5TBNA

Solution nmr structure of phf20 phd domain in complex with a histone h3k4me2 peptide
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
57
structure length
57
Chain Sequence
GHMDRYDFEVVRCICEVQEENDFMIQCEECQCWQHGVCMGLLEENVPEKYTCYVCQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title PHF20 Readers Link Methylation of Histone H3K4 and p53 with H4K16 Acetylation.
pubmed doi rcsb
molecule keywords PHD finger protein 20
molecule tags Transcription / structural protein
source organism Homo sapiens
total genus 11
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2016-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.40.10 Alpha Beta 2-Layer Sandwich Herpes Virus-1 Zinc/RING finger domain, C3HC4 (zinc finger) 5tbnA00
5B77A 1VYXA 3N9LA 2JMDA 4AUQB 3VK6A 3O7AA 2PUYA 5H1UA 5DKAA 2L80A 2CT2A 2VJFB 3O34A 2G45A 2YHOA 2KFTA 2L43A 3DPLR 3RPGB 5TDRA 2BAYA 2LGLA 4I7DA 2VP7A 5LKXA 4YATA 5G0FA 4Q6FA 3DQVR 3ZTGA 2YSJA 2LGGA 3LQHA 2LRIC 5LCWB 2LN0A 2PNXA 2UZGA 4CA1A 4GNEA 2LGKA 2RSDA 5TABA 2KWKA 2F6JA 2AN6A 2FSAA 2CSYA 5D1MB 2M1RA 2MUMA 4AVXA 1WEUA 4AP4A 4L58A 1WIMA 1WESA 3SOXA 3QZVA 2EGPA 3L1ZB 2K17A 3O37A 5FERA 2KE1A 5H1VA 4UP5A 2VPDA 4TKPB 4YADA 3T7LA 2VPEA 2C2LA 5H9MA 1RMDA 1X4IA 1ZBDB 2RI7A 1WEEA 2LXHC 3ZPVE 4C9ZA 4V3LC 5B8DA 2KGGA 4YABA 2M6MA 3N9MA 3L11A 5C13A 1WEQA 4AYCA 1VD4A 5KH7A 5B78A 4A4CA 3ZVZB 4FK5A 2ECNA 3FL2A 3I2DA 4ZQLA 1MM3A 5J3XA 4LJNA 5H1TA 4B7YC 5FEYA 5LKUA 3LRQA 2L5UA 4QF2A 3V43A 2MNZA 4N4FA 3HCTA 5AITA 5TBNA 3O35A 2MT5A 1JM7B 2L0BA 4A49A 3SOWA 3MHHA 2C2VS 2IDAA 5G05B 2JMIA 2FUIA 3N9NA 1XWHA 3ZVYA 5DINA 4W4UA 5D1KB 5TDWA 1JOCA 3PHDA 4GB0A 5FB0A 4WA6A 4R7EA 1VFYA 4FJCA 2VJEA 4B86C 3ZPV1 2MA6A 3U5MA 3T6RA 1X4UA 2ECWA 2M85A 2K1JA 4LADB 2H0DA 4BBQA 4S3OC 5I3LA 3M99A 3M62A 4FO9A 3U5NA 5KH9A 4O64A 4R2YA 2EA6A 4WZ0A 3U5OA 4PTBA 3HCUA 5AIUA 4QF3A 4IC2A 4UI9B 4F52B 2Y43A 4WZ2A 1Z2QA 2QIZA 1WEPA 2EODA 2I50A 1WEMA 2KWOA 3L1XA 3MHSA 1FBVA 3U5PA 4YAXA 5JG6A 3KV5A 1BORA 4XI1A 3GL6A 2XB1A 4YBSA 1MM2A 1WE9A 3N9QA 2E6RA 4FIPA 2CKLA 2LQ6A 2Y1NA 2E6SA 3LQJA 3GV4A 1DVPA 5G04B 2MIQA 3RTRB 2XEUA 2KGIA 2YUCA 3SHBA 2KWNA 2OXQC 3ASLA 2ECIA 5B75A 3N9PA 4YBMA 2KREA 2YU4A 3PUQA 4AYCB 5TRBA 3PURA 4LK9A 3NG2A 4PPEA 2ZETC 2G6QA 4BHWA 2K16A 2KU3A 5C11A 1HYJA 3EB5A 5B76A 2VJFA 3C6WA 4IC3A 2DX8A 1FP0A 3RPGC 3ZNIA 2YHNA 4ZDTA 3ZYQA 1CHCA 1WEOA 1T1HA 2D8SA 2YSMA 4NN2A 2ECJA 3O33A 3IHPA 2KWJA 4A0CD 2MNYA 2LXPC 4LLBA 