5N2PA

Sulfolobus solfataricus tryptophan synthase a
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
241
structure length
241
Chain Sequence
GKMLVVYMTLGYPNVQSFKDFIIGAVENGADILELGIPPKYAKYDGPVIRKSYDKVKGLDIWPLIEDIRKDVGVPIIALTYLEDWVDQLENFLNMIKDVKLDGILFPDLLIDYIDDLDKIDGIIKNKGLKNVIFTSPSVPDLLIHKVSKISDLFLYYGVRPTTGVPIPVSVKQLINRVRNLVENKLIVGFGLSSESDLRDALSAGADGIAIGTVFIEEIERNGVKSAINLVKKFRAILDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Tryptophan synthase alpha chain
publication title Evolution of alternative functional interfaces in the metabolic channel Tryptophan Synthase: indels as mechanistic drivers
rcsb
source organism Sulfolobus solfataricus
total genus 92
structure length 241
sequence length 241
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2017-02-08
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...