5UZ5K

S. cerevisiae u1 snrnp
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
131
structure length
124
Chain Sequence
KIQVAHSSRLANLIDYKLRVLTQDGRVYIGQLMAFDKHMNLVLNECIEERVPKTQLDKLRPRTLNIKVEKRVLGLTILRGEQILSTVVEDKPLLSKKERLVRDKKEKKQAQKQTKLRKEKEKKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CryoEM structure of Saccharomyces cerevisiae U1 snRNP offers insight into alternative splicing.
pubmed doi rcsb
molecule tags Nuclear protein/rna
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
molecule keywords U1 small nuclear ribonucleoprotein 70 kDa homolog
total genus 19
structure length 124
sequence length 131
ec nomenclature
pdb deposition date 2017-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...