4A4BA 2HDPA 5FB1A 2K4DA 4I7CA 2YW8A 5LKTA 2YURA 5B79A 2JMJA 4I7BA 3N9OA 2VJEB 2QJ0A 4GNDA 1WGMA 1K2FA 4ZUXU 2MA5A 4YBTA 2KR4A 1IYMA 2G43A 2VPBA 1V87A 2H0DB 1LDKC 3LQIA 4S3OB 2Y1MA 1WENA 5D1LB 3HCSA 2LGVA 2VPGA 3KNVA 1X4JA 1WILA 3O36A 2ECGA 1F62A 2FUUA 2YREA 2MD7B 2QICA 3EB6A 4V3KC 2F42A 5EYAF 4P5OB 2KIZA 4MSXA 1E4UA 4LKAA 2LV9A 4N3WA 5KH3A 2YT5A 4YC9A 1WEWA 1G25A 4L7XA 2VNFA 3HTKC 2YQLA 1Z60A 1HYIA 2LDRA 4R8PK 1U6GB 2YYRA 2L75A 2M3HA 4CCGX 3KQIA 1LDJB 1JM7A 2NAAA 5LKZA 2CKLB 4UP0A 2ECTA 3M63A 2HYED 2KYUA 2MD8C 2JRJA 2YQMA 4GNGA 1WFKA 2CSZA 1N87A 2F6NA 4MVTA 1Z6UA 3SOUA 1WEVA 3KV6A 2ECVA 4X3GA 4WZ3B 4GNFA 3O70A 3C5KA
chains in the Genus database with same CATH superfamily
3T9KA 5B77A 1VYXA 3N9LA 2JMDA 4AUQB 3VK6A 3O7AA 2PUYA 5H1UA 5DKAA 2OWAA 2L80A 2CT2A 2VJFB 2CSVA 3O34A 2G45A 2YHOA 2KFTA 2L43A 3DPLR 2FD4A 3RPGB 4F1PA 5TDRA 2BAYA 2LGLA 4I7DA 4Z0OA 2VP7A 5LKXA 4YATA 5G0FA 1DCQA 4Q6FA 3DQVR 3ZTGA 2YSJA 2LGGA 3LQHA 2LRIC 5LCWB 2LN0A 2PNXA 2UZGA 3H7HA 4CA1A 4GNEA 2LGKA 2RSDA 3DDTA 2L7PA 5TABA 2KWKA 2F6JA 2AN6A 5SVIA 2FSAA 2CSYA 5SVXA 5D1MB 2M1RA 2MUMA 4AVXA 1WEUA 4AP4A 3JUEA 4L58A 1WIMA 1WESA 3SOXA 3QZVA 2EGPA 3L1ZB 2K17A 3O37A 5FERA 2KE1A 5H1VA 4UP5A 2VPDA 3FEHA 4TKPB 3KDEC 3DWDA 4YADA 3T7LA 2VPEA 2C2LA 5K3QA 5H9MA 1RMDA 1X4IA 1ZBDB 2RI7A 4QQ4A 1WEEA 2LXHC 3ZPVE 4C9ZA 4V3LC 5B8DA 2KGGA 4YABA 4Z0RA 2M6MA 3N9MA 3L11A 5C13A 1WEQA 4AYCA 1VD4A 5KH7A 5B78A 4A4CA 3ZVZB 2YVRA 4FK5A 2ECNA 3FL2A 3I2DA 3FAOA 4ZQLA 1MM3A 5J3XA 4LJNA 5H1TA 4B7YC 5FEYA 5LKUA 3LRQA 2L5UA 4QF2A 2CONA 2B0OE 3V43A 4OGEA 2MNZA 4N4FA 1MBMA 3HCTA 5AITA 2KKXA 5TBNA 3O35A 2MT5A 1JM7B 2L0BA 4A49A 3SOWA 3MHHA 2C2VS 2IDAA 5G05B 2JMIA 2FUIA 3N9NA 1XWHA 3ZVYA 3FJUB 3Q1DA 5DINA 4W4UA 5D1KB 5TDWA 1JOCA 3PHDA 4GB0A 5FB0A 4WA6A 4R7EA 1VFYA 4FJCA 2VJEA 4B86C 3ZPV1 2MA6A 3U5MA 3T6RA 1X4UA 2ECWA 2M85A 2K1JA 4LADB 2CRRA 3O47A 3FANA 2H0DA 4BBQA 4S3OC 5I3LA 2DSMA 2DJAA 3M99A 3M62A 4FO9A 3U5NA 5KH9A 4O64A 4R2YA 3LVRE 2EA6A 4WZ0A 3U5OA 4PTBA 3HCUA 5AIUA 4QF3A 4IC2A 4UI9B 4F52B 2Y43A 4WZ2A 1Z2QA 2QIZA 1WEPA 2EODA 2I50A 1WEMA 2KWOA 3L1XA 3MHSA 1FBVA 3U5PA 4YAXA 5JG6A 5SVIB 3KV5A 1BORA 3E2DA 2MKEA 4XI1A 2LAUA 3GL6A 2E61A 2XB1A 4YBSA 3LVQE 1MM2A 1WE9A 3N9QA 2E6RA 4FIPA 2CKLA 2LQ6A 2Y1NA 2E6SA 2M13A 2XOCA 3LQJA 3GV4A 1DVPA 5G04B 2MIQA 3RTRB 5SVYA 2XEUA 2KGIA 2YUCA 2XOYA 3SHBA 2KWNA 2OXQC 3ASLA 2ECIA 5B75A 3N9PA 3LDYA 4YBMA 2KREA 2YU4A 3PUQA 4AYCB 5TRBA 3PURA 4LK9A 4O62A 