5Z6OA

Crystal structure of penicillium cyclopium protease
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
282
structure length
282
Chain Sequence
ANVVQRNSPSWGLSRISSKKSGATDYVYDSTAGEGIVIYGVDTGIDIGHADFGGRAEWGTNTADNDDTDGNGHGTHTASTAAGSKFGVAKKASVVAVKVLGADGSGTNSQVIAGMDWAVKDSKSRGATGKSVMNMSLGGAYSRAMNDAAANVVRSGVFLSVAAGNEAQDASNSSPASAPNVCTIAASTNSDGSASFTNFGSVVDLYAPGKDITAAYPGGGSKTLSGTSMAAPHVAGAAAYLMALEGTTTSSACARIVQDAITKISGAPKGTTTKLLYNGING
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystallographic structure of the subtilisin protease from Penicillium cyclopium.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords protease
total genus 105
structure length 282
sequence length 282
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2018-01-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...