5T2A6

Cryoem structure of the leishmania donovani 80s ribosome at 2.9 angstrom resolution
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
164
structure length
164
Chain Sequence
MRNYNNFNRVWKAPRRPFEKERLDREMKLCGQYGLRCKREIWRVNMTLSKMRRTARLLLTLPENHPRRLLEGSAIMRRCHEYGFLDEEKDKLDYVLSLTVPDILERRLQTIVFKAGLAKSVHHARVLIQQRHIAVAKQIVTIPSFIVRVSSERHIAFADASPFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords LSU-alpha
publication title Structures and stabilization of kinetoplastid-specific split rRNAs revealed by comparing leishmanial and human ribosomes.
pubmed doi rcsb
total genus 44
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2016-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
6 PF00163 Ribosomal_S4 Ribosomal protein S4/S9 N-terminal domain
6 PF01479 S4 S4 domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...