polycyclic ketone monooxygenase from the thermophilic fungus thermothelomyces thermophila
Total Genus 245
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
245
sequence length
642
structure length
636
Chain Sequence
PEDLKLHQLSQKYTAEAAKRFRPEGLGQFIRLKEVGNERFRALAEDPWVDHAALNAKEPVKDGSRYKFIILGAGYGGLLYAVRLAEAGLASGPDDILMVDAAGGFGGTWWWNRYPGLHCDVESYSYMPLLEETGYIPKSKYAAGPELLEHAYRIATQWKLHDKALFRSNVKTIRWDDESRLWSLEVTEGRGPGQQSRELKLQARYVLLASGILTNPQVPKIPGLETFTGPVFHTARWNYDVTGGSPTDEALNRLEGKRVGIIGTGATAIQVVPKLAKYAKELYVFQRTPSGVWWRGQRPTDPVEWKTKIARKKGWQRERMLNLDSYLTDAAEEGQENMVADGWTEMPAFSAVIGSPRHGIVEPTPEKIAEHLGRLYKLDLPHAEQVRARTDSIVKDPKTAAKLKAWYPTWCKRPTFSDEYLQTFNLPNVHLVDTDGKGVDAANPSGLVVADKEYPLDILVLSTGYVTPSIGGGSPAVRTGVDIYGRGGKSLDDKWQTHGAATLHGVCSNGFPNLFFTPLSQSSQAANNAFTLDVGTEHIVQVIKTAEDRVDGDALVEVTSEAEEAWSFEIMKHAGWFASVTGCTPGYITSEGEAPMEMAKRARSGNLSQGMASYMKLLQEYRADGSLKGFDISSRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Pyridine nucleotide-disulfide oxidoreductase-like protein
publication title Polycyclic Ketone Monooxygenase from the Thermophilic Fungus Thermothelomyces thermophila: A Structurally Distinct Biocatalyst for Bulky Substrates.
pubmed doi rcsb
source organism Myceliophthora thermophila
total genus 245
structure length 636
sequence length 642
ec nomenclature
pdb deposition date 2016-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...