3NG2A 2XP0A 4PPEA 2ZETC 2G6QA 2P57A 4BHWA 2K16A 2KU3A 5C11A 1HYJA 3EB5A 5B76A 2VJFA 3C6WA 4IC3A 3PLWA 2DX8A 1FP0A 3RPGC 3ZNIA 2YHNA 4ZDTA 3ZYQA 1CHCA 1WEOA 1T1HA 2D8SA 2YSMA 4NN2A 2ECJA 3O33A 3IHPA 2KWJA 4A0CD 2MNYA 2LXPC 4LLBA 3SUBA 4A4BA 2HDPA 5FB1A 2K4DA 4I7CA 2YW8A 5LKTA 2YURA 5B79A 2JMJA 4I7BA 3N9OA 2VJEB 2IQJA 4H9DA 2QJ0A 4GNDA 4OGCA 1WGMA 1K2FA 4ZUXU 2EGMA 2RR4A 2MA5A 4YBTA 2KR4A 1IYMA 2G43A 2EXUA 2VPBA 1V87A 2H0DB 1LDKC 3LQIA 4S3OB 2Y1MA 1WENA 5D1LB 3HCSA 2LGVA 2VPGA 3KNVA 1X4JA 2XOZA 1WILA 3O36A 2D8UA 2ECGA 1F62A 2FUUA 2YREA 2MD7B 2QICA 3EB6A 4V3KC 2F42A 5EYAF 4P5OB 2KIZA 4MSXA 1E4UA 2CRWA 4LKAA 2LV9A 4N3WA 5KH3A 2YT5A 2JM3A 1WEWA 4YC9A 1G25A 4L7XA 2JUNA 2VNFA 3HTKC 2YQLA 1Z60A 2FFWA 1HYIA 2LDRA 3LJUX 4R8PK 1U6GB 2YYRA 2L75A 2M3HA 4CCGX 3KQIA 1LDJB 1JM7A 2NAAA 5LKZA 2CKLB 4UP0A 2ECTA 3M63A 2HYED 2KYUA 2JRJA 2YQMA 4GNGA 2MD8C 3M7KA 1WFKA 2CSZA 1N87A 2F6NA 4MVTA 1Z6UA 3SOUA 1WEVA 3FM8C 3KV6A 2ECVA 3MDBC 2KKYA 4X3GA 4WZ3B 4GNFA 3O70A 3C5KA
chains in the Genus database with same CATH topology
5B77A 1VYXA 3N9LA 2JMDA 4AUQB 3VK6A 3O7AA 2PUYA 5H1UA 5DKAA 2L80A 2CT2A 2VJFB 3O34A 2G45A 2YHOA 2KFTA 2L43A 3DPLR 3RPGB 5TDRA 2BAYA 2LGLA 4I7DA 2VP7A 5LKXA 4YATA 5G0FA 4Q6FA 3DQVR 3ZTGA 2YSJA 2LGGA 3LQHA 2LRIC 5LCWB 2LN0A 2PNXA 2UZGA 4CA1A 4GNEA 2LGKA 2RSDA 5TABA 2KWKA 2F6JA 2AN6A 2FSAA 2CSYA 5D1MB 2M1RA 2MUMA 4AVXA 1WEUA 4AP4A 4L58A 1WIMA 1WESA 3SOXA 3QZVA 2EGPA 3L1ZB 2K17A 3O37A 5FERA 2KE1A 5H1VA 4UP5A 2VPDA 4TKPB 4YADA 3T7LA 2VPEA 2C2LA 5H9MA 1RMDA 1X4IA 1ZBDB 2RI7A 1WEEA 2LXHC 3ZPVE 4C9ZA 4V3LC 5B8DA 2KGGA 4YABA 2M6MA 3N9MA 3L11A 5C13A 1WEQA 4AYCA 1VD4A 5KH7A 5B78A 4A4CA 3ZVZB 4FK5A 2ECNA 3FL2A 3I2DA 4ZQLA 1MM3A 5J3XA 4LJNA 5H1TA 4B7YC 5FEYA 5LKUA 3LRQA 2L5UA 4QF2A 3V43A 2MNZA 4N4FA 3HCTA 5AITA 5TBNA 3O35A 2MT5A 1JM7B 2L0BA 4A49A 3SOWA 3MHHA 2C2VS 2IDAA 5G05B 2JMIA 2FUIA 3N9NA 1XWHA 3ZVYA 5DINA 4W4UA 5D1KB 5TDWA 1JOCA 3PHDA 4GB0A 5FB0A 4WA6A 4R7EA 1VFYA 4FJCA 2VJEA 4B86C 3ZPV1 2MA6A 3U5MA 3T6RA 1X4UA 2ECWA 2M85A 2K1JA 4LADB 2H0DA 4BBQA 4S3OC 5I3LA 3M99A 3M62A 4FO9A 3U5NA 5KH9A 4O64A 4R2YA 2EA6A 4WZ0A 3U5OA 4PTBA 3HCUA 5AIUA 4QF3A 4IC2A 4UI9B 4F52B 2Y43A 4WZ2A 1Z2QA 2QIZA 1WEPA 2EODA 2I50A 1WEMA 2KWOA 3L1XA 3MHSA 1FBVA 3U5PA 4YAXA 5JG6A 3KV5A 1BORA 4XI1A 3GL6A 2XB1A 4YBSA 1MM2A 1WE9A 3N9QA 2E6RA 4FIPA 2CKLA 2LQ6A 2Y1NA 2E6SA 3LQJA 3GV4A 1DVPA 5G04B 2MIQA 3RTRB 2XEUA 2KGIA 2YUCA 3SHBA 2KWNA 2OXQC 3ASLA 2ECIA 