5NG7A

Novel epoxide hydrolases belonging to the alpha/beta hydrolases superfamily in metagenomes from hot environments
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
292
structure length
292
Chain Sequence
NEMLKHEYVKVNGIKMHYVTQGKGKLLLLLHGFPDFWYVWRFQIPALAKHFRVVAPDLRGYNETDKPEGVENYRLDLLAKDILGLIKALGEEHAVVVGHDWGGIISWTLTAFNPQAVEKLVILNAPHPKAYMTRTKNSLRQLQKSWYVFFFQVANIPEKILSRNEFAFLKNMLIQSFVRRDLLTEEDLRIYVDAWSKSGALTSALNYYRANLNPDIIFSEKTVVFPKIKVPTLVIWGEKDVAISKDLIVNMEDFIEAPYSIKYFPECGHWVQLEEPELVRKHIEEFILKSDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords epoxide hydrolase
publication title New Thermophilic alpha / beta Class Epoxide Hydrolases Found in Metagenomes From Hot Environments.
pubmed doi rcsb
source organism Metagenome
total genus 112
structure length 292
sequence length 292
chains with identical sequence B
ec nomenclature ec 3.3.2.10: Soluble epoxide hydrolase.
pdb deposition date 2017-03-17
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...