5WLCSI

The complete structure of the small subunit processome
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
1124
structure length
802
Chain Sequence
TMQRSSDVNERKLHVPMVDRTPEDDPPPFIVAVVGPPGTGKTTLIRSLVRRMTKSTLNDIQGPITVVSGKHRRLTFLECPADDLNAMIDIAKIADLVLLLIDGNFGFEMETMEFLNIAQHHGMPRVLGVATHLDLFKSQSTLRASKKRLKHRFWTEVYQGAKLFYLSGVINGRYPDREILNLSRFISVMKFRPLKWRNEHPYMLADRFTDLTHPELIETQGLQIDRKVAIYGYLHGTPLPSAPGTRVHIAGVGDFSVAQIEKLPDPCPTPFRKRLDDKDKLIYAPMSDVGGVLMDKDAVYIDIGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNIGKLIYMDNISPEECIRRWRGVDLEKFVPYFDTFEKLAKKWKSVDAIKERFLTWYELQKAKISKQLEINNIEYQEMTPEQRQRIEGFKAGSYVRIVFEKVPMEFVKNFNPKFPIVMGGLLPTEIKFGIVKARLRRHRWHKKILKTNDPLVLSLGWRRFQTLPIYTTTDSRTRTRMLKYTPEHTYCNAAFYGPLCSPNTPFCGVQIVANSDTGNGFRIAATGIVEEIDVNIEIVKKLKLVGFPYKIFKNTAFIKDMFSSAMEVARFEGAQIKTVSGIRGEIKRALSKPEGHYRAAFEDKILMSDIVILRSWYPVRVKKFYNPVTSLLLKEKTEWKGLRLTGQIRAAMNLETPSNPDSAYHKIERVERHFNGLKVPKAVQKELPFKSQIHQMKPQKKKTYMAKRAVVLGGDEKKARSFIQKVLTISKAKDSKRKEQKASQRKERLKKLAKMEEEKSQRDKEKKKEYFAQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ribosome
molecule keywords 5' ETS
publication title The complete structure of the small-subunit processome.
pubmed doi rcsb
total genus 123
structure length 802
sequence length 1124
ec nomenclature
pdb deposition date 2017-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
SI PF00004 AAA ATPase family associated with various cellular activities (AAA)
SI PF04950 RIBIOP_C 40S ribosome biogenesis protein Tsr1 and BMS1 C-terminal
SI PF08142 AARP2CN AARP2CN (NUC121) domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...