5B75A 3N9PA 4YBMA 2KREA 2YU4A 3PUQA 4AYCB 5TRBA 3PURA 4LK9A 3NG2A 4PPEA 2ZETC 2G6QA 4BHWA 2K16A 2KU3A 5C11A 1HYJA 3EB5A 5B76A 2VJFA 3C6WA 4IC3A 2DX8A 1FP0A 3RPGC 3ZNIA 2YHNA 4ZDTA 3ZYQA 1CHCA 1WEOA 1T1HA 2D8SA 2YSMA 4NN2A 2ECJA 3O33A 3IHPA 2KWJA 4A0CD 2MNYA 2LXPC 4LLBA 4A4BA 2HDPA 5FB1A 2K4DA 4I7CA 2YW8A 5LKTA 2YURA 5B79A 2JMJA 4I7BA 3N9OA 2VJEB 2QJ0A 4GNDA 1WGMA 1K2FA 4ZUXU 2MA5A 4YBTA 2KR4A 1IYMA 2G43A 2VPBA 1V87A 2H0DB 1LDKC 3LQIA 4S3OB 2Y1MA 1WENA 5D1LB 3HCSA 2LGVA 2VPGA 3KNVA 1X4JA 1WILA 3O36A 2ECGA 1F62A 2FUUA 2YREA 2MD7B 2QICA 3EB6A 4V3KC 2F42A 5EYAF 4P5OB 2KIZA 4MSXA 1E4UA 4LKAA 2LV9A 4N3WA 5KH3A 2YT5A 4YC9A 1WEWA 1G25A 4L7XA 2VNFA 3HTKC 2YQLA 1Z60A 1HYIA 2LDRA 4R8PK 1U6GB 2YYRA 2L75A 2M3HA 4CCGX 3KQIA 1LDJB 1JM7A 2NAAA 5LKZA 2CKLB 4UP0A 2ECTA 3M63A 2HYED 2KYUA 2MD8C 2JRJA 2YQMA 4GNGA 1WFKA 2CSZA 1N87A 2F6NA 4MVTA 1Z6UA 3SOUA 1WEVA 3KV6A 2ECVA 4X3GA 4WZ3B 4GNFA 3O70A 3C5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B77 A;  1VYX A;  3N9L A;  2JMD A;  4AUQ B;  3VK6 A;  3O7A A;  2PUY A;  5H1U A;  5DKA A;  2L80 A;  2CT2 A;  2VJF B;  3O34 A;  2G45 A;  2YHO A;  2KFT A;  2L43 A;  3DPL R;  3RPG B;  5TDR A;  2BAY A;  2LGL A;  4I7D A;  2VP7 A;  5LKX A;  4YAT A;  5G0F A;  4Q6F A;  3DQV R;  3ZTG A;  2YSJ A;  2LGG A;  3LQH A;  2LRI C;  5LCW B;  2LN0 A;  2PNX A;  2UZG A;  4CA1 A;  4GNE A;  2LGK A;  2RSD A;  5TAB A;  2KWK A;  2F6J A;  2AN6 A;  2FSA A;  2CSY A;  5D1M B;  2M1R A;  2MUM A;  4AVX A;  1WEU A;  4AP4 A;  4L58 A;  1WIM A;  1WES A;  3SOX A;  3QZV A;  2EGP A;  3L1Z B;  2K17 A;  3O37 A;  5FER A;  2KE1 A;  5H1V A;  4UP5 A;  2VPD A;  4TKP B;  4YAD A;  3T7L A;  2VPE A;  2C2L A;  5H9M A;  1RMD A;  1X4I A;  1ZBD B;  2RI7 A;  1WEE A;  2LXH C;  3ZPV E;  4C9Z A;  4V3L C;  5B8D A;  2KGG A;  4YAB A;  2M6M A;  3N9M A;  3L11 A;  5C13 A;  1WEQ A;  4AYC A;  1VD4 A;  5KH7 A;  5B78 A;  4A4C A;  3ZVZ B;  4FK5 A;  2ECN A;  3FL2 A;  3I2D A;  4ZQL A;  1MM3 A;  5J3X A;  4LJN A;  5H1T A;  4B7Y C;  5FEY A;  5LKU A;  3LRQ A;  2L5U A;  4QF2 A;  3V43 A;  2MNZ A;  4N4F A;  3HCT A;  5AIT A;  5TBN A;  3O35 A;  2MT5 A;  1JM7 B;  2L0B A;  4A49 A;  3SOW A;  3MHH A;  2C2V S;  2IDA A;  5G05 B;  2JMI A;  2FUI A;  3N9N A;  1XWH A;  3ZVY A;  5DIN A;  4W4U A;  5D1K B;  5TDW A;  1JOC A;  3PHD A;  4GB0 A;  5FB0 A;  4WA6 A;  4R7E A;  1VFY A;  4FJC A;  2VJE A;  4B86 C;  3ZPV 1;  2MA6 A;  3U5M A;  3T6R A;  1X4U A;  2ECW A;  2M85 A;  2K1J