5NRMA

Crystal structure of the sixth cohesin from acetivibrio cellulolyticus' scaffoldin b in complex with cel5 dockerin s51i, l52n mutant
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
141
structure length
140
Chain Sequence
TGFNLSIDTVEGNPGSSVVVPVKLSGISKNGISTADFTVTYDATKLEYISGDAGSIVTNPGVNFGINESDGKLKVLFLDYTMSTGYISTDGVFANLNFNIKSSAAIGSKAEVSISGTPTFGDSTLTPVVAKVTNGAVNLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-function analyses generate novel specificities to assemble the components of multienzyme bacterial cellulosome complexes.
pubmed doi rcsb
molecule keywords Endoglucanase
molecule tags Cell adhesion
source organism Acetivibrio cellulolyticus
total genus 32
structure length 140
sequence length 141
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2017-04-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...