5WHQA

Crystal structure of the catalase-peroxidase from neurospora crassa at 2.9 a
Total Genus 220
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
220
sequence length
735
structure length
711
Chain Sequence
RKSNVGGGGTRNHDWWPAQLRLNILRQHTPVSNPLDKDFDYAAAFKSLDYEGLKKDLTKLMTDSQDWWPADFGHYGGLFIRMAWHSAGTYRVTDGRGGGGEGQQRFAPLNSWPDNVSLDKARRLLWPIKQKYGNKISWSDLLLLTGNVALESMGFKTFGFAGGRPDTWEADESVYWGAETTWLGNEDRYSHNRDLQSPLASSHMGLIYVNPEGPDGIPDPVASAKDIRVTFGRMAMNDEETVALIAGGHSFGKTHGAGPTHHVGKEPEAAPIEHQGLGWANSFGQGKGPDTITSGLEVTWTPTPTKWGMGYLEYLYKFDWEPTKSPAGANQWVAKNAEPTIPDAYDPNKKKLPTMLTTDIALRMDPAYDKICRDYLANPDKFADAFARAWFKLLHRDMGPRTRWIGPEVPSEILPWEDYIPPVDYQIIDDNDIAALKKEILATGVAPKKLIFVAWSSASSFRGSDKRGGANGARIRLAPQNEWKVNDPSTLREVLAALESVQQKFNDSSSGKKVSLADLIVLGGVAALEQASGLVVPFTPGRNDATQEHTDVHSFTHLEPHADGFRSYGKGTKRVRTEQFLIDRASLLTLSAPELTALIGGLRVLEANYDGSSYGVLTKTPGKLTNDYFVNLLDTNTAWKAADNEGEVFIGYDRKTHDKKWTATRADLIFGAHAELRALAEVYAAVDGEEKFKRDFVAAWHKVMNLDRFDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Catalase-peroxidase
publication title Structure, kinetics, molecular and redox properties of a cytosolic and developmentally regulated fungal catalase-peroxidase.
pubmed doi rcsb
source organism Neurospora crassa
total genus 220
structure length 711
sequence length 735
chains with identical sequence B
ec nomenclature ec 1.11.1.21: Catalase peroxidase.
pdb deposition date 2017-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00141 peroxidase Peroxidase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...