A;  4LAD B;  2H0D A;  4BBQ A;  4S3O C;  5I3L A;  3M99 A;  3M62 A;  4FO9 A;  3U5N A;  5KH9 A;  4O64 A;  4R2Y A;  2EA6 A;  4WZ0 A;  3U5O A;  4PTB A;  3HCU A;  5AIU A;  4QF3 A;  4IC2 A;  4UI9 B;  4F52 B;  2Y43 A;  4WZ2 A;  1Z2Q A;  2QIZ A;  1WEP A;  2EOD A;  2I50 A;  1WEM A;  2KWO A;  3L1X A;  3MHS A;  1FBV A;  3U5P A;  4YAX A;  5JG6 A;  3KV5 A;  1BOR A;  4XI1 A;  3GL6 A;  2XB1 A;  4YBS A;  1MM2 A;  1WE9 A;  3N9Q A;  2E6R A;  4FIP A;  2CKL A;  2LQ6 A;  2Y1N A;  2E6S A;  3LQJ A;  3GV4 A;  1DVP A;  5G04 B;  2MIQ A;  3RTR B;  2XEU A;  2KGI A;  2YUC A;  3SHB A;  2KWN A;  2OXQ C;  3ASL A;  2ECI A;  5B75 A;  3N9P A;  4YBM A;  2KRE A;  2YU4 A;  3PUQ A;  4AYC B;  5TRB A;  3PUR A;  4LK9 A;  3NG2 A;  4PPE A;  2ZET C;  2G6Q A;  4BHW A;  2K16 A;  2KU3 A;  5C11 A;  1HYJ A;  3EB5 A;  5B76 A;  2VJF A;  3C6W A;  4IC3 A;  2DX8 A;  1FP0 A;  3RPG C;  3ZNI A;  2YHN A;  4ZDT A;  3ZYQ A;  1CHC A;  1WEO A;  1T1H A;  2D8S A;  2YSM A;  4NN2 A;  2ECJ A;  3O33 A;  3IHP A;  2KWJ A;  4A0C D;  2MNY A;  2LXP C;  4LLB A;  4A4B A;  2HDP A;  5FB1 A;  2K4D A;  4I7C A;  2YW8 A;  5LKT A;  2YUR A;  5B79 A;  2JMJ A;  4I7B A;  3N9O A;  2VJE B;  2QJ0 A;  4GND A;  1WGM A;  1K2F A;  4ZUX U;  2MA5 A;  4YBT A;  2KR4 A;  1IYM A;  2G43 A;  2VPB A;  1V87 A;  2H0D B;  1LDK C;  3LQI A;  4S3O B;  2Y1M A;  1WEN A;  5D1L B;  3HCS A;  2LGV A;  2VPG A;  3KNV A;  1X4J A;  1WIL A;  3O36 A;  2ECG A;  1F62 A;  2FUU A;  2YRE A;  2MD7 B;  2QIC A;  3EB6 A;  4V3K C;  2F42 A;  5EYA F;  4P5O B;  2KIZ A;  4MSX A;  1E4U A;  4LKA A;  2LV9 A;  4N3W A;  5KH3 A;  2YT5 A;  4YC9 A;  1WEW A;  1G25 A;  4L7X A;  2VNF A;  3HTK C;  2YQL A;  1Z60 A;  1HYI A;  2LDR A;  4R8P K;  1U6G B;  2YYR A;  2L75 A;  2M3H A;  4CCG X;  3KQI A;  1LDJ B;  1JM7 A;  2NAA A;  5LKZ A;  2CKL B;  4UP0 A;  2ECT A;  3M63 A;  2HYE D;  2KYU A;  2MD8 C;  2JRJ A;  2YQM A;  4GNG A;  1WFK A;  2CSZ A;  1N87 A;  2F6N A;  4MVT A;  1Z6U A;  3SOU A;  1WEV A;  3KV6 A;  2ECV A;  4X3G A;  4WZ3 B;  4GNF A;  3O70 A;  3C5K A; 
#chains in the Genus database with same CATH topology
 3T9K A;  5B77 A;  1VYX A;  3N9L A;  2JMD A;  4AUQ B;  3VK6 A;  3O7A A;  2PUY A;  5H1U A;  5DKA A;  2OWA A;  2L80 A;  2CT2 A;  2VJF B;  2CSV A;  3O34 A;  2G45 A;  2YHO A;  2KFT A;  2L43 A;  3DPL R;  2FD4 A;  3RPG B;  4F1P A;  5TDR A;  2BAY A;  2LGL A;  4I7D A;  4Z0O A;  2VP7 A;  5LKX A;  4YAT A;  5G0F A;  1DCQ A;  4Q6F A;  3DQV R;  3ZTG A;  2YSJ A;  