5ZUDE

Fit r10 fab coordinates into the cryo-em of ev71 in complex with d6
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
220
structure length
212
Chain Sequence
EVKLVESGGGSVKPGGSLKLSCAASGFSFSTYGMSWVRQTPEKRLEWVATISGGGGYTYYPDSVKGRFTISRDNARNILYLQMSSLRSGDTAMYYCARRVYYFDYWGQGTTLTVSSPKTTPPSVYPLAPATNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus like particle
molecule keywords Capsid protein VP1
publication title CRYO-EM structure of EV71 and its neutralizing antibody D6 Fab
rcsb
source organism Enterovirus a71
total genus 35
structure length 212
sequence length 220
ec nomenclature
pdb deposition date 2018-05-07
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...