5XCAA

Crystal structure of gh45 endoglucanase eg27ii d137a mutant in complex with cellobiose
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
178
structure length
178
Chain Sequence
AQLCQPDAHGVRRFNGRPCASTTRYVDGHKGACGCGQKGSDTPFPWNLQKHVTAPSERYFDDGGSNLWCGKNCGKCVRLTPTGGFVPGKGGAPPNHNPVVFMVTNACPINGNEEWCGISGKPGTNHVNSHGYEVHFALQDQVGQVEALHWDNPEVTWEEVPCPGDLQANYQQCECHNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution crystal structures of the glycoside hydrolase family 45 endoglucanase EG27II from the snail Ampullaria crossean.
pubmed doi rcsb
molecule keywords Endo-beta-1,4-glucanase
molecule tags Hydrolase
source organism Ampullaria crossean
total genus 54
structure length 178
sequence length 178
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2017-03-22
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...