5W08H

A/texas/50/2012(h3n2) influenza hemagglutinin in complex with k03.12 fab
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
212
structure length
212
Chain Sequence
SALTQPASVSGSPGQSVTISCTGTNSDVGTFDLVSWYQQYPGKAPKLIIYEGSRRPSGVSDRFSGSKSGNTASLTISGLQAEDEADYYCSSYAGSVVFGGGTKLTVLGQPKGAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords Hemagglutinin HA1
publication title Memory B Cells that Cross-React with Group 1 and Group 2 Influenza A Viruses Are Abundant in Adult Human Repertoires.
pubmed doi rcsb
source organism Influenza a virus (a/texas/50/2012(h3n2))
total genus 40
structure length 212
sequence length 212
chains with identical sequence J, L, N, P, R
ec nomenclature
pdb deposition date 2017-05-30
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...