2LGG A;  3LQH A;  2LRI C;  5LCW B;  2LN0 A;  2PNX A;  2UZG A;  3H7H A;  4CA1 A;  4GNE A;  2LGK A;  2RSD A;  3DDT A;  2L7P A;  5TAB A;  2KWK A;  2F6J A;  2AN6 A;  5SVI A;  2FSA A;  2CSY A;  5SVX A;  5D1M B;  2M1R A;  2MUM A;  4AVX A;  1WEU A;  4AP4 A;  3JUE A;  4L58 A;  1WIM A;  1WES A;  3SOX A;  3QZV A;  2EGP A;  3L1Z B;  2K17 A;  3O37 A;  5FER A;  2KE1 A;  5H1V A;  4UP5 A;  2VPD A;  3FEH A;  4TKP B;  3KDE C;  3DWD A;  4YAD A;  3T7L A;  2VPE A;  2C2L A;  5K3Q A;  5H9M A;  1RMD A;  1X4I A;  1ZBD B;  2RI7 A;  4QQ4 A;  1WEE A;  2LXH C;  3ZPV E;  4C9Z A;  4V3L C;  5B8D A;  2KGG A;  4YAB A;  4Z0R A;  2M6M A;  3N9M A;  3L11 A;  5C13 A;  1WEQ A;  4AYC A;  1VD4 A;  5KH7 A;  5B78 A;  4A4C A;  3ZVZ B;  2YVR A;  4FK5 A;  2ECN A;  3FL2 A;  3I2D A;  3FAO A;  4ZQL A;  1MM3 A;  5J3X A;  4LJN A;  5H1T A;  4B7Y C;  5FEY A;  5LKU A;  3LRQ A;  2L5U A;  4QF2 A;  2CON A;  2B0O E;  3V43 A;  4OGE A;  2MNZ A;  4N4F A;  1MBM A;  3HCT A;  5AIT A;  2KKX A;  5TBN A;  3O35 A;  2MT5 A;  1JM7 B;  2L0B A;  4A49 A;  3SOW A;  3MHH A;  2C2V S;  2IDA A;  5G05 B;  2JMI A;  2FUI A;  3N9N A;  1XWH A;  3ZVY A;  3FJU B;  3Q1D A;  5DIN A;  4W4U A;  5D1K B;  5TDW A;  1JOC A;  3PHD A;  4GB0 A;  5FB0 A;  4WA6 A;  4R7E A;  1VFY A;  4FJC A;  2VJE A;  4B86 C;  3ZPV 1;  2MA6 A;  3U5M A;  3T6R A;  1X4U A;  2ECW A;  2M85 A;  2K1J A;  4LAD B;  2CRR A;  3O47 A;  3FAN A;  2H0D A;  4BBQ A;  4S3O C;  5I3L A;  2DSM A;  2DJA A;  3M99 A;  3M62 A;  4FO9 A;  3U5N A;  5KH9 A;  4O64 A;  4R2Y A;  3LVR E;  2EA6 A;  4WZ0 A;  3U5O A;  4PTB A;  3HCU A;  5AIU A;  4QF3 A;  4IC2 A;  4UI9 B;  4F52 B;  2Y43 A;  4WZ2 A;  1Z2Q A;  2QIZ A;  1WEP A;  2EOD A;  2I50 A;  1WEM A;  2KWO A;  3L1X A;  3MHS A;  1FBV A;  3U5P A;  4YAX A;  5JG6 A;  5SVI B;  3KV5 A;  1BOR A;  3E2D A;  2MKE A;  4XI1 A;  2LAU A;  3GL6 A;  2E61 A;  2XB1 A;  4YBS A;  3LVQ E;  1MM2 A;  1WE9 A;  3N9Q A;  2E6R A;  4FIP A;  2CKL A;  2LQ6 A;  2Y1N A;  2E6S A;  2M13 A;  2XOC A;  3LQJ A;  3GV4 A;  1DVP A;  5G04 B;  2MIQ A;  3RTR B;  5SVY A;  2XEU A;  2KGI A;  2YUC A;  2XOY A;  3SHB A;  2KWN A;  2OXQ C;  3ASL A;  2ECI A;  5B75 A;  3N9P A;  3LDY A;  4YBM A;  2KRE A;  2YU4 A;  3PUQ A;  4AYC B;  5TRB A;  3PUR A;  4LK9 A;  4O62 A;  3NG2 A;  2XP0 A;  4PPE A;  2ZET C;  2G6Q A;  2P57 A;  4BHW A;  2K16 A;  2KU3 A;  5C11 A;  1HYJ A;  3EB5 A;  5B76 A;  2VJF A;  3C6W A;  4IC3 A;  3PLW A;  2DX8 A;  1FP0 A;  3RPG C;  3ZNI A;  2YHN