5ZL1A

Hexameric structure of copper-containing nitrite reductase of an anammox organism ksu-1
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
306
structure length
306
Chain Sequence
MVDVISNVAKDPADIPGRISRSCPKTVTVNLVAKEVVADLAPGKKFWFWTFAEKKGDTVGPATVPGPMVRVMEGDTVVINLTNDLHNEEPHNLDFHAGFGAMLMDIEPGETDTLTFKAKREGAYIYHCGAEGMPWEHVAYGMYGLIVVEPKGGLSRVDKEFYIGQGEWYIKPGIEDHPHIRGYSLDEDKALAEHPDYFTFNGHTQALMDPSIYGNAITVNQGDKVRLFFVAGGPNIGSNFHIIGQIFDKFYPGHRRDFIRNEETAYIPPGSAAVFEFKALATGDFLIVDHALFRVPKGAGGLLHVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Putative copper-type nitrite reductase
publication title Hexameric structure of copper-containing nitrite reductase of an anammox organism KSU-1
rcsb
source organism Candidatus jettenia caeni
total genus 76
structure length 306
sequence length 306
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2018-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...