5V6XA

Crystal structure of the trna binding domain of pyrrolysyl-trna synthetase mutant (32a ntd) bound to trna(pyl)
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
84
structure length
84
Chain Sequence
b'NNKPLNTLISATGLWMSRTGTIHKIKHHEVSRSKIYIEMACGDHLVVNNSRSSRPARALRYHKYRKTCKRCRVSDEDLNKFLTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyrrolysine--tRNA ligase
publication title Crystal structures reveal an elusive functional domain of pyrrolysyl-tRNA synthetase.
pubmed doi rcsb
source organism Methanosarcina mazei (strain atcc baa-159 / dsm 3647 / goe1 / go1 / jcm 11833 /
molecule tags Ligase/rna
total genus 25
structure length 84
sequence length 84
chains with identical sequence B
ec nomenclature ec 6.1.1.26: Pyrrolysine--tRNA(Pyl) ligase.
pdb deposition date 2017-03-17
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...