A;  4ZDT A;  3ZYQ A;  1CHC A;  1WEO A;  1T1H A;  2D8S A;  2YSM A;  4NN2 A;  2ECJ A;  3O33 A;  3IHP A;  2KWJ A;  4A0C D;  2MNY A;  2LXP C;  4LLB A;  3SUB A;  4A4B A;  2HDP A;  5FB1 A;  2K4D A;  4I7C A;  2YW8 A;  5LKT A;  2YUR A;  5B79 A;  2JMJ A;  4I7B A;  3N9O A;  2VJE B;  2IQJ A;  4H9D A;  2QJ0 A;  4GND A;  4OGC A;  1WGM A;  1K2F A;  4ZUX U;  2EGM A;  2RR4 A;  2MA5 A;  4YBT A;  2KR4 A;  1IYM A;  2G43 A;  2EXU A;  2VPB A;  1V87 A;  2H0D B;  1LDK C;  3LQI A;  4S3O B;  2Y1M A;  1WEN A;  5D1L B;  3HCS A;  2LGV A;  2VPG A;  3KNV A;  1X4J A;  2XOZ A;  1WIL A;  3O36 A;  2D8U A;  2ECG A;  1F62 A;  2FUU A;  2YRE A;  2MD7 B;  2QIC A;  3EB6 A;  4V3K C;  2F42 A;  5EYA F;  4P5O B;  2KIZ A;  4MSX A;  1E4U A;  2CRW A;  4LKA A;  2LV9 A;  4N3W A;  5KH3 A;  2YT5 A;  2JM3 A;  1WEW A;  4YC9 A;  1G25 A;  4L7X A;  2JUN A;  2VNF A;  3HTK C;  2YQL A;  1Z60 A;  2FFW A;  1HYI A;  2LDR A;  3LJU X;  4R8P K;  1U6G B;  2YYR A;  2L75 A;  2M3H A;  4CCG X;  3KQI A;  1LDJ B;  1JM7 A;  2NAA A;  5LKZ A;  2CKL B;  4UP0 A;  2ECT A;  3M63 A;  2HYE D;  2KYU A;  2JRJ A;  2YQM A;  4GNG A;  2MD8 C;  3M7K A;  1WFK A;  2CSZ A;  1N87 A;  2F6N A;  4MVT A;  1Z6U A;  3SOU A;  1WEV A;  3FM8 C;  3KV6 A;  2ECV A;  3MDB C;  2KKY A;  4X3G A;  4WZ3 B;  4GNF A;  3O70 A;  3C5K A; 
#chains in the Genus database with same CATH homology
 5B77 A;  1VYX A;  3N9L A;  2JMD A;  4AUQ B;  3VK6 A;  3O7A A;  2PUY A;  5H1U A;  5DKA A;  2L80 A;  2CT2 A;  2VJF B;  3O34 A;  2G45 A;  2YHO A;  2KFT A;  2L43 A;  3DPL R;  3RPG B;  5TDR A;  2BAY A;  2LGL A;  4I7D A;  2VP7 A;  5LKX A;  4YAT A;  5G0F A;  4Q6F A;  3DQV R;  3ZTG A;  2YSJ A;  2LGG A;  3LQH A;  2LRI C;  5LCW B;  2LN0 A;  2PNX A;  2UZG A;  4CA1 A;  4GNE A;  2LGK A;  2RSD A;  5TAB A;  2KWK A;  2F6J A;  2AN6 A;  2FSA A;  2CSY A;  5D1M B;  2M1R A;  2MUM A;  4AVX A;  1WEU A;  4AP4 A;  4L58 A;  1WIM A;  1WES A;  3SOX A;  3QZV A;  2EGP A;  3L1Z B;  2K17 A;  3O37 A;  5FER A;  2KE1 A;  5H1V A;  4UP5 A;  2VPD A;  4TKP B;  4YAD A;  3T7L A;  2VPE A;  2C2L A;  5H9M A;  1RMD A;  1X4I A;  1ZBD B;  2RI7 A;  1WEE A;  2LXH C;  3ZPV E;  4C9Z A;  4V3L C;  5B8D A;  2KGG A;  4YAB A;  2M6M A;  3N9M A;  3L11 A;  5C13 A;  1WEQ A;  4AYC A;  1VD4 A;  5KH7 A;  5B78 A;  4A4C A;  3ZVZ B;  4FK5 A;  2ECN A;  3FL2 A;  3I2D A;  4ZQL A;  1MM3 A;  5J3X A;  4LJN A;  5H1T A;  4B7Y C;  5FEY A;  5LKU A;  3LRQ A;  2L5U A;  4QF2 A;  3V43 A;  2MNZ A;  4N4F A;  