The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
25
|
sequence length |
89
|
structure length |
89
|
Chain Sequence |
MGFTDETVRFDFDDNRKKAISETLETVYRALEEKGYNPINQIVGYLLSGDPAYIPRYQDARNLIRRHERDEIMEELTKYYLANHGIDIK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Structural genomics
|
| molecule keywords |
UPF0297 protein EF_1202
|
| publication title |
Structure and Dimerization of IreB, a Negative Regulator of Cephalosporin Resistance in Enterococcus faecalis.
pubmed doi rcsb |
| source organism |
Enterococcus faecalis (strain atcc 700802 / v583)
|
| total genus |
25
|
| structure length |
89
|
| sequence length |
89
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2017-02-13 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF06135 | IreB | IreB regulatory phosphoprotein |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
