5MXPA

Haloalkane dehalogenase dmxa from marinobacter sp. elb17 possessing a unique catalytic residue
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
294
structure length
294
Chain Sequence
TQKPADFPYPSHFADVLGSRMHYVEHGNGDPLLFLHGQPTWSYLWRKVLPELEGKGRLIAVDLIGYGMSDKPDIPYDIDDHIRYLDGFIEALGLDRITIVCHDWGSFFGFHYAHRHPERIKGLAFMEAMLNPIPGYDAFDPQTRAFFQTLRSSQANAERMMMDENQFVENILPAMICRPLERQELDAYRAPWTDRQSRRILCTFPQNLCIGKEPASVYRMQTAYIEWLGQTDLPKLLIHAEPGFLIPAPAVDQYRQQLPNLETAFVGSGLHYIQEDQPQKIGQAIAQWMDRCGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of paradoxically high thermostability of dehalogenase from psychrophilic bacterium
rcsb
source organism Marinobacter sp. elb17
molecule tags Hydrolase
molecule keywords Alpha/beta hydrolase
total genus 109
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2017-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...