3HCT A;  5AIT A;  5TBN A;  3O35 A;  2MT5 A;  1JM7 B;  2L0B A;  4A49 A;  3SOW A;  3MHH A;  2C2V S;  2IDA A;  5G05 B;  2JMI A;  2FUI A;  3N9N A;  1XWH A;  3ZVY A;  5DIN A;  4W4U A;  5D1K B;  5TDW A;  1JOC A;  3PHD A;  4GB0 A;  5FB0 A;  4WA6 A;  4R7E A;  1VFY A;  4FJC A;  2VJE A;  4B86 C;  3ZPV 1;  2MA6 A;  3U5M A;  3T6R A;  1X4U A;  2ECW A;  2M85 A;  2K1J A;  4LAD B;  2H0D A;  4BBQ A;  4S3O C;  5I3L A;  3M99 A;  3M62 A;  4FO9 A;  3U5N A;  5KH9 A;  4O64 A;  4R2Y A;  2EA6 A;  4WZ0 A;  3U5O A;  4PTB A;  3HCU A;  5AIU A;  4QF3 A;  4IC2 A;  4UI9 B;  4F52 B;  2Y43 A;  4WZ2 A;  1Z2Q A;  2QIZ A;  1WEP A;  2EOD A;  2I50 A;  1WEM A;  2KWO A;  3L1X A;  3MHS A;  1FBV A;  3U5P A;  4YAX A;  5JG6 A;  3KV5 A;  1BOR A;  4XI1 A;  3GL6 A;  2XB1 A;  4YBS A;  1MM2 A;  1WE9 A;  3N9Q A;  2E6R A;  4FIP A;  2CKL A;  2LQ6 A;  2Y1N A;  2E6S A;  3LQJ A;  3GV4 A;  1DVP A;  5G04 B;  2MIQ A;  3RTR B;  2XEU A;  2KGI A;  2YUC A;  3SHB A;  2KWN A;  2OXQ C;  3ASL A;  2ECI A;  5B75 A;  3N9P A;  4YBM A;  2KRE A;  2YU4 A;  3PUQ A;  4AYC B;  5TRB A;  3PUR A;  4LK9 A;  3NG2 A;  4PPE A;  2ZET C;  2G6Q A;  4BHW A;  2K16 A;  2KU3 A;  5C11 A;  1HYJ A;  3EB5 A;  5B76 A;  2VJF A;  3C6W A;  4IC3 A;  2DX8 A;  1FP0 A;  3RPG C;  3ZNI A;  2YHN A;  4ZDT A;  3ZYQ A;  1CHC A;  1WEO A;  1T1H A;  2D8S A;  2YSM A;  4NN2 A;  2ECJ A;  3O33 A;  3IHP A;  2KWJ A;  4A0C D;  2MNY A;  2LXP C;  4LLB A;  4A4B A;  2HDP A;  5FB1 A;  2K4D A;  4I7C A;  2YW8 A;  5LKT A;  2YUR A;  5B79 A;  2JMJ A;  4I7B A;  3N9O A;  2VJE B;  2QJ0 A;  4GND A;  1WGM A;  1K2F A;  4ZUX U;  2MA5 A;  4YBT A;  2KR4 A;  1IYM A;  2G43 A;  2VPB A;  1V87 A;  2H0D B;  1LDK C;  3LQI A;  4S3O B;  2Y1M A;  1WEN A;  5D1L B;  3HCS A;  2LGV A;  2VPG A;  3KNV A;  1X4J A;  1WIL A;  3O36 A;  2ECG A;  1F62 A;  2FUU A;  2YRE A;  2MD7 B;  2QIC A;  3EB6 A;  4V3K C;  2F42 A;  5EYA F;  4P5O B;  2KIZ A;  4MSX A;  1E4U A;  4LKA A;  2LV9 A;  4N3W A;  5KH3 A;  2YT5 A;  4YC9 A;  1WEW A;  1G25 A;  4L7X A;  2VNF A;  3HTK C;  2YQL A;  1Z60 A;  1HYI A;  2LDR A;  4R8P K;  1U6G B;  2YYR A;  2L75 A;  2M3H A;  4CCG X;  3KQI A;  1LDJ B;  1JM7 A;  2NAA A;  5LKZ A;  2CKL B;  4UP0 A;  2ECT A;  3M63 A;  2HYE D;  2KYU A;  2MD8 C;  2JRJ A;  2YQM A;  4GNG A;  1WFK A;  2CSZ A;  1N87 A;  2F6N A;  4MVT A;  1Z6U A;  3SOU A;  1WEV A;  3KV6 A;  2ECV A;  4X3G A;  4WZ3 B;  4GNF A;  3O70 A;  3C5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...