5ZRLA

M. smegmatis antimutator protein mutt2 in complex with cdp
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
126
structure length
126
Chain Sequence
b'KQIVVAGALISRGTLLVAQRDRPAELAGLWELPGGKVTPGESDADALARELREELGVDVAVGERLGADVALNDAMTLRAYRVTLRSGSPHPHDHRALRWVGADEIDGLAWVPADRAWVPDLVAALS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative mutator protein MutT2/NUDIX hydrolase
publication title Structural insights into the catalysis mechanism of M. smegmatis antimutator protein MutT2
rcsb
source organism Mycobacterium smegmatis (strain atcc 700084 / mc(2)155)
molecule tags Hydrolase
total genus 29
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature
pdb deposition date 2018-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...